#

#

#  Percent Identity  Matrix - created by Clustal2.1

#

#

 

     1: ACJ61335.1           100.00   98.66   98.66   98.66   98.99   45.26   46.32   46.32   46.32   45.61   45.96   46.32   44.75   45.08   42.86   44.64   45.36   45.00   45.36   45.00   45.00   45.00   44.64   45.00   45.00   45.00   44.64   45.00   45.00   45.36   45.00   45.00   45.00   44.64   45.00   45.00   45.00

     2: AFI72872.1            98.66  100.00   99.33   99.33   99.66   45.26   45.96   45.96   46.32   45.61   45.96   46.32   44.75   45.08   43.21   45.00   45.71   45.36   45.71   45.36   45.36   45.36   45.00   45.36   45.36   45.36   45.00   45.36   45.36   45.71   45.36   45.36   45.36   45.00   45.36   45.36   45.36

     3: AAO59455.1            98.66   99.33  100.00   99.33   99.66   45.26   45.96   45.96   46.32   45.61   45.96   46.32   44.75   45.08   43.21   45.00   45.71   45.36   45.71   45.36   45.36   45.36   45.00   45.36   45.36   45.36   45.00   45.36   45.36   45.71   45.36   45.36   45.36   45.00   45.36   45.36   45.36

     4: AAF61417.1            98.66   99.33   99.33  100.00   99.66   45.26   45.96   45.96   46.32   45.61   45.96   46.32   44.41   44.75   43.21   45.00   45.71   45.36   45.71   45.36   45.36   45.36   45.00   45.36   45.36   45.36   45.00   45.36   45.36   45.71   45.36   45.36   45.36   45.00   45.36   45.36   45.36

     5: N1NTC9|N1NTC9_9GAMM   98.99   99.66   99.66   99.66  100.00   45.26   45.96   45.96   46.32   45.61   45.96   46.32   44.75   45.08   43.21   45.00   45.71   45.36   45.71   45.36   45.36   45.36   45.00   45.36   45.36   45.36   45.00   45.36   45.36   45.71   45.36   45.36   45.36   45.00   45.36   45.36   45.36

     6: AAC09012.1            45.26   45.26   45.26   45.26   45.26  100.00   81.60   81.60   86.46   86.11   86.11   86.11   86.46   86.81   49.82   48.76   49.47   49.12   49.47   49.47   49.12   49.47   49.12   49.47   49.47   49.47   49.82   49.47   49.47   49.12   49.47   49.47   49.12   49.47   49.47   49.47   49.47

     7: AAM74565.1            46.32   45.96   45.96   45.96   45.96   81.60  100.00   98.96   89.24   84.03   84.38   84.03   84.38   84.72   49.82   49.12   49.47   49.12   49.47   49.47   49.12   49.47   49.12   49.47   49.47   49.47   49.82   49.47   49.47   49.47   49.47   49.47   49.12   49.47   49.47   49.47   49.47

     8: AAP22374.1            46.32   45.96   45.96   45.96   45.96   81.60   98.96  100.00   88.89   84.03   84.38   84.03   84.38   84.72   50.18   48.76   49.12   48.76   49.12   49.12   48.76   49.12   48.76   49.12   49.12   49.12   49.47   49.12   49.12   49.12   49.12   49.12   48.76   49.12   49.12   49.12   49.12

     9: AAD19217.1            46.32   46.32   46.32   46.32   46.32   86.46   89.24   88.89  100.00   93.40   94.10   94.10   94.44   94.79   50.88   49.47   49.82   49.47   49.82   49.82   49.47   49.82   49.47   49.82   49.82   49.82   50.18   49.82   49.82   49.82   49.82   49.82   49.47   49.82   49.82   49.82   49.82

    10: BAA02497.1            45.61   45.61   45.61   45.61   45.61   86.11   84.03   84.03   93.40  100.00   97.92   97.92   98.26   97.92   49.12   48.41   48.76   48.41   48.76   48.76   48.41   48.76   48.41   48.76   48.76   48.76   49.12   48.76   48.76   48.41   48.76   48.76   49.12   48.76   48.76   48.76   48.76

    11: AAG23870.1            45.96   45.96   45.96   45.96   45.96   86.11   84.38   84.38   94.10   97.92  100.00   99.31   99.65   99.31   49.47   48.76   49.12   48.76   49.12   49.12   48.76   49.12   48.76   49.12   49.12   49.12   49.47   49.12   49.12   48.76   49.12   49.12   49.47   49.12   49.12   49.12   49.12

    12: AAK96394.1            46.32   46.32   46.32   46.32   46.32   86.11   84.03   84.03   94.10   97.92   99.31  100.00   99.65   99.31   49.47   48.76   49.12   48.76   49.12   49.12   48.76   49.12   48.76   49.12   49.12   49.12   49.47   49.12   49.12   48.76   49.12   49.12   49.47   49.12   49.12   49.12   49.12

    13: AAA25740.1            44.75   44.75   44.75   44.41   44.75   86.46   84.38   84.38   94.44   98.26   99.65   99.65  100.00   99.67   49.47   48.76   49.12   48.76   49.12   49.12   48.76   49.12   48.76   49.12   49.12   49.12   49.47   49.12   49.12   48.76   49.12   49.12   49.47   49.12   49.12   49.12   49.12

    14: AAB19430.2            45.08   45.08   45.08   44.75   45.08   86.81   84.72   84.72   94.79   97.92   99.31   99.31   99.67  100.00   49.82   49.12   49.47   49.12   49.47   49.47   49.12   49.47   49.12   49.47   49.47   49.47   49.82   49.47   49.47   49.12   49.47   49.47   49.82   49.47   49.47   49.47   49.47

