#

#

#  Percent Identity  Matrix - created by Clustal2.1

#

#

 

     1: AEM97673.1           100.00   97.63   97.63   97.89   97.59   97.87   98.42   97.63   97.63   98.42   97.63   97.37   97.89   97.63   98.16   98.16   98.16   98.16   97.63   97.63   97.89   98.16   98.16   98.16   98.16   98.16   98.16   98.16   98.16   98.16   98.16   98.16   97.89   98.16   98.16   98.16   97.89   97.89   98.16   98.16   98.16   98.16   97.89   98.16   97.89   97.89   98.16   98.16   98.42   98.16   98.16   98.16   91.20   94.21   93.68   93.95   93.95   94.21   94.21   93.95   95.00   94.74   95.00   94.74   95.00   95.26   95.53   95.00   95.00   94.74   95.00   95.26   95.53   95.00   95.26   95.26   95.00   94.74   95.00   95.26   95.53   95.00   95.00   95.26   95.26   95.26   95.26   95.26   95.79   95.79   95.00   95.26   95.79   95.79   95.26   95.26   96.32   96.05   95.79   95.53   96.32   95.53   95.79   95.26   95.79   95.53   96.05   96.05

     2: B3LDH1|B3LDH1_PROMI   97.63  100.00   99.48   99.74   98.40   98.67   99.21   98.42   98.42   98.95   98.68   98.68   98.68   98.42   99.21   98.95   98.95   98.95   98.42   98.95   98.68   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.68   98.95   98.95   98.95   98.68   98.68   98.95   98.95   98.95   98.95   98.68   98.95   99.21   99.21   98.95   98.95   99.21   99.47   99.21   99.21   91.47   94.74   94.21   94.47   94.47   94.74   94.74   94.47   95.53   95.53   95.53   95.26   95.79   95.79   96.32   95.79   95.79   95.26   95.53   95.79   96.05   95.53   95.79   96.05   95.53   95.26   95.79   96.05   96.05   95.53   95.53   95.79   96.05   95.79   95.79   95.79   96.32   96.58   95.79   96.05   96.58   96.58   96.05   96.05   97.11   96.84   96.58   96.32   97.11   96.32   96.58   96.05   96.58   96.32   96.84   96.84

     3: O54038|O54038_PROMI   97.63   99.48  100.00   99.74   98.40   98.67   99.21   98.42   98.42   98.95   98.42   99.21   98.68   98.42   99.21   98.95   98.95   98.95   98.42   99.47   98.68   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.68   98.95   98.95   98.95   98.68   98.68   98.95   98.95   98.95   98.95   98.68   98.95   99.74   99.21   98.95   98.95   99.21   99.47   99.21   99.21   91.47   94.74   94.21   94.47   94.47   94.74   94.74   94.47   95.53   95.53   95.53   95.26   95.79   95.79   96.32   95.79   95.79   95.26   95.53   95.79   96.05   95.53   95.79   96.05   95.53   95.26   95.79   96.05   96.05   95.53   95.53   95.79   96.05   95.79   95.79   95.79   96.32   96.58   95.79   96.05   96.58   96.58   96.05   96.05   97.11   96.84   96.58   96.32   97.11   96.32   96.58   96.05   96.58   96.32   96.84   96.84

     4: Q70Q39|Q70Q39_PROMI   97.89   99.74   99.74  100.00   98.67   98.94   99.47   98.68   98.68   99.21   98.68   98.95   98.95   98.68   99.47   99.21   99.21   99.21   98.68   99.21   98.95   99.21   99.21   99.21   99.21   99.21   99.21   99.21   99.21   99.21   99.21   99.21   98.95   99.21   99.21   99.21   98.95   98.95   99.21   99.21   99.21   99.21   98.95   99.21   99.47   99.47   99.21   99.21   99.47   99.74   99.47   99.47   91.73   95.00   94.47   94.74   94.74   95.00   95.00   94.74   95.79   95.79   95.79   95.53   96.05   96.05   96.58   96.05   96.05   95.53   95.79   96.05   96.32   95.79   96.05   96.32   95.79   95.53   96.05   96.32   96.32   95.79   95.79   96.05   96.32   96.05   96.05   96.05   96.58   96.84   96.05   96.32   96.84   96.84   96.32   96.32   97.37   97.11   96.84   96.58   97.37   96.58   96.84   96.32   96.84   96.58   97.11   97.11

     5: ACJ65711.1            97.59   98.40   98.40   98.67  100.00   99.47   99.20   98.40   98.40   98.67   98.40   98.13   98.67   98.66   98.93   98.93   98.93   98.93   98.40   98.40   98.93   99.20   99.20   98.93   98.93   98.93   98.93   98.93   98.93   98.93   98.93   98.93   98.67   98.93   98.93   98.93   98.67   98.93   98.93   98.93   98.93   98.93   98.67   99.20   98.67   98.67   98.93   98.93   99.20   98.93   98.93   98.93   91.35   94.67   94.13   94.40   94.40   94.67   94.67   94.40   95.47   95.47   95.47   95.20   95.73   95.73   96.27   95.73   95.73   95.20   95.47   95.73   96.00   95.47   95.73   96.00   95.47   95.20   95.73   96.00   96.00   95.47   95.47   95.73   96.00   95.73   95.73   95.73   96.27   96.53   95.73   96.00   96.53   96.53   96.00   96.00   97.07   97.07   96.53   96.27   97.07   96.27   96.53   96.00   96.53   96.27   96.80   96.80

     6: ACA97847.1            97.87   98.67   98.67   98.94   99.47  100.00   99.47   98.67   98.67   98.94   98.67   98.41   98.94   98.94   99.20   99.20   99.20   99.20   98.67   98.67   99.20   99.47   99.20   99.20   99.20   99.20   99.20   99.20   99.20   99.20   99.20   99.20   98.94   99.20   99.20   99.20   98.94   99.20   99.20   99.20   99.20   99.20   98.94   99.47   98.94   98.94   99.20   99.20   99.47   99.20   99.20   99.20   91.67   94.96   94.43   94.69   94.69   94.96   94.96   94.69   95.76   95.76   95.76   95.49   96.02   96.02   96.55   96.02   96.02   95.49   95.76   96.02   96.29   95.76   96.02   96.29   95.76   95.49   96.02   96.29   96.29   95.76   95.76   96.02   96.29   96.02   96.02   96.02   96.55   96.82   96.02   96.29   96.82   96.82   96.29   96.29   97.35   97.08   96.82   96.55   97.35   96.55   96.82   96.29   96.82   96.55   97.08   97.08

