#

#

#  Percent Identity  Matrix - created by Clustal2.1

#

#

 

     1: AHM76779.1           100.00   91.84   91.60   91.60   91.86   92.13   92.13   91.86   92.65   92.65   87.40   87.93   86.58   86.61   87.93   87.37   86.58   86.32   86.32   86.58

     2: BAM34463.1            91.84  100.00   99.74   98.16   98.42   98.68   96.84   96.58   97.89   97.89   88.42   88.95   86.84   87.37   88.95   88.68   87.89   87.63   87.63   87.89

     3: AHA80105.1            91.60   99.74  100.00   97.90   98.16   98.43   96.59   96.85   97.64   97.64   88.71   89.24   87.11   87.66   89.24   88.95   88.16   87.89   87.89   88.16

     4: AFU25653.1            91.60   98.16   97.90  100.00   99.21   99.48   96.59   96.33   97.11   97.11   87.66   88.19   86.05   86.88   88.45   88.16   87.37   87.63   87.63   87.89

     5: ACJ05688.1            91.86   98.42   98.16   99.21  100.00   99.74   96.85   96.59   97.38   97.38   87.93   88.45   86.58   86.88   88.71   88.42   87.63   87.89   87.89   88.16

     6: AHM76771.1            92.13   98.68   98.43   99.48   99.74  100.00   97.11   96.85   97.64   97.64   88.19   88.71   86.58   87.14   88.71   88.42   87.63   87.89   87.89   88.16

     7: ACJ05689.1            92.13   96.84   96.59   96.59   96.85   97.11  100.00   99.74   97.90   97.90   88.19   88.45   86.32   86.88   88.45   87.63   87.11   86.84   86.84   87.11

     8: AHA80106.1            91.86   96.58   96.85   96.33   96.59   96.85   99.74  100.00   97.64   97.64   88.45   88.71   86.58   87.14   88.71   87.89   87.37   87.11   87.11   87.37

     9: AFU25647.1            92.65   97.89   97.64   97.11   97.38   97.64   97.90   97.64  100.00   99.48   88.19   88.71   86.58   87.40   88.98   88.42   87.63   87.37   87.37   87.63

    10: AHM76777.1            92.65   97.89   97.64   97.11   97.38   97.64   97.90   97.64   99.48  100.00   88.19   88.71   86.58   87.40   88.98   88.42   87.63   87.37   87.37   87.63

    11: AFU25650.1            87.40   88.42   88.71   87.66   87.93   88.19   88.19   88.45   88.19   88.19  100.00   98.69   89.74   88.98   90.03   89.74   89.74   89.21   89.21   89.47

    12: AHM76774.1            87.93   88.95   89.24   88.19   88.45   88.71   88.45   88.71   88.71   88.71   98.69  100.00   89.47   88.71   89.76   89.74   89.47   88.95   88.95   89.21

    13: AEI70575.1            86.58   86.84   87.11   86.05   86.58   86.58   86.32   86.58   86.58   86.58   89.74   89.47  100.00   90.53   91.84   92.11   91.58   91.58   91.05   91.32

    14: AEV91214.1            86.61   87.37   87.66   86.88   86.88   87.14   86.88   87.14   87.40   87.40   88.98   88.71   90.53  100.00   97.38   96.32   97.89   96.58   96.58   96.84

    15: ACJ05686.1            87.93   88.95   89.24   88.45   88.71   88.71   88.45   88.71   88.98   88.98   90.03   89.76   91.84   97.38  100.00   97.63   98.16   97.37   97.37   97.63

    16: ABZ81086.1            87.37   88.68   88.95   88.16   88.42   88.42   87.63   87.89   88.42   88.42   89.74   89.74   92.11   96.32   97.63  100.00   97.63   97.89   98.16   98.16

    17: L0R2B4|L0R2B4_ENTAS   86.58   87.89   88.16   87.37   87.63   87.63   87.11   87.37   87.63   87.63   89.74   89.47   91.58   97.89   98.16   97.63  100.00   98.16   98.16   98.43

    18: ABL67017.1            86.32   87.63   87.89   87.63   87.89   87.89   86.84   87.11   87.37   87.37   89.21   88.95   91.58   96.58   97.37   97.89   98.16  100.00   99.48   99.74

    19: AAC45086.2            86.32   87.63   87.89   87.63   87.89   87.89   86.84   87.11   87.37   87.37   89.21   88.95   91.05   96.58   97.37   98.16   98.16   99.48  100.00   99.74