    15: DAA64858.1            42.86   43.21   43.21   43.21   43.21   49.82   49.82   50.18   50.88   49.12   49.47   49.47   49.47   49.82  100.00   85.16   85.16   85.51   85.16   85.51   85.51   85.51   85.51   85.51   85.51   85.51   85.51   85.51   85.51   85.51   85.51   85.51   85.87   86.22   85.87   85.87   86.22

    16: DAA64856.1            44.64   45.00   45.00   45.00   45.00   48.76   49.12   48.76   49.47   48.41   48.76   48.76   48.76   49.12   85.16  100.00   98.59   98.59   98.59   98.23   98.23   98.23   98.23   98.23   98.23   98.23   98.23   98.23   98.23   98.23   98.23   98.23   98.23   98.23   98.59   98.59   98.23

    17: DAA64853.1            45.36   45.71   45.71   45.71   45.71   49.47   49.47   49.12   49.82   48.76   49.12   49.12   49.12   49.47   85.16   98.59  100.00   98.59   99.29   98.94   98.94   98.94   98.94   98.94   98.94   98.94   98.94   98.94   98.94   98.94   98.94   98.94   98.94   98.94   99.29   99.29   98.94

    18: DAA64857.1            45.00   45.36   45.36   45.36   45.36   49.12   49.12   48.76   49.47   48.41   48.76   48.76   48.76   49.12   85.51   98.59   98.59  100.00   98.59   98.94   98.94   98.94   98.94   98.94   98.94   98.94   98.94   98.94   98.94   98.94   98.94   98.94   98.94   98.94   99.29   99.29   98.94

    19: AIL92326.1            45.36   45.71   45.71   45.71   45.71   49.47   49.47   49.12   49.82   48.76   49.12   49.12   49.12   49.47   85.16   98.59   99.29   98.59  100.00   99.65   98.94   98.94   98.94   98.94   98.94   98.94   98.94   98.94   98.94   98.94   98.94   98.94   98.94   98.94   99.29   99.29   98.94

    20: DAA64860.1            45.00   45.36   45.36   45.36   45.36   49.47   49.47   49.12   49.82   48.76   49.12   49.12   49.12   49.47   85.51   98.23   98.94   98.94   99.65  100.00   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.65   99.65   99.29

    21: DAA64855.1            45.00   45.36   45.36   45.36   45.36   49.12   49.12   48.76   49.47   48.41   48.76   48.76   48.76   49.12   85.51   98.23   98.94   98.94   98.94   99.29  100.00   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.65   99.65   99.29

    22: DAA64854.1            45.00   45.36   45.36   45.36   45.36   49.47   49.47   49.12   49.82   48.76   49.12   49.12   49.12   49.47   85.51   98.23   98.94   98.94   98.94   99.29   99.29  100.00   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.65   99.65   99.29

    23: DAA64862.1            44.64   45.00   45.00   45.00   45.00   49.12   49.12   48.76   49.47   48.41   48.76   48.76   48.76   49.12   85.51   98.23   98.94   98.94   98.94   99.29   99.29   99.29  100.00   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.65   99.65   99.29

    24: DAA64864.1            45.00   45.36   45.36   45.36   45.36   49.47   49.47   49.12   49.82   48.76   49.12   49.12   49.12   49.47   85.51   98.23   98.94   98.94   98.94   99.29   99.29   99.29   99.29  100.00   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.65   99.65   99.29

    25: DAA64866.1            45.00   45.36   45.36   45.36   45.36   49.47   49.47   49.12   49.82   48.76   49.12   49.12   49.12   49.47   85.51   98.23   98.94   98.94   98.94   99.29   99.29   99.29   99.29   99.29  100.00   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.65   99.65   99.29

    26: DAA64865.1            45.00   45.36   45.36   45.36   45.36   49.47   49.47   49.12   49.82   48.76   49.12   49.12   49.12   49.47   85.51   98.23   98.94   98.94   98.94   99.29   99.29   99.29   99.29   99.29   99.29  100.00   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.65   99.65   99.29

    27: DAA64867.1            44.64   45.00   45.00   45.00   45.00   49.82   49.82   49.47   50.18   49.12   49.47   49.47   49.47   49.82   85.51   98.23   98.94   98.94   98.94   99.29   99.29   99.29   99.29   99.29   99.29   99.29  100.00   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.65   99.65   99.29

    28: DAA64859.1            45.00   45.36   45.36   45.36   45.36   49.47   49.47   49.12   49.82   48.76   49.12   49.12   49.12   49.47   85.51   98.23   98.94   98.94   98.94   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29  100.00   99.29   99.29   99.29   99.29   99.29   99.29   99.65   99.65   99.29

    29: DAA64869.1            45.00   45.36   45.36   45.36   45.36   49.47   49.47   49.12   49.82   48.76   49.12   49.12   49.12   49.47   85.51   98.23   98.94   98.94   98.94   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29  100.00   99.29   99.29   99.29   99.29   99.29   99.65   99.65   99.29

    30: DAA64870.1            45.36   45.71   45.71   45.71   45.71   49.12   49.47   49.12   49.82   48.41   48.76   48.76   48.76   49.12   85.51   98.23   98.94   98.94   98.94   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29  100.00   99.29   99.29   99.29   99.29   99.65   99.65   99.29