     7: ADK55604.1            98.42   99.21   99.21   99.47   99.20   99.47  100.00   99.21   99.21  100.00   99.21   98.95   99.48   99.21   99.74   99.74   99.74   99.74   99.21   99.21   99.48   99.74   99.74   99.74   99.74   99.74   99.74   99.74   99.74   99.74   99.74   99.74   99.48   99.74   99.74   99.74   99.48   99.48   99.74   99.74   99.74   99.74   99.48   99.74   99.48   99.48   99.74   99.74  100.00   99.74   99.74   99.74   92.29   95.54   95.01   95.28   95.28   95.54   95.54   95.28   96.33   96.33   96.33   96.06   96.59   96.59   97.11   96.59   96.59   96.06   96.33   96.59   96.85   96.33   96.59   96.85   96.33   96.06   96.59   96.85   96.85   96.33   96.33   96.59   96.85   96.59   96.59   96.59   97.11   97.38   96.59   96.85   97.38   97.38   96.85   96.85   97.90   97.64   97.38   97.11   97.90   97.11   97.38   96.85   97.38   97.11   97.64   97.64

     8: ADQ38362.1            97.63   98.42   98.42   98.68   98.40   98.67   99.21  100.00   98.43   99.21   98.43   98.16   98.69   98.68   98.95   98.95   98.95   98.95   98.69   98.43   98.69   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.69   98.69   98.95   98.95   98.95   98.95   98.69   98.95   98.69   98.69   98.95   98.95   99.21   98.95   98.95   98.95   92.82   95.54   95.01   95.28   95.28   95.54   95.54   95.28   96.33   96.85   96.85   96.59   97.11   96.59   97.11   97.11   97.11   96.59   96.33   96.59   96.85   96.85   97.11   97.38   96.85   96.59   97.11   96.85   96.85   96.85   96.85   97.11   97.38   97.11   97.11   97.11   97.64   97.90   96.06   96.33   96.85   96.85   96.33   97.38   97.90   97.38   96.85   96.59   97.38   96.59   96.85   96.33   96.85   96.59   97.11   97.11

     9: ABN51007.1            97.63   98.42   98.42   98.68   98.40   98.67   99.21   98.43  100.00   99.21   98.43   98.16   98.69   98.42   98.95   98.95   98.95   98.95   98.43   98.43   98.69   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.69   98.95   98.95   98.95   98.69   98.69   98.95   98.95   98.95   98.95   98.69   98.95   98.69   98.69   98.95   98.95   99.21   98.95   98.95   98.95   91.76   95.01   94.49   94.75   94.75   95.01   95.01   94.75   95.54   95.54   95.54   95.28   95.80   95.80   96.33   95.80   96.06   95.28   95.54   95.80   96.06   95.54   95.80   96.06   95.54   95.28   95.80   96.06   96.06   95.54   95.80   95.80   96.06   95.80   95.80   95.80   96.33   96.59   96.85   97.11   97.64   97.64   97.11   96.33   97.11   97.38   97.64   97.38   98.16   97.38   98.16   97.64   98.16   97.90   98.43   98.43

    10: AAU95778.1            98.42   98.95   98.95   99.21   98.67   98.94  100.00   99.21   99.21  100.00   99.21   98.95   99.48   99.21   99.74   99.74   99.74   99.74   99.21   99.21   99.48   99.74   99.74   99.74   99.74   99.74   99.74   99.74   99.74   99.74   99.74   99.74   99.48   99.74   99.74   99.74   99.48   99.48   99.74   99.74   99.74   99.74   99.48   99.74   99.48   99.48   99.74   99.74  100.00   99.74   99.74   99.74   92.29   95.54   95.01   95.28   95.28   95.54   95.54   95.28   96.33   96.33   96.33   96.06   96.59   96.59   97.11   96.59   96.59   96.06   96.33   96.59   96.85   96.33   96.59   96.85   96.33   96.06   96.59   96.85   96.85   96.33   96.33   96.59   96.85   96.59   96.59   96.59   97.11   97.38   96.59   96.85   97.38   97.38   96.85   96.85   97.90   97.64   97.38   97.11   97.90   97.11   97.38   96.85   97.38   97.11   97.64   97.64

    11: AKG51729.1            97.63   98.68   98.42   98.68   98.40   98.67   99.21   98.43   98.43   99.21  100.00   98.16   98.69   98.42   98.95   98.95   98.95   98.95   98.43   98.43   98.69   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.69   99.21   98.95   98.95   99.21   99.21   98.95   98.95   98.95   98.95   99.21   98.95   98.69   98.69   99.48   98.95   99.21   98.95   98.95   98.95   91.49   94.75   94.23   94.49   94.49   94.75   94.75   94.49   95.54   95.54   95.54   95.28   95.80   95.80   96.33   95.80   95.80   95.28   95.54   95.80   96.06   95.54   95.80   96.06   95.54   95.28   95.80   96.06   96.06   95.54   95.54   95.80   96.06   95.80   95.80   95.80   96.33   96.59   95.80   96.06   96.59   96.59   96.06   96.06   97.38   96.85   96.59   96.33   97.11   96.33   96.59   96.06   96.59   96.33   96.85   96.85

    12: D2U4S1|D2U4S1_PROMI   97.37   98.68   99.21   98.95   98.13   98.41   98.95   98.16   98.16   98.95   98.16  100.00   98.43   98.16   98.69   98.69   98.69   98.69   98.16   99.21   98.43   98.69   98.69   98.69   98.69   98.69   98.69   98.69   98.69   98.69   98.69   98.69   98.43   98.69   98.69   98.69   98.43   98.43   98.69   98.69   98.69   98.69   98.43   98.69   99.48   98.95   98.69   98.69   98.95   99.21   98.95   98.95   91.22   94.49   93.96   94.23   94.23   94.49   94.49   94.23   95.28   95.28   95.28   95.01   95.54   95.54   96.06   95.54   95.54   95.01   95.28   95.54   95.80   95.28   95.54   95.80   95.28   95.01   95.54   95.80   95.80   95.28   95.28   95.54   95.80   95.54   95.54   95.54   96.06   96.33   95.54   95.80   96.33   96.33   95.80   95.80   96.85   96.59   96.33   96.06   96.85   96.06   96.33   95.80   96.33   96.06   96.59   96.59

    13: ABY58049.1            97.89   98.68   98.68   98.95   98.67   98.94   99.48   98.69   98.69   99.48   98.69   98.43  100.00   98.68   99.21   99.21   99.21   99.21   98.69   98.69   98.95   99.21   99.21   99.21   99.21   99.21   99.21   99.21   99.21   99.21   99.21   99.21   98.95   99.21   99.21   99.21   98.95   98.95   99.21   99.21   99.21   99.21   98.95   99.21   98.95   98.95   99.21   99.21   99.48   99.21   99.21   99.21   91.76   95.01   94.49   94.75   94.75   95.01   95.01   94.75   95.80   95.80   95.80   95.54   96.06   96.06   96.59   96.06   96.06   95.54   95.80   96.06   96.33   95.80   96.06   96.33   95.80   95.54   96.06   96.33   96.33   95.80   95.80   96.06   96.33   96.06   96.06   96.06   96.59   96.85   96.06   96.33   96.85   96.85   96.33   96.33   97.38   97.11   96.85   96.59   97.38   96.59   96.85   96.33   96.85   96.59   97.38   97.11