    20: Q0KHB3|Q0KHB3_ENTAS   86.58   87.89   88.16   87.89   88.16   88.16   87.11   87.37   87.63   87.63   89.47   89.21   91.32   96.84   97.63   98.16   98.43   99.74   99.74  100.00

 

 

CLUSTAL O(1.2.4) multiple sequence alignment

 

 

AHM76779.1               -MMKKSFCCALLLAISGSALAAPVSEKQLAEVVANTVTPLMKTQAIPGMAVAVIYQGKPH

BAM34463.1               -MMKKSLCCALLLGLSCSALAAPVSEKQLAEVVANTVTPLMKAQSVPGMAVAVIYQGKSH

AHA80105.1               -MMKKSLCCALLLGLSCSALAAPVSEKQLAEVVANTVTPLMKAQSVPGMAVAVIYQGKSH

AFU25653.1               -MMKKSLCCALLLGISCSALATPVSEKQLAEVVANTVTPLMKAQSVPGMAVAVIYQGKPH

ACJ05688.1               -MMRKSLCCALLLGISCSALATPVSEKQLAEVVANTVTPLMKAQSVPGMAVAVIYQGKPH

AHM76771.1               -MMKKSLCCALLLGISCSALATPVSEKQLAEVVANTVTPLMKAQSVPGMAVAVIYQGKPH

ACJ05689.1               -MMKKSLCCALLLGISCSALAAPVSEKQLAEVVANTVTPLMKAQSIPGMAVAVIYQGKPH

AHA80106.1               -MMKKSLCCALLLGISCSALAAPVSEKQLAEVVANTVTPLMKAQSIPGMAVAVIYQGKPH

AFU25647.1               -MMKKSLCCALLLGISCSALAAPVSEKQLAEVVANTVTPLMKAQSIPGMAVAVIYQGKPH

AHM76777.1               -MMKKSLCCALLLGISCSALAAPVSEKQLAEVVANTITPLMKAQSIPGMAVAVIYQGKPH

AFU25650.1               -MMKKSLCCALLLSTSCAALAAPLSETQLAKVVERTVTPLMKAQSIPGMAVAVIYQGQPH

AHM76774.1               -MMKKSLCCALLLSTSCAALAAPMSETQLAKVVARTVTPLMKAQSIPGMAVAVIYQGQPH

AEI70575.1               -MKTKSLCCALLLSTSCSVLAAPMSEKQLSDVVERTVTPLMKAQAIPGMAVAVIYQGQPH

AEV91214.1               -MMKKSVCCALLLSTSCSVLAAPMSEKQLAEVVERTVTPLMKAQAIPGIAVAVIYQGQPH

ACJ05686.1               -MMTKSLCCALLLSTSCSVLAAPMSEKQLAEVVERTVTPLMKAQAIPGMAVAVIYQGQPH

ABZ81086.1               -MMTKSLCCALLLSTSCSVLAAPMSEKQLAEVVERTVTPLMKAQAIPGMAVAVIYQGQPH

L0R2B4|L0R2B4_ENTAS      MMMTKSLCCALLLSTSCSVLAAPMSEKQLAEVVERTVTPLMKAQAIPGMAVAVIYQGQPH

ABL67017.1               MMMTKSLCCALLLSTSCSVLATPMSEKQLAEVVERTVTPLMKAQAIPGMAVAVIYEGQPH

AAC45086.2               MMMTKSLCCALLLSTSCSVLATPMSEKQLAEVVERTVTPLMKAQAIPGMAVAVIYEGQPH

Q0KHB3|Q0KHB3_ENTAS      MMMTKSLCCALLLSTSCSVLATPMSEKQLAEVVERTVTPLMKAQAIPGMAVAVIYEGQPH

                          *  **.******. * :.**:*:**.**:.** .*:*****:*::**:******:*: *

 