    31: DAA64868.1            45.00   45.36   45.36   45.36   45.36   49.47   49.47   49.12   49.82   48.76   49.12   49.12   49.12   49.47   85.51   98.23   98.94   98.94   98.94   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29  100.00  100.00   99.29   99.29   99.65   99.65   99.29

    32: DAA64861.1            45.00   45.36   45.36   45.36   45.36   49.47   49.47   49.12   49.82   48.76   49.12   49.12   49.12   49.47   85.51   98.23   98.94   98.94   98.94   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29  100.00  100.00   99.29   99.29   99.65   99.65   99.29

    33: DAA64852.1            45.00   45.36   45.36   45.36   45.36   49.12   49.12   48.76   49.47   49.12   49.47   49.47   49.47   49.82   85.87   98.23   98.94   98.94   98.94   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29  100.00   99.29   99.65   99.65   99.29

    34: DAA64871.1            44.64   45.00   45.00   45.00   45.00   49.47   49.47   49.12   49.82   48.76   49.12   49.12   49.12   49.47   86.22   98.23   98.94   98.94   98.94   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29  100.00   99.65   99.65   99.29

    35: AIL92327.1            45.00   45.36   45.36   45.36   45.36   49.47   49.47   49.12   49.82   48.76   49.12   49.12   49.12   49.47   85.87   98.59   99.29   99.29   99.29   99.65   99.65   99.65   99.65   99.65   99.65   99.65   99.65   99.65   99.65   99.65   99.65   99.65   99.65   99.65  100.00  100.00   99.65

    36: DAA64863.1            45.00   45.36   45.36   45.36   45.36   49.47   49.47   49.12   49.82   48.76   49.12   49.12   49.12   49.47   85.87   98.59   99.29   99.29   99.29   99.65   99.65   99.65   99.65   99.65   99.65   99.65   99.65   99.65   99.65   99.65   99.65   99.65   99.65   99.65  100.00  100.00   99.65

    37: AIL92328.1            45.00   45.36   45.36   45.36   45.36   49.47   49.47   49.12   49.82   48.76   49.12   49.12   49.12   49.47   86.22   98.23   98.94   98.94   98.94   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.29   99.65   99.65  100.00

 

CLUSTAL O(1.2.4) multiple sequence alignment

 

 