    14: AAX58682.2            97.63   98.42   98.42   98.68   98.66   98.94   99.21   98.68   98.42   99.21   98.42   98.16   98.68  100.00   98.95   98.95   98.95   98.95   99.47   98.42   98.68   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   99.74   98.95   98.95   98.95   98.68   99.21   99.47   98.95   98.95   98.95   98.68   98.95   98.68   98.68   98.95   98.95   99.21   98.95   98.95   98.95   92.53   95.79   95.26   95.53   95.53   95.79   95.79   95.53   96.58   96.58   96.58   96.32   96.84   96.84   97.37   96.84   96.84   96.32   96.58   96.84   97.11   96.58   96.84   97.11   96.58   96.32   96.84   97.11   97.11   96.58   96.58   96.84   97.11   96.84   96.84   96.84   97.37   97.63   96.84   97.11   97.63   97.63   97.11   97.11   98.16   97.89   97.63   97.37   98.16   97.37   97.63   97.11   97.63   97.37   97.89   97.89

    15: AKZ20821.1            98.16   99.21   99.21   99.47   98.93   99.20   99.74   98.95   98.95   99.74   98.95   98.69   99.21   98.95  100.00   99.48   99.48   99.48   98.95   98.95   99.21   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.21   99.48   99.48   99.48   99.21   99.21   99.48   99.48   99.48   99.48   99.21   99.48   99.21   99.21   99.48   99.48   99.74   99.48   99.48   99.48   92.02   95.28   94.75   95.01   95.01   95.28   95.28   95.01   96.06   96.06   96.06   95.80   96.33   96.33   96.85   96.33   96.33   95.80   96.06   96.33   96.59   96.06   96.33   96.59   96.06   95.80   96.33   96.59   96.59   96.06   96.06   96.33   96.59   96.33   96.33   96.33   96.85   97.11   96.33   96.59   97.11   97.11   96.59   96.59   97.64   97.38   97.11   96.85   97.64   96.85   97.11   96.59   97.11   96.85   97.38   97.38

    16: AKZ20822.1            98.16   98.95   98.95   99.21   98.93   99.20   99.74   98.95   98.95   99.74   98.95   98.69   99.21   98.95   99.48  100.00   99.48   99.48   98.95   98.95   99.21   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.21   99.48   99.48   99.48   99.21   99.21   99.48   99.48   99.48   99.48   99.21   99.48   99.21   99.21   99.48   99.48   99.74   99.48   99.48   99.48   92.02   95.28   94.75   95.01   95.01   95.28   95.28   95.01   96.06   96.06   96.06   95.80   96.33   96.33   96.85   96.33   96.33   95.80   96.06   96.33   96.59   96.06   96.33   96.59   96.06   95.80   96.33   96.59   96.59   96.06   96.06   96.33   96.59   96.33   96.33   96.33   96.85   97.11   96.33   96.59   97.11   97.11   96.59   96.59   97.64   97.38   97.11   96.85   97.64   96.85   97.11   96.59   97.11   97.38   97.38   97.90

    17: AHW47897.1            98.16   98.95   98.95   99.21   98.93   99.20   99.74   98.95   98.95   99.74   98.95   98.69   99.21   98.95   99.48   99.48  100.00   99.48   98.95   98.95   99.21   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.21   99.48   99.48   99.48   99.21   99.21   99.48   99.48   99.48   99.48   99.21   99.48   99.21   99.21   99.48   99.48   99.74   99.48   99.48   99.48   92.02   95.28   94.75   95.01   95.01   95.28   95.28   95.01   96.06   96.06   96.06   95.80   96.33   96.33   96.85   96.33   96.33   95.80   96.06   96.33   96.59   96.06   96.33   96.59   96.06   95.80   96.33   96.59   96.59   96.06   96.06   96.33   96.59   96.33   96.33   96.33   96.85   97.11   96.33   96.59   97.11   97.11   96.59   96.59   97.64   97.38   97.11   96.85   97.64   96.85   97.11   96.59   97.11   96.85   97.38   97.38

    18: ALE33733.1            98.16   98.95   98.95   99.21   98.93   99.20   99.74   98.95   98.95   99.74   98.95   98.69   99.21   98.95   99.48   99.48   99.48  100.00   98.95   98.95   99.21   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.21   99.48   99.48   99.48   99.21   99.21   99.48   99.48   99.48   99.48   99.21   99.48   99.21   99.21   99.48   99.48   99.74   99.48   99.48   99.48   92.02   95.28   94.75   95.01   95.01   95.28   95.28   95.01   96.06   96.06   96.06   95.80   96.33   96.33   96.85   96.33   96.33   95.80   96.06   96.33   96.59   96.06   96.33   96.59   96.06   95.80   96.33   96.59   96.59   96.06   96.06   96.33   96.59   96.33   96.33   96.33   96.85   97.11   96.33   96.59   97.11   97.11   96.59   96.59   97.64   97.38   97.11   96.85   97.64   96.85   97.11   96.59   97.11   96.85   97.38   97.38

    19: AHA80103.1            97.63   98.42   98.42   98.68   98.40   98.67   99.21   98.69   98.43   99.21   98.43   98.16   98.69   99.47   98.95   98.95   98.95   98.95  100.00   98.43   98.69   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   99.74   98.95   98.95   98.95   98.69   98.69   99.48   98.95   98.95   98.95   98.69   98.95   98.69   98.69   98.95   98.95   99.21   98.95   98.95   98.95   92.55   95.80   95.28   95.54   95.54   95.80   95.80   95.54   96.59   96.59   96.59   96.33   96.85   96.85   97.38   96.85   96.85   96.33   96.59   96.85   97.11   96.59   96.85   97.11   96.59   96.33   96.85   97.11   97.11   96.59   96.59   96.85   97.11   96.85   96.85   96.85   97.38   97.64   96.85   97.11   97.64   97.64   97.11   97.38   98.16   97.90   97.64   97.38   98.16   97.38   97.64   97.11   97.64   97.38   97.90   97.90

    20: AGU59995.1            97.63   98.95   99.47   99.21   98.40   98.67   99.21   98.43   98.43   99.21   98.43   99.21   98.69   98.42   98.95   98.95   98.95   98.95   98.43  100.00   98.69   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.69   98.95   98.95   98.95   98.69   98.69   98.95   98.95   98.95   98.95   98.69   98.95   99.74   99.21   98.95   98.95   99.21   99.48   99.21   99.21   91.49   94.75   94.23   94.49   94.49   94.75   94.75   94.49   95.54   95.54   95.54   95.28   95.80   95.80   96.33   95.80   95.80   95.28   95.54   95.80   96.06   95.54   95.80   96.06   95.54   95.28   95.80   96.06   96.06   95.54   95.54   95.80   96.06   95.80   95.80   95.80   96.33   96.59   95.80   96.06   96.59   96.59   96.06   96.06   97.11   96.85   96.59   96.33   97.11   96.33   96.59   96.06   96.59   96.33   96.85   96.85