AHM76779.1               YYTFGEADIAAKKPVTPQTLFELGSISKTFTGVLGGDAIARGEISLDDPVTKFWPELTGK

BAM34463.1               YYTFGKADIAANKPVTPQTLFELGSISKTFTGVLGGDAIARGEISLDDPVTRYWPQLTGK

AHA80105.1               YYTFGKADVAANKPVTPQTLFELGSISKTFTGVLGGDAIARGEISLDDPVTRYWPQLTGK

AFU25653.1               YYTFGKADIAANKPVTPQTLFELGSISKTFTGVLGGDAIARGEISLDDPVTRYWPQLTGK

ACJ05688.1               YYTFGKADIAANKPVTPQTLFELGSISKTFTGVLGGDAIARGEISLDDPVTRYWPQLTGK

AHM76771.1               YYTFGKADIAANKPVTPQTLFELGSISKTFTGVLGGDAIARGEISLDDPVTRYWPQLTGK

ACJ05689.1               YYTFGKADIAASKPVTPQTLFELGSISKTFTGVLGGDAIARGEISLDDPVTRYWPQLTGK

AHA80106.1               YYTFGKADVAASKPVTPQTLFELGSISKTFTGVLGGDAIARGEISLDDPVTRYWPQLTGK

AFU25647.1               YYTFGKADIAANKPVTPQTLFELGSISKTFTGVLGGDAIARGEISLDDPVTRYWPQLTGK

AHM76777.1               YYTFGKADIAANKPVTPQTLFELGSISKTFTGVLGGDAIARGEISLDDPVTRYWPQLTGK

AFU25650.1               YFTFGKADVAANTPVTAQTLFELGSISKTFTGVLGGDAIARGEISLGDPVTKYWPELTGK

AHM76774.1               YFTFGKADVAANTPVTAQTLFELGSISKTFTGVLGGDAIARGEISLSDPVTKYWPELTGK

AEI70575.1               YFTFGKADVTANKPVTPQTLFELGSISKTFTGVLGGDAIARGEISLGDPVTKYWPELTGK

AEV91214.1               YFTFGKADVAANKPVTPQTLFELGSISKTFTGVLGGDAIARGEISLGDPVTKYWPELTGK

ACJ05686.1               YFTFGKADVAANKPVTPQTLFELGSISKTFTGVLGGDAIARGEISLGDPVTKYWPELTGK

ABZ81086.1               YFTFGKADVAANKPVTPQTLFELGSISKTFTGVLGGDAIARGEISLGDPVTKYWPELTGK

L0R2B4|L0R2B4_ENTAS      YFTFGKADVAANKPVTPQTLFELGSISKTFTGVLGGDAIARGEISLGDPVTKYWPELTGK

ABL67017.1               YFTFGKADVAANKPVTPQTLFELGSISKTFTGVLGGDAIARGEISLGDPVTKYWPELTGK

AAC45086.2               YFTFGKADVAANKPVTPQTLFELGSISKTFTGVLGGDAIARGEISLGDPVTKYWPELTGK

Q0KHB3|Q0KHB3_ENTAS      YFTFGKADVAANKPVTPQTLFELGSISKTFTGVLGGDAIARGEISLGDPVTKYWPELTGK

                         *:***:**::*..*** *****************************.****::**:****

 