ACJ61335.1               ------MDVRQHKASFFSVVITFLCLT---LSLNANATDSVLEAVTNAETELGARIGLAA

AFI72872.1               ------MDVRKHKASFFSVVITFLCLT---LSLNANATDSVLEAVTNAETELGARIGLAV

AAO59455.1               ------MDVRKHKASFFSVVITFLCLT---LSLNANATDSVLEAVTNAETELGARIGLAV

AAF61417.1               ------MNVRKHKASFFSVVITFLCLT---LSLNANATDSVLEAVTNAETELGARIGLAV

N1NTC9|N1NTC9_9GAMM      ------MDVRKHKASFFSVVITFLCLT---LSLNANATDSVLEAVTNAETELGARIGLAV

AAC09012.1               ----------------MKLLLVFSLLIPSMVFANSSKFQQVEQDAKVIEASLSAHIGISV

AAM74565.1               ----------------MKSLLVFALLMPSVVFASSSKFQSVEQEIKGIESSLSARIGVAI

AAP22374.1               ----------------MKSLLVFALLMPSVVFASSSKFQSVEQEIKGIESSLSARIGVAI

AAD19217.1               ----------------MKFLLAFSLLIPSVVFASSSKFQQVEQDVKAIEVSLSARIGVSV

BAA02497.1               ----------------MKFLLVFSLLIPSVVFASSSKFRQVEQDVKAIEVSLSARIGVSV

AAG23870.1               ----------------MKFLLAFSLLIPSVVFASSSKFQQVEQDVKAIEVSLSARIGVSV

AAK96394.1               ----------------MKFLLAFSLLIPSVVFASSSKFQQVEQDVKAIEVSLSARIGVSV

AAA25740.1               MLLYKMCDNQNYGVTYMKFLLAFSLLIPSVVFASSSKFQQVEQDVKAIEVSLSARIGVSV

AAB19430.2               MLLYKMCDNQNYGVTYMKFLLAFSLLIPSVVFASSSKFQQVEQDVKAIEVSLSARIGVSV

DAA64858.1               ----------------MKKLF---LLAGLMVCSTLSYASQLNEDISLLEQQTSSRIGVSV

DAA64856.1               ----------------MKKLF---LLVGLMVCSTVSYASKLNEDISLIEKQTSGRIGVSV

DAA64853.1               ----------------MKKLF---LLVGLMVCSTVSYASKLNEDISLIEKQTSGRIGVSV

DAA64857.1               ----------------MKKLF---LLVGLMVCSTVSYASKLNEDISLIEKQTSGRIGVSV

AIL92326.1               ----------------MKKLF---LLVGLMVCSTVSYASKLNEDISLIEKQTSGRIGVSV

DAA64860.1               ----------------MKKLF---LLVGLMVCSTVSYASKLNEDISLIEKQTSGRIGVSV

DAA64855.1               ----------------MKKLF---LLVGLMVCSTVSYASKLNEDISLIEKQTSGRIGVSV

DAA64854.1               ----------------MKKLF---LLVGLMVCSTVSYASKLNEDISLIEKQTSGRIGVSV

DAA64862.1               ----------------MKKLF---LLVGLMVCSTVSYASKLNEDISLIEKQTSGRIGVSV

DAA64864.1               ----------------MKKLF---LLVGLMVCSTVSYASKLNEDISLIEKQTSGRIGVSV

DAA64866.1               ----------------MKKLF---LLVGLMVCSTVSYASKLNEDISLIEKQTSGRIGVSV

DAA64865.1               ----------------MKKLF---LLVGLMVCSTVSYASKLNEDISLIEKQTSGRIGVSV

DAA64867.1               ----------------MKKLF---LLVGLMVCSTVSYASKLNEDISLIEKQTSGRIGVSV

DAA64859.1               ----------------MKKLF---LLVGLMVYSTVSYASKLNEDISLIEKQTSGRIGVSV

DAA64869.1               ----------------MKKLF---LLVGLMVCSTVSYASKLNEDISIIEKQTSGRIGVSV

DAA64870.1               ----------------MKKLF---LLVGLMVCSTVSYASKLNEDISLIEKQTSGRIGVSV

DAA64868.1               ----------------MKKLF---LLVGLMVCSTVSYASKLNEDISLIEKQTSGRIGVSV

DAA64861.1               ----------------MKKLF---LLVGLMVCSTVSYASKLNEDISLIEKQTSGRIGVSV

DAA64852.1               ----------------MKKLF---LLVGLMVCSTVSYASKLNEDISLIEKQTSGRIGVSV

DAA64871.1               ----------------MKKLF---LLVGLMVCSTVSYASKLNEDISLIEKQTSGRIGVSV

AIL92327.1               ----------------MKKLF---LLVGLMVCSTVSYASKLNEDISLIEKQTSGRIGVSV

DAA64863.1               ----------------MKKLF---LLVGLMVCSTVSYASKLNEDISLIEKQTSGRIGVSV

AIL92328.1               ----------------MKKLF---LLAGLMVCSTVSYASKLNEDISLIEKQTSGRIGVSV

                                         :. ::    *    :  . .   .: :  .  * . ..:**::

 