    21: AGC54799.1            97.89   98.68   98.68   98.95   98.93   99.20   99.48   98.69   98.69   99.48   98.69   98.43   98.95   98.68   99.21   99.21   99.21   99.21   98.69   98.69  100.00   99.74   99.21   99.21   99.21   99.74   99.21   99.21   99.21   99.21   99.21   99.48   98.95   99.21   99.21   99.48   98.95   98.95   99.21   99.21   99.21   99.21   98.95   99.48   98.95   98.95   99.21   99.21   99.48   99.21   99.21   99.21   91.76   95.01   94.49   94.75   94.75   95.01   95.01   94.75   95.80   95.80   95.80   95.54   96.06   96.06   96.59   96.06   96.06   95.54   95.80   96.06   96.33   95.80   96.06   96.33   95.80   95.54   96.06   96.33   96.33   95.80   95.80   96.06   96.33   96.06   96.06   96.06   96.59   96.85   96.06   96.33   96.85   96.85   96.33   96.33   97.38   97.11   96.85   96.59   97.38   96.59   96.85   96.33   96.85   96.59   97.11   97.11

    22: AGC54798.1            98.16   98.95   98.95   99.21   99.20   99.47   99.74   98.95   98.95   99.74   98.95   98.69   99.21   98.95   99.48   99.48   99.48   99.48   98.95   98.95   99.74  100.00   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.21   99.48   99.48   99.48   99.21   99.21   99.48   99.48   99.48   99.48   99.21   99.74   99.21   99.21   99.48   99.48   99.74   99.48   99.48   99.48   92.02   95.28   94.75   95.01   95.01   95.28   95.28   95.01   96.06   96.06   96.06   95.80   96.33   96.33   96.85   96.33   96.33   95.80   96.06   96.33   96.59   96.06   96.33   96.59   96.06   95.80   96.33   96.59   96.59   96.06   96.06   96.33   96.59   96.33   96.33   96.33   96.85   97.11   96.33   96.59   97.11   97.11   96.59   96.59   97.64   97.38   97.11   96.85   97.64   96.85   97.11   96.59   97.11   96.85   97.38   97.38

    23: WP_063859861.1        98.16   98.95   98.95   99.21   99.20   99.20   99.74   98.95   98.95   99.74   98.95   98.69   99.21   98.95   99.48   99.48   99.48   99.48   98.95   98.95   99.21   99.48  100.00   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.21   99.48   99.48   99.48   99.21   99.21   99.48   99.48   99.48   99.48   99.21   99.48   99.21   99.21   99.48   99.48   99.74   99.48   99.48   99.48   92.02   95.28   94.75   95.01   95.01   95.28   95.28   95.01   96.06   96.06   96.06   95.80   96.33   96.33   96.85   96.33   96.33   95.80   96.06   96.33   96.59   96.06   96.33   96.59   96.06   95.80   96.33   96.59   96.59   96.06   96.06   96.33   96.59   96.33   96.33   96.33   96.85   97.11   96.33   96.59   97.11   97.11   96.59   96.59   97.64   97.38   97.11   96.85   97.64   96.85   97.11   96.59   97.11   96.85   97.38   97.38

    24: AEM97674.1            98.16   98.95   98.95   99.21   98.93   99.20   99.74   98.95   98.95   99.74   98.95   98.69   99.21   98.95   99.48   99.48   99.48   99.48   98.95   98.95   99.21   99.48   99.48  100.00   99.48   99.48   99.48   99.48   99.48   99.48   99.74   99.48   99.21   99.48   99.48   99.48   99.21   99.21   99.48   99.48   99.48   99.48   99.21   99.48   99.21   99.21   99.48   99.48   99.74   99.48   99.48   99.48   92.02   95.28   94.75   95.01   95.01   95.28   95.28   95.01   96.06   96.06   96.06   95.80   96.33   96.33   96.85   96.33   96.33   95.80   96.06   96.33   96.59   96.06   96.33   96.59   96.06   95.80   96.33   96.59   96.59   96.06   96.06   96.33   96.59   96.33   96.33   96.33   96.85   97.11   96.33   96.59   97.11   97.11   96.59   96.59   97.64   97.38   97.11   96.85   97.64   96.85   97.11   96.59   97.11   96.85   97.38   97.38

    25: AEM97672.1            98.16   98.95   98.95   99.21   98.93   99.20   99.74   98.95   98.95   99.74   98.95   98.69   99.21   98.95   99.48   99.48   99.48   99.48   98.95   98.95   99.21   99.48   99.48   99.48  100.00   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.21   99.48   99.48   99.48   99.21   99.21   99.48   99.48   99.48   99.48   99.21   99.48   99.21   99.21   99.48   99.48   99.74   99.48   99.48   99.48   92.02   95.28   94.75   95.01   95.01   95.28   95.28   95.01   96.06   96.06   96.06   95.80   96.33   96.33   96.85   96.33   96.33   95.80   96.06   96.33   96.59   96.06   96.33   96.59   96.06   95.80   96.33   96.59   96.59   96.06   96.06   96.33   96.59   96.33   96.33   96.33   96.85   97.11   96.33   96.59   97.11   97.11   96.59   96.59   97.64   97.38   97.11   96.85   97.64   96.85   97.11   96.59   97.11   96.85   97.38   97.38

    26: BAJ17544.1            98.16   98.95   98.95   99.21   98.93   99.20   99.74   98.95   98.95   99.74   98.95   98.69   99.21   98.95   99.48   99.48   99.48   99.48   98.95   98.95   99.74   99.48   99.48   99.48   99.48  100.00   99.48   99.48   99.48   99.48   99.48   99.74   99.21   99.48   99.48   99.74   99.21   99.21   99.48   99.48   99.48   99.48   99.21   99.48   99.21   99.21   99.48   99.48   99.74   99.48   99.48   99.48   92.02   95.28   94.75   95.01   95.01   95.28   95.28   95.01   96.06   96.06   96.06   95.80   96.33   96.33   96.85   96.33   96.33   95.80   96.06   96.33   96.59   96.06   96.33   96.59   96.06   95.80   96.33   96.59   96.59   96.06   96.06   96.33   96.59   96.33   96.33   96.33   96.85   97.11   96.33   96.59   97.11   97.11   96.59   96.59   97.64   97.38   97.11   96.85   97.64   96.85   97.11   96.59   97.11   96.85   97.38   97.38