AHM76779.1               QWQGIRMLDLATYTAGGLPLQVPEEVTDNASLLRFYQHWQPQWKPGTTRLYANASIGLFG

BAM34463.1               QWQGIRMLDLATYTAGGLPLQVPDEVTDNASLLRFYQNWQPQWKPGTTRLYANASIGLFG

AHA80105.1               QWQGIRMLDLATYTAGGLPLQVPDEVTDNASLLRFYQNWQPQWKPGTTRLYANASIGLFG

AFU25653.1               QWQGIRMLDLATYTAGGLPLQVPDEVTDNASLLRFYQNWQPQWKSGTTRLYANASIGLFG

ACJ05688.1               QWQGIRMLDLATYTAGGLPLQVPDEVTDNASLLRFYQNWQPQWKPGTTRLYANASIGLFG

AHM76771.1               QWQGIRMLDLATYTAGGLPLQVPDEVTDNASLLRFYQNWQPQWKPGTTRLYANASIGLFG

ACJ05689.1               QWQGIRMLDLATYTAGGLPLQVPDEVTDNAALLRFYQNWQPQWKPGTTRLYANASIGLFG

AHA80106.1               QWQGIRMLDLATYTAGGLPLQVPDEVTDNAALLRFYQNWQPQWKPGTTRLYANASIGLFG

AFU25647.1               QWQGIRMLDLATYTAGGLPLQVPDEVTDNAALLRFYQNWQPQWKPGTTRLYANASIGLFG

AHM76777.1               QWQGIRMLDLATYTAGGLPLQVPDEVTDNAALLRFYQNWQPQWKPGTTRLYANASIGLFG

AFU25650.1               QWQGVRMLDLATYTAGGLPLQVPDEVTDNASLLRFYQSWQPQWAPGTTRLYANASIGLFG

AHM76774.1               QWQGVRMLDLATYTAGGLPLQVPDEVTDNASLLRFYQSWQPQWAPGTTRLYANASIGLFG

AEI70575.1               QWQGIRMLDLATYTAGGLPLQVPDEVTDNTSLLRFYQHWQPQWKPGTTRLYANASIGLFG

AEV91214.1               QWKGIRMLDLATYTAGGLPLQVPDEVTDNASLLRFYQNWQPQWKPGTTRLYANASIGLFG

ACJ05686.1               QWQGIRMLDLATYTAGGLPLQVPDEVTDNASLLRFYQNWQPQWKPGTTRLYANASIGLFG

ABZ81086.1               QWQGIRMLDLATYTAGGLPLQVPDEVADNASLLRFYQNWQPQWKPGTTRLYANTSIGLFG

L0R2B4|L0R2B4_ENTAS      QWQGIRMLDLATYTAGGLPLQVPDEVTDNASLLRFYQNWQPQWKPGTTRLYANASIGLFG

ABL67017.1               QWQGIRMLDLATYTAGGLPLQVPDEVTDNASLLRFYQNWQPQWKPGTTRLYANASIGLFG

AAC45086.2               QWQGIRMLDLATYTAGGLPLQVPDEVKDNASLLRFYQNWQPQWKPGTTRLYANASIGLFG

Q0KHB3|Q0KHB3_ENTAS      QWQGIRMLDLATYTAGGLPLQVPDEVTDNASLLRFYQNWQPQWKPGTTRLYANASIGLFG

                         **:*:******************:** **::****** *****  ********:******

 

AHM76779.1               ALAVKPSGMRYEQAMTKRVFKPLRLNHTWINVPKAEAAHYAWGYRDGKAVHISPGMLDAE

BAM34463.1               ALAVKPSGMPYEQAMTTRVLKPLKLDHTWINVPKAEEAHYAWGYRDGKAVRVSPGMLDAQ

AHA80105.1               ALAVKPSGMPYEQAMTTRVLKPLKLDHTWINVPKAEEAHYAWGYRDGKAVRVSPGMLDAQ

AFU25653.1               ALAVKPSGMPYEQAMTTRVLKPLKLDHTWINVPKAEEAHYAWGYRDGKAVRVSPGMLDAQ

ACJ05688.1               ALAVKPSGMPYEQAMTTRVLKPLKLDHTWINVPKAEEAHYAWGYRDGKAVRVSPGMLDAQ

AHM76771.1               ALAVKPSGMPYEQAMTTRVLKPLKLDHTWINVPKAEEAHYAWGYRDGKAVRVSPGMLDAQ

ACJ05689.1               ALAVKPSGMPFEQAMTTRVLKPLKLDHTWINVPKAEEAHYAWGYRDGKAVRVSPGMLDAQ

AHA80106.1               ALAVKPSGMPFEQAMTTRVLKPLKLDHTWINVPKAEEAHYAWGYRDGKAVRVSPGMLDAQ

AFU25647.1               ALAVKPSGMGYEQAMTTRVLKPLKLDHTWINVPKAEEAHYAWGYRDGKAVRVSPGMLDAQ

AHM76777.1               ALAVKPSGMGYEQAMTTRVLKPLKLDHTWINVPKAEEAHYAWGYRDGKAVRVSPGMLDAQ

AFU25650.1               ALAVKPSGMRFEQAMTERVLKPLNLNHTWINVPKAEEQHYAWGYRDGKAVHVSPGMLDAE

AHM76774.1               ALAVKPSGMRFEQAMTERVLKPLNLNHTWINVPKAEEQHYAWGYRDGKAVHVSPGMLDAE

AEI70575.1               ALAVKPSGMNFEQAMTKRVFKPLKLDHTWINVPKEEEAHYAWGYRDGKAIHVSPGMLDAE

AEV91214.1               ALAVKPSGMSYEQAITTRVFKPLKLDHTWINVPKTEEAHYAWGYRDGKAVHVSPGMLDAE

ACJ05686.1               ALAVKPSGMSYEQAITTRVFKPLKLDHTWINVPKAEEAHYAWGYRDGKAVHVSPGMLDAE

ABZ81086.1               ALAVKPSGMSYEQAITTRVFKPLKLDHTWINVPKAEEAHYAWGYRDGKAVHVSPGMLDAE

L0R2B4|L0R2B4_ENTAS      ALAVKPSGMSYEQAITTRVFKPLKLDHTWINVPKAEEAHYAWGYRDGKAVHVSPGMLDAE

ABL67017.1               ALAVKPSGMSYEQAITTRVFKPLKLDHTWINVPKAEEAHYAWGYRDGKAIHVSPGMLDAE

AAC45086.2               ALAVKPSGMSYEQAITTRVFKPLKLDHTWINVPKAEEAHYAWGYRDGKAVHVSPGMLDAE

Q0KHB3|Q0KHB3_ENTAS      ALAVKPSGMSYEQAITTRVFKPLKLDHTWINVPKAEEAHYAWGYRDGKAVHVSPGMLDAE

                         ********* :***:* **:***.*:******** *  ***********:::*******:

 

