#  Percent Identity  Matrix - created by Clustal2.1

#

#

 

     1: AAF86697.1           100.00   85.94   87.13   87.13   86.86

     2: AAF86691.1            85.94  100.00   95.08   94.82   94.56

     3: L0R244|L0R244_HAFAL   87.13   95.08  100.00   99.48   99.22

     4: Q9XB24|Q9XB24_KLEPN   87.13   94.82   99.48  100.00   99.74

     5: ABP49606.1            86.86   94.56   99.22   99.74  100.00

 

CLUSTAL O(1.2.4) multiple sequence alignment

 

 

AAF86697.1               MRKKMQNTLKMLSVITCLALTAQGAMASEMDQAKIKDTVDSLIQPLMQKNNIPGMSVAVT

AAF86691.1               MRKKMQNTLKLLSVITCLAATAQGAMAANIDESKIKDTVDGLIQPLMQKNNIPGMSVAVT

L0R244|L0R244_HAFAL      ----MQNTLKLLSVITCLAATAQGALAANIDESKIKDTVDDLIQPLMQKNNIPGMSVAVT

Q9XB24|Q9XB24_KLEPN      ----MQNTLKLLSVITCLAATVQGALAANIDESKIKDTVDDLIQPLMQKNNIPGMSVAVT

ABP49606.1               ----MQNTLKLLSVITCLAATVQGALAANIDESKIKDTVDDLIQPLMQKNNIPGMSVAVT

                             ******:******** *.***:*:::*::*******.*******************

 

AAF86697.1               LNGKNYIYNYGLASKQPQQPVTDNTLFEVGSLSKTFAATLASYAQVSGKLSLDKSISHYV

AAF86691.1               IRGRNYIYNYGLAAKQPQQPVTENTLFEVGSLSKTFAAILASYAQASGKLSLEQSVSHYV

L0R244|L0R244_HAFAL      VNGKNYIYNYGLAAKQPQQPVTENTLFEVGSLSKTFAATLASYAQLSGKLSLDQSVSHYV

Q9XB24|Q9XB24_KLEPN      VNGKNYIYNYGLAAKQPQQPVTENTLFEVGSLSKTFAATLASYAQVSGKLSLDQSVSHYV

ABP49606.1               VNGKNYIYNYGLAAKQPQQPVTENTLFEVGSLSKTFAATLASYAQVSGKLSLDQSVSHYV

                         :.*:*********:********:*************** ****** ******::*:****

 

AAF86697.1               PELRGSSFDHISVLNAGTHTTGLALFMPEEVKNTDQLMAYLKAWKPADPAGTHRVYSNIG

AAF86691.1               PELRGSSFDHVSVLNVGTHTSGLQLFMPEDIKNTTQLMTYLKAWKPADAAGTHRVYSNIG

L0R244|L0R244_HAFAL      PELRGSSFDHVSVLNVGTHTSGLQLFMPEDIKNTTQLMAYLKAWKPADAAGTHRVYSNIG

Q9XB24|Q9XB24_KLEPN      PELRGSSFDHVSVLNVGTHTSGLQLFMPEDIKNTTQLMAYLKAWKPADAAGTHRVYSNIG

ABP49606.1               PELRGSSFDHVSVLNVGTHTSGLQLFMPEDIKNTTQLMAYLKAWKPADAAGTHRVYSNIG

                         **********:****.****:** *****::*** ***:********* ***********

 

AAF86697.1               TGLLGMIAAQSMGMTYEDAIEKTLLPKLGMTHTYLNVPADQAENYAWGYNKKNEPIHVNM

AAF86691.1               TGLLGMIAAKSLGVSYEDAIEQTILPLLGMNQTYLKVPADQMENYAWGYNKKDEPVHVNM

L0R244|L0R244_HAFAL      TGLLGMIAAKSLGVSYEDAIEKTLLPQLGMHHSYLKVPADQMENYAWGYNKKDEPVHVNM

Q9XB24|Q9XB24_KLEPN      TGLLGMIAAKSLGVSYEDAIEKTLLPQLGMHHSYLKVPADQMENYAWGYNKKDEPVHVNM

ABP49606.1               TGLLGMIAAKSLGVSYEDAIEKTLLPQLGMHHSYLKVPADQMENYAWGYNKKDEPVHGNM

                         *********:*:*::******:*:** *** ::**:***** **********:**:* **

 

AAF86697.1               EVLGNEAYGIRTNASDLIRYVQANMGQLKLDGNSTLQKALTDTHIGYFKSGKITQDLMWE

AAF86691.1               EILGNEAYGIKTTSSDLLRYVQANMGQLKLDGNAKIQHALTATHTGYFKSGEITQDLMWE

L0R244|L0R244_HAFAL      EILGNEAYGIKTTSSDLLRYVQANMGQLKLDANAKMQQALTATHTGYFKSGEITQDLMWE

Q9XB24|Q9XB24_KLEPN      EILGNEAYGIKTTSSDLLRYVQANMGQLKLDANAKMQQALTATHTGYFKSGEITQDLMWE

ABP49606.1               EILGNEAYGIKTTSSDLLRYVQANMGQLKLDANAKMQQALTATHTGYFKSGEITQDLMWE

                         *:********:*.:***:*************.*:.:*:*** ** ******:********

 

AAF86697.1               QLPYPVSLPDLLTGNDMAMTKSVATPIVPPLPPQENVWINKTGSTNGFGAYIAFVPAKKM

AAF86691.1               QLPYPVSLPNLLTGNDMAMTKSVATPIVPPLPPQENVWINKTGSTNGFGAYIAFVPAKKM

L0R244|L0R244_HAFAL      QLPYPVSLPNLLTGNDMAMTKSVATPIVPPLPPQENVWINKTGSTNGFGAYIAFVPAKKM

Q9XB24|Q9XB24_KLEPN      QLPYPVSLPNLLTGNDMAMTKSVATPIVPPLPPQENVWINKTGSTNGFGAYIAFVPAKKM

ABP49606.1               QLPYPVSLPNLLTGNDMAMTKSVATPIVPPLPPQENVWINKTGSTNGFGAYIAFVPAKKM

                         *********:**************************************************

 

AAF86697.1               GIVMLANKNYSIDQRVT-------------

AAF86691.1               GIVMLANKNYSIDQRVTVAYKILSSLEVNK

L0R244|L0R244_HAFAL      GIVMLANKNYSIDQRVTVAYKILSSLEGNK

Q9XB24|Q9XB24_KLEPN      GIVMLANKNYSIDQRVTVAYKILSSLEGNK

ABP49606.1               GIVMLANKNYSIDQRVTVAYKILSSLEGNK

                         *****************