    27: ADY19254.1            98.16   98.95   98.95   99.21   98.93   99.20   99.74   98.95   98.95   99.74   98.95   98.69   99.21   98.95   99.48   99.48   99.48   99.48   98.95   98.95   99.21   99.48   99.48   99.48   99.48   99.48  100.00   99.48   99.48   99.48   99.48   99.48   99.21   99.48   99.48   99.48   99.21   99.21   99.48   99.48   99.48   99.48   99.21   99.48   99.21   99.21   99.48   99.48   99.74   99.48   99.48   99.48   92.02   95.28   94.75   95.01   95.01   95.28   95.28   95.01   96.06   96.06   96.06   95.80   96.33   96.33   96.85   96.33   96.33   95.80   96.06   96.33   96.59   96.06   96.33   96.59   96.06   95.80   96.33   96.59   96.59   96.06   96.06   96.33   96.59   96.33   96.33   96.33   96.85   97.11   96.33   96.59   97.11   97.11   96.59   96.59   97.64   97.38   97.11   96.85   97.64   96.85   97.11   96.59   97.11   96.85   97.38   97.38

    28: ADP37961.1            98.16   98.95   98.95   99.21   98.93   99.20   99.74   98.95   98.95   99.74   98.95   98.69   99.21   98.95   99.48   99.48   99.48   99.48   98.95   98.95   99.21   99.48   99.48   99.48   99.48   99.48   99.48  100.00   99.48   99.48   99.48   99.48   99.21   99.48   99.48   99.48   99.21   99.21   99.48   99.48   99.48   99.48   99.21   99.48   99.21   99.21   99.48   99.48   99.74   99.48   99.48   99.48   92.02   95.28   94.75   95.01   95.01   95.28   95.28   95.01   96.06   96.06   96.06   95.80   96.33   96.33   96.85   96.33   96.33   95.80   96.06   96.33   96.59   96.06   96.33   96.59   96.06   95.80   96.33   96.59   96.59   96.06   96.06   96.33   96.59   96.33   96.33   96.33   96.85   97.11   96.33   96.59   97.11   97.11   96.59   96.59   97.64   97.38   97.11   96.85   97.64   96.85   97.11   96.59   97.11   96.85   97.38   97.38

    29: ADT91162.1            98.16   98.95   98.95   99.21   98.93   99.20   99.74   98.95   98.95   99.74   98.95   98.69   99.21   98.95   99.48   99.48   99.48   99.48   98.95   98.95   99.21   99.48   99.48   99.48   99.48   99.48   99.48   99.48  100.00   99.48   99.48   99.48   99.21   99.48   99.48   99.48   99.21   99.21   99.48   99.48   99.48   99.48   99.21   99.48   99.21   99.21   99.48   99.48   99.74   99.48   99.48   99.48   92.02   95.28   94.75   95.01   95.01   95.28   95.28   95.01   96.06   96.06   96.06   95.80   96.33   96.33   96.85   96.33   96.33   95.80   96.06   96.33   96.59   96.06   96.33   96.59   96.06   95.80   96.33   96.59   96.59   96.06   96.06   96.33   96.59   96.33   96.33   96.33   96.85   97.11   96.33   96.59   97.11   97.11   96.59   96.59   97.64   97.38   97.11   96.85   97.64   96.85   97.11   96.59   97.11   96.85   97.38   97.38

    30: ADK55605.1            98.16   98.95   98.95   99.21   98.93   99.20   99.74   98.95   98.95   99.74   98.95   98.69   99.21   98.95   99.48   99.48   99.48   99.48   98.95   98.95   99.21   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48  100.00   99.48   99.48   99.21   99.48   99.48   99.48   99.21   99.21   99.48   99.48   99.48   99.48   99.21   99.48   99.21   99.21   99.48   99.48   99.74   99.48   99.48   99.48   92.02   95.28   94.75   95.01   95.01   95.28   95.28   95.01   96.06   96.06   96.06   95.80   96.33   96.33   96.85   96.33   96.33   95.80   96.06   96.33   96.59   96.06   96.33   96.59   96.06   95.80   96.33   96.59   96.59   96.06   96.06   96.33   96.59   96.33   96.33   96.33   96.85   97.11   96.33   96.59   97.11   97.11   96.59   96.59   97.64   97.38   97.11   96.85   97.64   96.85   97.11   96.59   97.11   96.85   97.38   97.38

    31: ACJ05361.1            98.16   98.95   98.95   99.21   98.93   99.20   99.74   98.95   98.95   99.74   98.95   98.69   99.21   98.95   99.48   99.48   99.48   99.48   98.95   98.95   99.21   99.48   99.48   99.74   99.48   99.48   99.48   99.48   99.48   99.48  100.00   99.48   99.21   99.48   99.48   99.48   99.21   99.21   99.48   99.48   99.48   99.48   99.21   99.48   99.21   99.21   99.48   99.48   99.74   99.48   99.48   99.48   92.02   95.28   94.75   95.01   95.01   95.28   95.28   95.01   96.06   96.06   96.06   95.80   96.33   96.33   96.85   96.33   96.33   95.80   96.06   96.33   96.59   96.06   96.33   96.59   96.06   95.80   96.33   96.59   96.59   96.06   96.06   96.33   96.59   96.33   96.33   96.33   96.85   97.11   96.33   96.59   97.11   97.11   96.59   96.59   97.64   97.38   97.11   96.85   97.64   96.85   97.11   96.59   97.11   96.85   97.38   97.38

    32: ADM21467.1            98.16   98.95   98.95   99.21   98.93   99.20   99.74   98.95   98.95   99.74   98.95   98.69   99.21   98.95   99.48   99.48   99.48   99.48   98.95   98.95   99.48   99.48   99.48   99.48   99.48   99.74   99.48   99.48   99.48   99.48   99.48  100.00   99.21   99.48   99.48   99.74   99.21   99.21   99.48   99.48   99.48   99.48   99.21   99.48   99.21   99.21   99.48   99.48   99.74   99.48   99.48   99.48   92.02   95.28   94.75   95.01   95.01   95.28   95.28   95.01   96.06   96.06   96.06   95.80   96.33   96.33   96.85   96.33   96.33   95.80   96.06   96.33   96.59   96.06   96.33   96.59   96.06   95.80   96.33   96.59   96.59   96.06   96.06   96.33   96.59   96.33   96.33   96.33   96.85   97.11   96.33   96.59   97.11   97.11   96.59   96.59   97.64   97.38   97.11   96.85   97.64   96.85   97.11   96.59   97.11   96.85   97.38   97.38

    33: ABN51006.1            97.89   98.68   98.68   98.95   98.67   98.94   99.48   98.95   98.69   99.48   98.69   98.43   98.95   99.74   99.21   99.21   99.21   99.21   99.74   98.69   98.95   99.21   99.21   99.21   99.21   99.21   99.21   99.21   99.21   99.21   99.21   99.21  100.00   99.21   99.21   99.21   98.95   98.95   99.74   99.21   99.21   99.21   98.95   99.21   98.95   98.95   99.21   99.21   99.48   99.21   99.21   99.21   92.82   96.06   95.54   95.80   95.80   96.06   96.06   95.80   96.85   96.85   96.85   96.59   97.11   97.11   97.64   97.11   97.11   96.59   96.85   97.11   97.38   96.85   97.11   97.38   96.85   96.59   97.11   97.38   97.38   96.85   96.85   97.11   97.38   97.11   97.11   97.11   97.64   97.90   97.11   97.38   97.90   97.90   97.38   97.38   98.43   98.16   97.90   97.64   98.43   97.64   97.90   97.38   97.90   97.64   98.16   98.16