AHM76779.1               AYGVKTNVQDMANWVMANMAPENIADASLKQGIALAQSRYWRIGSMYQGLGWEMLNWPVE

BAM34463.1               AYGVKTNVQDMANWVMANMAPEKVADASLKQGIALAQSRYWRIGSMYQGLGWEMLNWPVE

AHA80105.1               AYGVKTNVQDMANWVMANMAPEKVADASLKQGIALAQSRYWRIGSMYQGLGWEMLNWPVE

AFU25653.1               AYGVKTNVQDMANWVMANMAPENVADASLKQGIALAQSRYWRIGSMYQGLGWEMLNWPVE

ACJ05688.1               AYGVKTNVQDMANWVMANMAPENVADASLKQGIALAQSRYWRIGSMYQGLGWEMLNWPVE

AHM76771.1               AYGVKTNVQDMANWVMANMAPENVADASLKQGIALAQSRYWRIGSMYQGLGWEMLNWPVE

ACJ05689.1               AYGMKTNVQDMANWVMANMAPENVADASLKQGISLAQSRYWRIGSMYQGLGWEMLNWPVE

AHA80106.1               AYGMKTNVQDMANWVMANMAPENVADASLKQGISLAQSRYWRIGSMYQGLGWEMLNWPVE

AFU25647.1               AYGVKTNVQDMANWVMANMAPEKVADASLKQGIALAQSRYWRIGSMYQGLGWEMLNWPVE

AHM76777.1               AYGVKTNVQDMANWVMANMAPEKVADASLKQGIALAQSRYWRIGSMYQGLGWEMLNWPVE

AFU25650.1               AYGVKTNVKDMASWVVANMAPDGVQDASLKQGMVLAQSRYWRTGSMYQGLGWEMLNWPVE

AHM76774.1               AYGVKTNVKDMASWVVANMAPDGVQDASLKQGMALAQSRYWRTGSMYQGLGWEMLNWPVE

AEI70575.1               AYGVKTNIQDMASWLKANMNPDALSDSTLKQGIALAQSRYWRVGAMYQGLGWEMLNWPVE

AEV91214.1               AYGVKTNVKDMASWVMVNMKPDSLEDSSLRKGFTLAQSRYWRVGAMYQGLGWEMLNWPVD

ACJ05686.1               AYGVKTNVKDMANWVMVNMKPDSLQDSSLKEGITLAQSRYWRVGAMYQGLGWEMLNWPVD

ABZ81086.1               AYGVKTNVQDMASWVMVNMKPDSLQDNSLRQGIALAQSRYWRVGAMYQGLGWEMLNWPVD

L0R2B4|L0R2B4_ENTAS      AYGVKTNVKDMASWVMVNMKPDSLEESSLRKGLTLAQSRYWRVGAMYQGLGWEMLNWPVD

ABL67017.1               AYGVKTNVQDMASWVMVNMKPDSLQDNSLRKGLTLAQSRYWRVGAMYQGLGWEMLNWPVD

AAC45086.2               AYGVKTNVQDMASWVMVNMKPDSLQDNSLRKGLTLAQSRYWRVGAMYQGLGWEMLNWPVD

Q0KHB3|Q0KHB3_ENTAS      AYGVKTNVQDMASWVMVNMKPDSLQDNSLRKGLTLAQSRYWRVGAMYQGLGWEMLNWPVD

                         ***:***::***.*: .** *: : : :*::*: ******** *:**************:

 