ACJ61335.1               HDLETGKRWEHKSNERFPLTSTFKTLACANVLQRVDLGKERIDRVVRFSESNLVTYSPVT

AFI72872.1               HDLETGKRWEHKSNERFPLSSTFKTLACANVLQRVDLGKERIDRVVRFSESNLVTYSPVT

AAO59455.1               HDLETGKRWEHKSNERFPLSSTFKTLACANVLQRVDLGKERIDRVVRFSESNLVTYSPVT

AAF61417.1               HDLETGKRWEHKSNERFPLSSTFKTLACANVLQRVDLGKERIDRVVRFSESNLVTYSPVT

N1NTC9|N1NTC9_9GAMM      HDLETGKRWEHKSNERFPLSSTFKTLACANVLQRVDLGKERIDRVVRFSESNLVTYSPVT

AAC09012.1               LDTQTGEYWDYNGNQRFPLTSTFKTIACAKLLYDAEQGEINPKSTIEIKKADLVTYSPVI

AAM74565.1               LDTQNGESWDYNGDQRFPLTSTFKTIACAKLLYDAEHGKVNLNSTVEIKKADLVTYSPVL

AAP22374.1               LDTQNGESWDYNGDQRFPLTSTFKTIACAKLLYDAEHGKVNLNSTVEVKKADLVTYSPVL

AAD19217.1               LDTQNGEYWDYNGNQRFPLTSTFKTIACAKLLYDAEQGKVNPNSTVEIKKADLVTYSPVI

BAA02497.1               LDTQNGEYWDYNGNQRFPLTSTFKTIACAKLLYDAEQGKVNPNSTVEIKKADLVTYSPVI

AAG23870.1               LDTQNGEYWDYNGNQRFPLTSTFKTIACAKLLYDAEQGKVNSNSTVEIKKADLVTYSPVI

AAK96394.1               LDTQNGEYWDYNGNQRFPLTSTFKTIACAKLLYDAEQGKVNPNSTVEIKKADLVTYSPVI

AAA25740.1               LDTQNGEYWDYNGNQRFPLTSTFKTIACAKLLYDAEQGKVNPNSTVEIKKADLVTYSPVI

AAB19430.2               LDTQNGEYWDYNGNQRFPLTSTFKTIACAKLLYDAEQGKVNPNSTVEIKKADLVTYSPVI

DAA64858.1               WDTQADERWDYRGDERFPLMSTFKTLACAKMLSDMDSGKLSKNATAKVDERSIVVWSPVM

DAA64856.1               WDTQMDERWDYRGDERFPLMSTFKTLACATMLSDMDSGKLNKNATARIDERNIVVWSPVM

DAA64853.1               WDTQTDERWDYRGDERFPLMSTFKTLACATMLSDMDSGKLNKNATARINERNIVVWSPVM

DAA64857.1               WDTQMDERWDYRGDERFPLMSTFKTLACATMLSDMDSGKLNKNATAKIDERNIVVWSPVM

AIL92326.1               WDTQTDERWDYRGDERFPLMSTFKTLACATMLSDMDSGKLNKNATARIDERNIVVWSPVM

DAA64860.1               WDTQTDERWDYRGDERFPLMSTFKTLACATMLSDMDSGKLNKNATAKIDERNIVVWSPVM

DAA64855.1               WDTQTDERWDYRGDERFPLMSTFKTLACATMLSDMDSGKLNKNATAKIDERNIVVWSPVM

DAA64854.1               WDTQTDERWDYRGDERFPLMSTFKTLACATMLSDMDSGKLNKNATAKIDERNIVVWSPVM

DAA64862.1               WDTQTDERWDYRGDERFPLMSTFKTLACATMLSDMDSGKLNKNATAKIDERNIVVWSPVM

DAA64864.1               WDTQTDERWDYRGDERFPLMSTFKTLACATMLSDMDSGKLNKNATAKIDERNIVVWSPVM

DAA64866.1               WDTQTDERWDYRGDERFPLMSTFKTLACATMLSDMDSGKLNKNATAKIDERNIVVWSPVM

DAA64865.1               WDTQTDERWDYRGDERFPLMSTFKTLACATMLSDMDSGKLNKNATAKIDERNIVVWSPVM

DAA64867.1               WDTQTDERWDYRGDERFPLMSTFKTLACATMLSDMESGKLNKNATAKIDERNIVVWSPVM

DAA64859.1               WDTQTDERWDYRGDERFPLMSTFKTLACATMLSDMDSGKLNKNATAKIDERNIVVWSPVM

DAA64869.1               WDTQTDERWDYRGDERFPLMSTFKTLACATMLSDMDSGKLNKNATAKIDERNIVVWSPVM

DAA64870.1               WDTQTDERWDYRGDERFPLMSTFKTLACATMLSDMDSGKLNKNATAKIDERNIVVWSPVM

DAA64868.1               WDTQTDERWDYRGDERFPLMSTFKTLACATMLSDMDSGKLNKNATAKIDERNIVVWSPVM

DAA64861.1               WDTQTDERWDYRGDERFPLMSTFKTLACATMLSDMDSGKLNKNATAKIDERNIVVWSPVM

DAA64852.1               WDTQTDERWDYRGDERFPLMSTFKTLACATMLSDMDSGKLNKNATAKIDERNIVVWSPVM

DAA64871.1               WDTQTDERWDYRGDERFPLMSTFKTLACATMLSDMDSGKLNKNATAKIDERNIVVWSPVM

AIL92327.1               WDTQTDERWDYRGDERFPLMSTFKTLACATMLSDMDSGKLNKNATAKIDERNIVVWSPVM

DAA64863.1               WDTQTDERWDYRGDERFPLMSTFKTLACATMLSDMDSGKLNKNATAKIDERNIVVWSPVM

AIL92328.1               WDTQTDERWDYRGDERFPLMSTFKTLACATMLSDMDSGKLNKNATAKIDERNIVVWSPVM

                          * : .: *::..::**** *****:***.:*   : *:   . . ...: .:*.:***

 