    34: ACA97846.1            98.16   98.95   98.95   99.21   98.93   99.20   99.74   98.95   98.95   99.74   99.21   98.69   99.21   98.95   99.48   99.48   99.48   99.48   98.95   98.95   99.21   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.21  100.00   99.48   99.48   99.21   99.21   99.48   99.48   99.48   99.48   99.21   99.48   99.21   99.21   99.48   99.48   99.74   99.48   99.48   99.48   92.02   95.28   94.75   95.01   95.01   95.28   95.28   95.01   96.06   96.06   96.06   95.80   96.33   96.33   96.85   96.33   96.33   95.80   96.06   96.33   96.59   96.06   96.33   96.59   96.06   95.80   96.33   96.59   96.59   96.06   96.06   96.33   96.59   96.33   96.33   96.33   96.85   97.11   96.33   96.59   97.11   97.11   96.59   96.59   97.64   97.38   97.11   96.85   97.64   96.85   97.11   96.59   97.11   96.85   97.38   97.38

    35: ABR18736.1            98.16   98.95   98.95   99.21   98.93   99.20   99.74   98.95   98.95   99.74   98.95   98.69   99.21   98.95   99.48   99.48   99.48   99.48   98.95   98.95   99.21   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.21   99.48  100.00   99.48   99.21   99.21   99.48   99.48   99.48   99.48   99.48   99.48   99.21   99.21   99.48   99.48   99.74   99.48   99.48   99.48   92.02   95.28   94.75   95.01   95.01   95.28   95.28   95.01   96.06   96.06   96.06   95.80   96.33   96.33   96.85   96.33   96.33   95.80   96.06   96.33   96.59   96.06   96.33   96.59   96.06   95.80   96.33   96.59   96.59   96.06   96.06   96.33   96.59   96.33   96.33   96.33   96.85   97.11   96.33   96.59   97.11   97.11   96.59   96.59   97.64   97.38   97.11   96.85   97.64   96.85   97.11   96.59   97.11   96.85   97.38   97.38

    36: ABS12249.1            98.16   98.95   98.95   99.21   98.93   99.20   99.74   98.95   98.95   99.74   98.95   98.69   99.21   98.95   99.48   99.48   99.48   99.48   98.95   98.95   99.48   99.48   99.48   99.48   99.48   99.74   99.48   99.48   99.48   99.48   99.48   99.74   99.21   99.48   99.48  100.00   99.21   99.21   99.48   99.48   99.48   99.48   99.21   99.48   99.21   99.21   99.48   99.48   99.74   99.48   99.48   99.48   92.02   95.28   94.75   95.01   95.01   95.28   95.28   95.01   96.06   96.06   96.06   95.80   96.33   96.33   96.85   96.33   96.33   95.80   96.06   96.33   96.59   96.06   96.33   96.59   96.06   95.80   96.33   96.59   96.59   96.06   96.06   96.33   96.59   96.33   96.33   96.33   96.85   97.11   96.33   96.59   97.11   97.11   96.59   96.59   97.64   97.38   97.11   96.85   97.64   96.85   97.11   96.59   97.11   96.85   97.38   97.38

    37: ABS12248.1            97.89   98.68   98.68   98.95   98.67   98.94   99.48   98.69   98.69   99.48   99.21   98.43   98.95   98.68   99.21   99.21   99.21   99.21   98.69   98.69   98.95   99.21   99.21   99.21   99.21   99.21   99.21   99.21   99.21   99.21   99.21   99.21   98.95   99.21   99.21   99.21  100.00   99.48   99.21   99.21   99.21   99.21   99.48   99.21   98.95   98.95   99.74   99.21   99.48   99.21   99.21   99.21   92.02   95.28   94.75   95.01   95.01   95.28   95.28   95.01   95.80   95.80   95.80   95.54   96.06   96.06   96.59   96.06   96.06   95.54   95.80   96.06   96.33   95.80   96.06   96.33   95.80   95.54   96.06   96.33   96.33   95.80   95.80   96.06   96.33   96.06   96.06   96.06   96.59   96.85   96.06   96.33   96.85   96.85   96.33   96.33   97.64   97.11   96.85   96.59   97.38   96.59   96.85   96.33   96.85   96.59   97.11   97.11

    38: ABQ51091.1            97.89   98.68   98.68   98.95   98.93   99.20   99.48   98.69   98.69   99.48   99.21   98.43   98.95   99.21   99.21   99.21   99.21   99.21   98.69   98.69   98.95   99.21   99.21   99.21   99.21   99.21   99.21   99.21   99.21   99.21   99.21   99.21   98.95   99.21   99.21   99.21   99.48  100.00   99.21   99.21   99.21   99.21   99.48   99.21   98.95   98.95   99.74   99.21   99.48   99.21   99.21   99.21   91.76   95.01   94.49   94.75   94.75   95.01   95.01   94.75   95.80   95.80   95.80   95.54   96.06   96.06   96.59   96.06   96.06   95.54   95.80   96.06   96.33   95.80   96.06   96.33   95.80   95.54   96.06   96.33   96.33   95.80   95.80   96.06   96.33   96.06   96.06   96.06   96.59   96.85   96.06   96.33   96.85   96.85   96.33   96.33   97.64   97.11   96.85   96.59   97.38   96.59   96.85   96.33   96.85   96.59   97.11   97.11

    39: ACA30420.1            98.16   98.95   98.95   99.21   98.93   99.20   99.74   98.95   98.95   99.74   98.95   98.69   99.21   99.47   99.48   99.48   99.48   99.48   99.48   98.95   99.21   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.74   99.48   99.48   99.48   99.21   99.21  100.00   99.48   99.48   99.48   99.21   99.48   99.21   99.21   99.48   99.48   99.74   99.48   99.48   99.48   92.55   95.80   95.28   95.54   95.54   95.80   95.80   95.54   96.59   96.59   96.59   96.33   96.85   96.85   97.38   96.85   96.85   96.33   96.59   96.85   97.11   96.59   96.85   97.11   96.59   96.33   96.85   97.11   97.11   96.59   96.59   96.85   97.11   96.85   96.85   96.85   97.38   97.64   96.85   97.11   97.64   97.64   97.11   97.11   98.16   97.90   97.64   97.38   98.16   97.38   97.64   97.11   97.64   97.38   97.90   97.90