AHM76779.1               AKMVIEGSDNKVALAPLPVAEVNPPAPPVKASWVHKTGSTGGFGSYVAFIPEKQIGIVML

BAM34463.1               ANTVVEGSDSKVALAPLPVAEVNPPAPPVKASWVHKTGSTGGFGSYVAFIPEKQIGIVML

AHA80105.1               ANTVVEGSDSKVALAPLPVAEVNPPAPPVKASWVHKTGSTGGFGSYVAFIPEKQIGIVML

AFU25653.1               ANTVVEGSDSKVALAPLPVVEVNPPAPPVKASWVHKTGSTGGFGSYVAFIPEKQIGIVML

ACJ05688.1               ANTVVEGSDSKVALAPLPVAEVNPPAPPVKASWVHKTGSTGGFGSYVAFIPEKQIGIVML

AHM76771.1               ANTVVEGSDSKVALAPLPVAEVNPPAPPVKASWVHKTGSTGGFGSYVAFIPEKQIGIVML

ACJ05689.1               ANTVIEGSDSKVALAPLPVAEVNPPAPPVKASWVHKTGSTGGFGSYVAFIPEKQIGIVML

AHA80106.1               ANTVIEGSDSKVALAPLPVAEVNPPAPPVKASWVHKTGSTGGFGSYVAFIPEKQIGIVML

AFU25647.1               ANTVIEGSDSKVALAPLPVAEVNPPAPPVKASWVHKTGSTGGFGSYLAFIPEKQIGIVML

AHM76777.1               ANTVIEGSDSKVALAPLPVAEVNPPAPPVKASWVHKTGSTGGFGSYVAFIPEKQIGIVML

AFU25650.1               AKTVVEGSDNKVALAPLPVAEVNPPAPPVKASWVHKTGSTGGFGSYVAFIPEKELGIVML

AHM76774.1               AKTVVEGSDNKVALAPLPVAEVNPPAPPVKASWVHKTGSTGGFGSYVAFIPEKKLGIVML

AEI70575.1               AKTVVEGSDNKVALAPLLVAEVNPPAPPVKASWVHKTGSTGGFGSYVAFIPEKELGIVML

AEV91214.1               AKTVVEGSDNKVALAPLPAREVNPPAPPVNASWVHKTGSTGGFGSYVAFIPEKQLGIVML

ACJ05686.1               AKTVVEGSDNKVALAPLPAREVNPPAPPVNASWVHKTGSTGGFGSYVAFIPEKQLGIVML

ABZ81086.1               AKTVVEGSDNKVALAPLPAREVNPPAPPVNASWVHKTGSTGGFGSYVAFIPEKQLGIVML

L0R2B4|L0R2B4_ENTAS      AKTVVEGSDNKVALAPLPAREVNPPAPPVNASWVHKTGSTGGFGSYVAFIPEKQLGIVML

ABL67017.1               AKTVVEGSDNKVALAPLPAREVNPPAPPVNASWVHKTGSTGGFGSYVAFIPEKQLGIVML

AAC45086.2               AKTVVEGSDNKVALAPLPAREVNPPAPPVNASWVHKTGSTGGFGSYVAFIPEKQLGIVML

Q0KHB3|Q0KHB3_ENTAS      AKTVVEGSDNKVALAPLPAREVNPPAPPVNASWVHKTGSTGGFGSYVAFIPEKQLGIVML

                         *: *:****.******* . *********:****************:******::*****

 

AHM76779.1               ANKSYPNPARVEAAYHILDALQ

BAM34463.1               ANKSYPNPARVEAAYHILEAL-

AHA80105.1               ANKSYPNPARVEAAYHILEALQ

AFU25653.1               ANTSYPNPARVEAAYHILEALQ

ACJ05688.1               ANTSYPNPARVEAAYHILEALQ

AHM76771.1               ANTSYPNPARVEAAYHILEALQ

ACJ05689.1               ANKSYPNPARVEAAYPILDALQ

AHA80106.1               ANKSYPNPARVEAAYPILDALQ

AFU25647.1               ANKSYPNPARVEAAYHILDALQ

AHM76777.1               ANKSYPNPARVEAAYHILDALQ

AFU25650.1               ANKSYPNPARVEAAYRILSALQ

AHM76774.1               ANKSYPNPARVEAAYRILSALQ

AEI70575.1               ANKSYPNPARVEAAYRILSAL-

AEV91214.1               ANKSYPNPARVEAAYRILDALQ

ACJ05686.1               ANKSYPNPARVEAAYRILDALQ

ABZ81086.1               ANKSYPNPARVEAAYRILSAL-

L0R2B4|L0R2B4_ENTAS      ANKSYPNPARVEAAYRILSAL-

ABL67017.1               ANKSYPNPARVEAAYRILSAL-

AAC45086.2               ANKSYPNPARVEAAYRILSAL-

Q0KHB3|Q0KHB3_ENTAS      ANKSYPNPARVEAAYRILSAL-

                         **.************ **.**