ACJ61335.1               EKHVGKKGMSLAELCQATLSTSDNSAANFILQAIGGPKALTKFLRSIGDDTTRLDRWETE

AFI72872.1               EKHVGKKGMSLAELCQATLSTSDNSAANFILQAIGGPKALTKFLRSIGDDTTRLDRWETE

AAO59455.1               EKHVGKKGMSLAELCQATLSTSDNSAANFILQAIGGPKALTKFLRSIGDDTTRLDRWETE

AAF61417.1               EKHVGKKGMSLAELCQATLSTSDNSAANFILQAIGGPKALTKFLRSIGDDTTRLDRWETE

N1NTC9|N1NTC9_9GAMM      EKHVGKKGMSLAELCQATLSTSDNSAANFILQAIGGPKALTKFLRSIGDDTTRLDRWETE

AAC09012.1               EKQVGQ-AITLDDACFATMTTSDNAAANIILNALGGPESVTDFLRQIGDKETRLDRIEPE

AAM74565.1               EKQVGK-PITLSDACLATMTTSDNTAANIVINAVGDPKSITDFLRQIGDKETRLDRVEPE

AAP22374.1               EKQVGK-PITLSDACFATMTTSDNTAANIVINAVGDPKSITDFLRQIGDKETRLDRVEPE

AAD19217.1               EKQVGQ-AITLDDACFATMTTSDNTAANIILSAVGGPKGVTDFLRQIGDKETRLDRIEPD

BAA02497.1               EKQVGQ-AITLDDACFATMTTSDNTAANIILSAVGGSKGVTDFLRQIGDKETRLDRIEPD

AAG23870.1               EKQVGQ-AITLDDACFATMTTSDNTAANIILSAVGGPKGVTDFLRQIGDKETRLDRIEPD

AAK96394.1               EKQVGQ-AITLDDACFATMTTSDNTAANIILSAVGGPKGVTDFLRQIGDKETRLDRIEPD

AAA25740.1               EKQVGQ-AITLDDACFATMTTSDNTAANIILSAVGGPKGVTDFLRQIGDKETRLDRIEPD

AAB19430.2               EKQVGQ-AITLDDACFATMTTSDNTAANIILSAVGGPKGVTDFLRQIGDKETRLDRIEPD

DAA64858.1               DKLAGQ-NTRIEHACEAAMLMSDNTAANLVLNEIGGPKAVTMFLRTIGDKATRLDRIEPR

DAA64856.1               DKLAGQ-STRIEHACEAAMLMSDNTAANLVLNEIGGPKAVTLFLRSVGDKATRLDRLEPR

DAA64853.1               DKLAGQ-STRIEHACEAAMLMSDNTAANLVLNEIGGPKAVTLFLRSIGDKATRLDRLEPR

DAA64857.1               DKLAGQ-STRIEHACEAAMLMSDNSAANLVLNEIGGPKAVTLFLRSIGDKATRLDRLEPR

AIL92326.1               DKLTGQ-STRIEHACEAAMLMSDNTAANLVLNEIGGPKAVTLFLRSIGDKATRLDRLEPR

DAA64860.1               DKLTGQ-STRIEHACEAAMLMSDNTAANLVLNEIGGPKAVTLFLRSIGDKATRLDRLEPR

DAA64855.1               DKLAGQ-STRIEHACEAAMLMSDNTAANLVLNEIGGPKAVTLFLRSIGDNATRLDRLEPR

DAA64854.1               DKLAGQ-STRVEHACEAAMLMSDNTAANLVLNEIGGPKAVTLFLRSIGDKATRLDRLEPR

DAA64862.1               DKLAGQ-STRIEHACEAAMLMSDNTAANLVLNEIGGPKAVTLFLRSIGDKATRLDRLEPR

DAA64864.1               DKLAGQ-STRIEHACEAAMLMSDNTAANLVLNKIGGPKAVTLFLRSIGDKATRLDRLEPR

DAA64866.1               DKLAGQ-STRIEHACEAAMLMSDNTAANLVLNEIGGPKAVTLFLRSIGDKATRLDRLEPR

DAA64865.1               DKLAGQ-STRIEHACEAAMLMSDNTAANLVLNEIGGPKAVTLFLRSIGDKATRLDRLEPG

DAA64867.1               DKLAGQ-STRIEHACEAAMLMSDNTAANLVLNEIGGPKAVTLFLRSIGDKATRLDRLEPR

DAA64859.1               DKLAGQ-STRIEHACEAAMLMSDNTAANLVLNEIGGPKAVTLFLRSIGDKATRLDRLEPR

DAA64869.1               DKLAGQ-STRIEHACEAAMLMSDNTAANLVLNEIGGPKAVTLFLRSIGDKATRLDRLEPR

DAA64870.1               DKLAGQ-STRIEHACEAAMLMSDNTAANLVLNEIGGPKAVTLFLRSIGDKATRLDRLEPR

DAA64868.1               DKLAGQ-STRIEHACEAAMLRSDNTAANLVLNEIGGPKAVTLFLRSIGDKATRLDRLEPR

DAA64861.1               DKLAGQ-STRIEHACEAAMLRSDNTAANLVLNEIGGPKAVTLFLRSIGDKATRLDRLEPR

DAA64852.1               DKLAGQ-STRIEHACEAAMLMSDNTAANLVLNEIGGPKAVTLFLRSIGDKATRLDRLEPR

DAA64871.1               DKLAGQ-STRIEHACEAAMLMSDNTAANLVLNEIGGPKAVTLFLRSIGDKATRLDRLEPR

AIL92327.1               DKLAGQ-STRIEHACEAAMLMSDNTAANLVLNEIGGPKAVTLFLRSIGDKATRLDRLEPR

DAA64863.1               DKLAGQ-STRIEHACEAAMLMSDNTAANLVLNEIGGPKAVTLFLRSIGDKATRLDRLEPR

AIL92328.1               DKLAGQ-STRIEHACEAAMLMSDNTAANLVLNEIGGPKAVTLFLRSIGDKATRLDRLEPR

                         :* .*:    : . * *::  ***:***:::. :*. :.:* *** :**. ***** * 

 