    40: ABN69070.1            98.16   98.95   98.95   99.21   98.93   99.20   99.74   98.95   98.95   99.74   98.95   98.69   99.21   98.95   99.48   99.48   99.48   99.48   98.95   98.95   99.21   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.21   99.48   99.48   99.48   99.21   99.21   99.48  100.00   99.48   99.48   99.21   99.48   99.21   99.21   99.48   99.48   99.74   99.48   99.48   99.48   92.02   95.28   94.75   95.01   95.01   95.28   95.28   95.01   96.06   96.06   96.06   95.80   96.33   96.33   96.85   96.33   96.33   95.80   96.06   96.33   96.59   96.06   96.33   96.59   96.06   95.80   96.33   96.59   96.59   96.06   96.06   96.33   96.59   96.33   96.33   96.33   96.85   97.11   96.33   96.59   97.11   97.11   96.59   96.59   97.64   97.38   97.11   96.85   97.64   96.85   97.11   96.59   97.11   96.85   97.38   97.38

    41: ABF06441.1            98.16   98.95   98.95   99.21   98.93   99.20   99.74   98.95   98.95   99.74   98.95   98.69   99.21   98.95   99.48   99.48   99.48   99.48   98.95   98.95   99.21   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.21   99.48   99.48   99.48   99.21   99.21   99.48   99.48  100.00   99.48   99.21   99.48   99.21   99.21   99.48   99.48   99.74   99.48   99.48   99.48   92.02   95.28   94.75   95.01   95.01   95.28   95.28   95.01   96.06   96.06   96.06   95.80   96.33   96.33   96.85   96.33   96.33   95.80   96.06   96.33   96.59   96.06   96.33   96.59   96.06   95.80   96.33   96.59   96.59   96.06   96.06   96.33   96.59   96.33   96.33   96.33   96.85   97.11   96.33   96.59   97.11   97.11   96.59   96.59   97.64   97.38   97.11   96.85   97.64   96.85   97.11   96.59   97.11   96.85   97.38   97.38

    42: ABB72431.1            98.16   98.95   98.95   99.21   98.93   99.20   99.74   98.95   98.95   99.74   98.95   98.69   99.21   98.95   99.48   99.48   99.48   99.48   98.95   98.95   99.21   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.21   99.48   99.48   99.48   99.21   99.21   99.48   99.48   99.48  100.00   99.21   99.48   99.21   99.21   99.48   99.48   99.74   99.48   99.48   99.48   92.02   95.28   94.75   95.01   95.01   95.28   95.28   95.01   96.06   96.06   96.06   95.80   96.33   96.33   96.85   96.33   96.33   95.80   96.06   96.33   96.59   96.06   96.33   96.59   96.06   95.80   96.33   96.59   96.59   96.06   96.06   96.33   96.59   96.33   96.33   96.33   96.85   97.11   96.33   96.59   97.11   97.11   96.59   96.59   97.64   97.38   97.11   96.85   97.64   96.85   97.11   96.59   97.11   96.85   97.38   97.38

    43: AAZ66866.1            97.89   98.68   98.68   98.95   98.67   98.94   99.48   98.69   98.69   99.48   99.21   98.43   98.95   98.68   99.21   99.21   99.21   99.21   98.69   98.69   98.95   99.21   99.21   99.21   99.21   99.21   99.21   99.21   99.21   99.21   99.21   99.21   98.95   99.21   99.48   99.21   99.48   99.48   99.21   99.21   99.21   99.21  100.00   99.21   98.95   98.95   99.74   99.21   99.48   99.21   99.21   99.21   91.76   95.01   94.49   94.75   94.75   95.01   95.01   94.75   95.80   95.80   95.80   95.54   96.06   96.06   96.59   96.06   96.06   95.54   95.80   96.06   96.33   95.80   96.06   96.33   95.80   95.54   96.06   96.33   96.33   95.80   95.80   96.06   96.33   96.06   96.06   96.06   96.59   96.85   96.06   96.33   96.85   96.85   96.33   96.33   97.64   97.11   96.85   96.59   97.38   96.59   96.85   96.33   96.85   96.59   97.11   97.11

    44: AAS13399.1            98.16   98.95   98.95   99.21   99.20   99.47   99.74   98.95   98.95   99.74   98.95   98.69   99.21   98.95   99.48   99.48   99.48   99.48   98.95   98.95   99.48   99.74   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.21   99.48   99.48   99.48   99.21   99.21   99.48   99.48   99.48   99.48   99.21  100.00   99.21   99.21   99.48   99.48   99.74   99.48   99.48   99.48   92.02   95.28   94.75   95.01   95.01   95.28   95.28   95.01   96.06   96.06   96.06   95.80   96.33   96.33   96.85   96.33   96.33   95.80   96.06   96.33   96.59   96.06   96.33   96.59   96.06   95.80   96.33   96.59   96.59   96.06   96.06   96.33   96.59   96.33   96.33   96.33   96.85   97.11   96.33   96.59   97.11   97.11   96.59   96.59   97.64   97.38   97.11   96.85   97.64   96.85   97.11   96.59   97.11   96.85   97.38   97.38

    45: Q4LCT4|Q4LCT4_PROMI   97.89   99.21   99.74   99.47   98.67   98.94   99.48   98.69   98.69   99.48   98.69   99.48   98.95   98.68   99.21   99.21   99.21   99.21   98.69   99.74   98.95   99.21   99.21   99.21   99.21   99.21   99.21   99.21   99.21   99.21   99.21   99.21   98.95   99.21   99.21   99.21   98.95   98.95   99.21   99.21   99.21   99.21   98.95   99.21  100.00   99.48   99.21   99.21   99.48   99.74   99.48   99.48   91.76   95.01   94.49   94.75   94.75   95.01   95.01   94.75   95.80   95.80   95.80   95.54   96.06   96.06   96.59   96.06   96.06   95.54   95.80   96.06   96.33   95.80   96.06   96.33   95.80   95.54   96.06   96.33   96.33   95.80   95.80   96.06   96.33   96.06   96.06   96.06   96.59   96.85   96.06   96.33   96.85   96.85   96.33   96.33   97.38   97.11   96.85   96.59   97.38   96.59   96.85   96.33   96.85   96.59   97.11   97.11

    46: Q70Q38|Q70Q38_PROMI   97.89   99.21   99.21   99.47   98.67   98.94   99.48   98.69   98.69   99.48   98.69   98.95   98.95   98.68   99.21   99.21   99.21   99.21   98.69   99.21   98.95   99.21   99.21   99.21   99.21   99.21   99.21   99.21   99.21   99.21   99.21   99.21   98.95   99.21   99.21   99.21   98.95   98.95   99.21   99.21   99.21   99.21   98.95   99.21   99.48  100.00   99.21   99.21   99.48   99.74   99.48   99.48   91.76   95.01   94.49   94.75   94.75   95.01   95.01   94.75   95.80   95.80   95.80   95.54   96.06   96.06   96.59   96.06   96.06   95.54   95.80   96.06   96.33   95.80   96.06   96.33   95.80   95.54   96.06   96.33   96.33   95.80   95.80   96.06   96.33   96.06   96.06   96.06   96.59   96.85   96.06   96.33   96.85   96.85   96.33   96.33   97.38   97.11   96.85   96.59   97.38   96.59   96.85   96.33   96.85   96.59   97.11   97.11