ACJ61335.1               LNEAVPGDKRDTTTPIAMVTTLEKLLIDETLSIKSRQQLESWLKGNEVGDALFRKGVPSD

AFI72872.1               LNEAVPGDKRDTTTPIAMVTTLEKLLIDETLSIKSRQQLESWLKGNEVGDALFRKGVPSD

AAO59455.1               LNEAVPGDKRDTTTPIAMVTTLEKLLIDETLSIKSRQQLESWLKGNEVGDALFRKGVPSD

AAF61417.1               LNEAVPGDKRDTTTPIAMVTTLEKLLIDETLSIKSRQQLESWLKGNEVGDALFRKGVPSD

N1NTC9|N1NTC9_9GAMM      LNEAVPGDKRDTTTPIAMVTTLEKLLIDETLSIKSRQQLESWLKGNEVGDALFRKGVPSD

AAC09012.1               LNEGKLGDLRDTTTPNAIVNTLNELLFGSTLSQDGQKKLEYWMVNNQVTGNLLRSVLPEG

AAM74565.1               LNEGKLGDLRDTTTPNAITSTLNQLLFGSTLSEASQKKLESWMVNNQVTGNLLRSVLPVK

AAP22374.1               LNEGKLGDLRDTTTPNAITSTLNQLLFGSTLSEASQKKLESWMVNNQVTGNLLRSVLPVT

AAD19217.1               LNEGKLGDLRDTTTPKAIASTLNQLLFGSTLSEASQKKLESWMVNNQVTGNLLRSVLPVK

BAA02497.1               LNEGKLGDLRDTTTPKAIASTLNKFLFGSALSEMNKKKLESWMVNNQVTGNLLRSVLPAG

AAG23870.1               LNEGKLGDLRDTTTPKAIASTLNKFLFGSALSEMNQKKLESWMVNNQVTGNLLRSVLPAG

AAK96394.1               LNEGKLGDLRDTTTPKAIASTLNKFLFGSALSEMNQKKLESWMVNNQVTGNLLRSVLPAG

AAA25740.1               LNEGKLGDLRDTTTPKAIASTLNKFLFGSALSEMNQKKLESWMVNNQVTGNLLRSVLPAG

AAB19430.2               LNEGKLGDLRDTTTPKAIASTLNKLLFGSALSEMNQKKLESWMVNNQVTGNLLRSVLPAG

DAA64858.1               LNEATPGDSRDTTTPNAILNTLRTLVEGETLSYESRVQLKIWMQDNKVSDSLMRSVLPTG

DAA64856.1               LNEAKPGDKRDTTTPNAMVNTLHTLMEDNALSYESRTQLKIWMQDNKVSDSLMRSVLPKG

DAA64853.1               LNEAKPGDKRDTTTPNAMVNTLHTLMEDNALSYESRTQLKIWMQDNKVSDSLMRSVLPKG

DAA64857.1               LNEAKPGDKRDTTTPNAMVNTLHTLMEDNALSYESRTQLKIWMQDNKVSDSLMRSVLPKG

AIL92326.1               LNEAKPGDKRDTTTPNAMVNTLHTLMEDNALSYESRTQLKIWMQDNKVSDSLMRSVLPKG

DAA64860.1               LNEAKPGDKRDTTTPNAMVNTLHTLMEDNALSYESRTQLKIWMQDNKVSDSLMRSVLPKG

DAA64855.1               LNEAKPGDKRDTTTPNAMVNTLHTLMEDNALSYESRTQLKIWMQDNKVSDSLMRSVLPKG

DAA64854.1               LNEAKPGDKRDTTTPNAMVNTLHTLMEDNALSYESRTQLKIWMQDNKVSDSLMRSVLPKG

DAA64862.1               LNEAKPGDKRDTTTPNAMVNTLHTLMEDNALSYESRTQLKIWMQDNKVSDSLMRSVLPKG

DAA64864.1               LNEAKPGDKRDTTTPNAMVNTLHTLMEDNALSYESRTQLKIWMQDNKVSDSLMRSVLPKG

DAA64866.1               LNEAKPGDKRDTTTPNAMVNTLHSLMEDNALSYESRTQLKIWMQDNKVSDSLMRSVLPKG

DAA64865.1               LNEAKPGDKRDTTTPNAMVNTLHTLMEDNALSYESRTQLKIWMQDNKVSDSLMRSVLPKG

DAA64867.1               LNEAKPGDKRDTTTPNAMVNTLHTLMEDNALSYESRTQLKIWMQDNKVSDSLMRSVLPKG

DAA64859.1               LNEAKPGDKRDTTTPNAMVNTLHTLMEDNALSYESRTQLKIWMQDNKVSDSLMRSVLPKG

DAA64869.1               LNEAKPGDKRDTTTPNAMVNTLHTLMEDNALSYESRTQLKIWMQDNKVSDSLMRSVLPKG

DAA64870.1               LNEAKPGDKRDTTTPNAMVNTLHTLMEDNALSYESRTQLKIWMQDNKVSDSLMRSVLPKD

DAA64868.1               LNEAKPGDKRDTTTPNAMVNTLHTLMEDNALSYESRTQLKIWMQDNKVSDSLMRSVLPKG

DAA64861.1               LNEAKPGDKRDTTTPNAMVNTLHTLMEDNALSYESRTQLKIWMQDNKVSDSLMRSVLPKG

DAA64852.1               LNEAKPGDKRDTTTPNAMVNTLHTLMEDNALSYESRTQLKIWMQDNKVSDSLMRSVLPKG

DAA64871.1               LNEAKPGDKRDTTTPNAMVNTLHTLMEDNALSYESRTQLKIWMQDNKVSDSLMRSVLPKG

AIL92327.1               LNEAKPGDKRDTTTPNAMVNTLHTLMEDNALSYESRTQLKIWMQDNKVSDSLMRSVLPKG

DAA64863.1               LNEAKPGDKRDTTTPNAMVNTLHTLMEDNALSYESRTQLKIWMQDNKVSDSLMRSVLPKG

AIL92328.1               LNEAKPGDKRDTTTPNAMVNTLHTLMEDNALSYESRTQLKIWMQDNKVSDSLMRSVLPKG

                         ***.  ** ****** *: .**. :: ..:**  .: :*: *: .*:* . *:*. :* 

 

ACJ61335.1               WIVADRTGAGGYGSRAITAVMWPPNRKPIVAALYITETDASFEERNAVIAKIGEQIAKTV

AFI72872.1               WIVADRTGAGGYGSRAITAVMWPPNRKPIVAALYITETDASFEERNAVIAKIGEQIAKIV

AAO59455.1               WIVADRTGAGGYGSRAITAVMWPPNRKPIVAALYITETDASFEERNAVIAKIGEQIAKTI

AAF61417.1               WIVADRTGAGGYGSRAITAVMWPPNRKPIVAALYITETDASFEERNAVIAKIGEQIAKTV

N1NTC9|N1NTC9_9GAMM      WIVADRTGAGGYGSRAITAVMWPPNRKPIVAALYITETDASFEERNAVIAKIGEQIAKTV

AAC09012.1               WNIADRSGAGGFGARSITAVVWSEAQSPIIVSIYLAQTEASIADRNDAIVKIGRSIFEVY

AAM74565.1               WSIADRSGAGGFGARSITAIVWSEEKKPIIVSIYLAQTEASMAERNDAIVKIGRSIFEVY

AAP22374.1               WSIADRSGAGGFGARSITAIVWSEEKKPIIVSIYLAQTEASMAERNDAIVKIGRSIFEVY

AAD19217.1               WSIADRSGAGGFGARSITAIVWSEEKKTIIVSIYLAQTEASMAERNDAIVKIGRSIFEVY

BAA02497.1               WNIADRSGAGGFGARSITAVVWSEHQAPIIVSIYLAQTQASMAERNDAIVKIGRSIFDVY

AAG23870.1               WNIADRSGAGGFGARSITAVVWSEHQAPIIVSIYLAQTQASMAERNDAIVKIGHSIFDVY

AAK96394.1               WNIADRSGAGGFGARSITAVVWSEHQAPIIVSIYLAQTQASMEERNDAIVKIGHSIFDVY

AAA25740.1               WNIADRSGAGGFGARSITAVVWSEHQAPIIVSIYLAQTQASMAERNDAIVKIGHSIFDVY

AAB19430.2               WNIADRSGAGGFGARSITAVVWSEHQAPIIVSIYLAQTQASMAERNDAIVKIGHSIFDVY

DAA64858.1               WSIADRSGAGGHGSRGINAIIWKENHRPVYISIYVTETELSLQARDQLVAQISQLILQKY

DAA64856.1               WSIADRSGAGNYGSRGISAMIWKDNYKPVYISIYVTDTDLSLQARDQLIAQISQLILERY

DAA64853.1               WSIADRSGAGNYGSRGISAMIWKDNYKPVYISIYVTDTDLSLQARDQLIAQISQLILEHY

DAA64857.1               WSIADRSGAGNYGSRGISAMIWKDNYKPVYISIYVTDTDLSLQARDQLIAQISQLILEHY

AIL92326.1               WSIADRSGAGNYGSRGISAMIWKDNYKPVYISIYVTDTDLSLQARDQLIAQISQLILEHY

DAA64860.1               WSIADRSGAGNYGSRGISAMIWKDNYKPVYISIYVTDTDLSLQARDQLIAQISQLILEHY

DAA64855.1               WSIADRSGAGNYGSRGISAMIWKDNYKPVYISIYVTDTDLSLQARDQLIAQISQLILEHY

DAA64854.1               WSIADRSGAGNYGSRGISAMIWKDNYKPVYISIYVTDTDLSLQARDQLIAQISQLILEHY

DAA64862.1               WSIADRSGAGNYGSLGISAMIWKDNYKPVYISIYVTDTDLSLQARDQLIAQISQLILEHY

DAA64864.1               WSIADRSGAGNYGSRGISAMIWKDNYKPVYISIYVTDTDLSLQARDQLIAQISQLILEHY

DAA64866.1               WSIADRSGAGNYGSRGISAMIWKDNYKPVYISIYVTDTDLSLQARDQLIAQISQLILEHY

DAA64865.1               WSIADRSGAGNYGSRGISAMIWKDNYKPVYISIYVTDTDLSLQARDQLIAQISQLILEHY

DAA64867.1               WSIADRSGAGNYGSRGISAMIWKDNYKPVYISIYVTDTDLSLQARDQLIAQISQLILEHY

DAA64859.1               WSIADRSGAGNYGSRGISAMIWKDNYKPVYISIYVTDTDLSLQARDQLIAQISQLILEHY

DAA64869.1               WSIADRSGAGNYGSRGISAMIWKDNYKPVYISIYVTDTDLSLQARDQLIAQISQLILEHY

DAA64870.1               WSIADRSGAGNYGSRGISAMIWKDNYKPVYISIYVTDTDLSLQARDQLIAQISQLILEHY

DAA64868.1               WSIADRSGAGNYGSRGISAMIWKDNYKPVYISIYVTDTDLSLQARDQLIAQISQLILEHY

DAA64861.1               WSIADRSGAGNYGSRGISAMIWKDNYKPVYISIYVTDTDLSLQARDQLIAQISQLILEHY

DAA64852.1               WSIADRSGAGNYGSRGISAMIWKDNYKPVYISIYVTDTDLSLQARDQLIAQISQLILDHY

DAA64871.1               WSIADRSGAGNHGSRGISAMIWKDNYKPVYISIYVTDTDLSLQARDQLIAQISQLILEHY

AIL92327.1               WSIADRSGAGNYGSRGISAMIWKDNYKPVYISIYVTDTDLSLQARDQLIAQISQLILEHY

DAA64863.1               WSIADRSGAGNYGSRGISAMIWKDNYKPVYISIYVTDTDLSLQARDQLIAQISQLILEHY

AIL92328.1               WSIADRSGAGNYGSRGISAMIWKDNYKPVYISIYVTDTDLSLQARDQLIAQISQLILEHY

                         * :***:***..*: .*.*::*      :  ::*:::*: *:  *:  :.:*.. * . 

 

ACJ61335.1               LMENSRN

AFI72872.1               LMENSRN

AAO59455.1               LMENSRN

AAF61417.1               LMENSRN

N1NTC9|N1NTC9_9GAMM      LMENSRN

AAC09012.1               SS-QSR-

AAM74565.1               TS-QSR-

AAP22374.1               TS-QSR-

AAD19217.1               TS-QSR-

BAA02497.1               TS-QSR-

AAG23870.1               TS-QSR-

AAK96394.1               TS-QSR-

AAA25740.1               TS-QSR-

AAB19430.2               TS-QSR-

DAA64858.1               KD-N---

DAA64856.1               KE-S---

DAA64853.1               KE-S---

DAA64857.1               KE-S---

AIL92326.1               KE-S---

DAA64860.1               KE-S---

DAA64855.1               KE-S---

DAA64854.1               KE-S---

DAA64862.1               KE-S---

DAA64864.1               KE-S---

DAA64866.1               KE-S---

DAA64865.1               KE-S---

DAA64867.1               KE-S---

DAA64859.1               KE-S---

DAA64869.1               KE-S---

DAA64870.1               KE-S---

DAA64868.1               KE-S---

DAA64861.1               KE-S---

DAA64852.1               KE-S---

DAA64871.1               KE-S---

AIL92327.1               KE-S---

DAA64863.1               KE-S---

AIL92328.1               KE-S---

                            .