    47: Q9S6R4|Q9S6R4_ECOLX   98.16   98.95   98.95   99.21   98.93   99.20   99.74   98.95   98.95   99.74   99.48   98.69   99.21   98.95   99.48   99.48   99.48   99.48   98.95   98.95   99.21   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.21   99.48   99.48   99.48   99.74   99.74   99.48   99.48   99.48   99.48   99.74   99.48   99.21   99.21  100.00   99.48   99.74   99.48   99.48   99.48   92.02   95.28   94.75   95.01   95.01   95.28   95.28   95.01   96.06   96.06   96.06   95.80   96.33   96.33   96.85   96.33   96.33   95.80   96.06   96.33   96.59   96.06   96.33   96.59   96.06   95.80   96.33   96.59   96.59   96.06   96.06   96.33   96.59   96.33   96.33   96.33   96.85   97.11   96.33   96.59   97.11   97.11   96.59   96.59   97.90   97.38   97.11   96.85   97.64   96.85   97.11   96.59   97.11   96.85   97.38   97.38

    48: Q9XB33|Q9XB33_KLEOX   98.16   98.95   98.95   99.21   98.93   99.20   99.74   98.95   98.95   99.74   98.95   98.69   99.21   98.95   99.48   99.48   99.48   99.48   98.95   98.95   99.21   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.21   99.48   99.48   99.48   99.21   99.21   99.48   99.48   99.48   99.48   99.21   99.48   99.21   99.21   99.48  100.00   99.74   99.48   99.48   99.48   92.02   95.28   95.28   95.01   95.01   95.28   95.28   95.01   96.06   96.06   96.06   95.80   96.33   96.33   96.85   96.33   96.33   95.80   96.06   96.33   96.59   96.06   96.33   96.59   96.06   95.80   96.33   96.59   96.59   96.06   96.06   96.33   96.59   96.33   96.33   96.33   96.85   97.11   96.33   96.59   97.11   97.11   96.59   96.59   97.64   97.38   97.11   96.85   97.64   96.85   97.11   96.59   97.11   96.85   97.38   97.38

    49: Q48434|Q48434_KLEPN   98.42   99.21   99.21   99.47   99.20   99.47  100.00   99.21   99.21  100.00   99.21   98.95   99.48   99.21   99.74   99.74   99.74   99.74   99.21   99.21   99.48   99.74   99.74   99.74   99.74   99.74   99.74   99.74   99.74   99.74   99.74   99.74   99.48   99.74   99.74   99.74   99.48   99.48   99.74   99.74   99.74   99.74   99.48   99.74   99.48   99.48   99.74   99.74  100.00   99.74   99.74   99.74   92.29   95.54   95.01   95.28   95.28   95.54   95.54   95.28   96.33   96.33   96.33   96.06   96.59   96.59   97.11   96.59   96.59   96.06   96.33   96.59   96.85   96.33   96.59   96.85   96.33   96.06   96.59   96.85   96.85   96.33   96.33   96.59   96.85   96.59   96.59   96.59   97.11   97.38   96.59   96.85   97.38   97.38   96.85   96.85   97.90   97.64   97.38   97.11   97.90   97.11   97.38   96.85   97.38   97.11   97.64   97.64

    50: O33446|O33446_PROMI   98.16   99.47   99.47   99.74   98.93   99.20   99.74   98.95   98.95   99.74   98.95   99.21   99.21   98.95   99.48   99.48   99.48   99.48   98.95   99.48   99.21   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.21   99.48   99.48   99.48   99.21   99.21   99.48   99.48   99.48   99.48   99.21   99.48   99.74   99.74   99.48   99.48   99.74  100.00   99.74   99.74   92.02   95.28   94.75   95.01   95.01   95.28   95.28   95.01   96.06   96.06   96.06   95.80   96.33   96.33   96.85   96.33   96.33   95.80   96.06   96.33   96.59   96.06   96.33   96.59   96.06   95.80   96.33   96.59   96.59   96.06   96.06   96.33   96.59   96.33   96.33   96.33   96.85   97.11   96.33   96.59   97.11   97.11   96.59   96.59   97.64   97.38   97.11   96.85   97.64   96.85   97.11   96.59   97.11   96.85   97.38   97.38

    51: Q9S6R5|Q9S6R5_ECOLX   98.16   99.21   99.21   99.47   98.93   99.20   99.74   98.95   98.95   99.74   98.95   98.95   99.21   98.95   99.48   99.48   99.48   99.48   98.95   99.21   99.21   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.21   99.48   99.48   99.48   99.21   99.21   99.48   99.48   99.48   99.48   99.21   99.48   99.48   99.48   99.48   99.48   99.74   99.74  100.00   99.74   92.02   95.28   94.75   95.01   95.01   95.28   95.28   95.01   96.06   96.06   96.06   95.80   96.33   96.33   96.85   96.33   96.33   95.80   96.06   96.33   96.59   96.06   96.33   96.59   96.06   95.80   96.33   96.59   96.59   96.06   96.06   96.33   96.59   96.33   96.33   96.33   96.85   97.11   96.33   96.59   97.11   97.11   96.59   96.59   97.64   97.38   97.11   96.85   97.64   96.85   97.11   96.59   97.11   96.85   97.38   97.38

    52: ACA30421.1            98.16   99.21   99.21   99.47   98.93   99.20   99.74   98.95   98.95   99.74   98.95   98.95   99.21   98.95   99.48   99.48   99.48   99.48   98.95   99.21   99.21   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.48   99.21   99.48   99.48   99.48   99.21   99.21   99.48   99.48   99.48   99.48   99.21   99.48   99.48   99.48   99.48   99.48   99.74   99.74   99.74  100.00   92.02   95.28   94.75   95.01   95.01   95.28   95.28   95.01   96.06   96.06   96.06   95.80   96.33   96.33   96.85   96.33   96.33   95.80   96.06   96.33   96.59   96.06   96.33   96.59   96.06   95.80   96.33   96.59   96.59   96.06   96.06   96.33   96.59   96.33   96.33   96.33   96.85   97.11   96.33   96.59   97.11   97.11   96.59   96.59   97.64   97.38   97.11   96.85   97.64   96.85   97.11   96.59   97.11   96.85   97.38   97.38

    53: AGH70380.1            91.20   91.47   91.47   91.73   91.35   91.67   92.29   92.82   91.76   92.29   91.49   91.22   91.76   92.53   92.02   92.02   92.02   92.02   92.55   91.49   91.76   92.02   92.02   92.02   92.02   92.02   92.02   92.02   92.02   92.02   92.02   92.02   92.82   92.02   92.02   92.02   92.02   91.76   92.55   92.02   92.02   92.02   91.76   92.02   91.76   91.76   92.02   92.02   92.29   92.02   92.02   92.02  100.00   94.68   94.41   94.95   94.68   94.95   94.95   94.68   91.76   92.29   92.29   92.02   92.55   92.02   92.55   92.55   92.82   92.02   91.76   92.02   92.29   92.29   92.55   92.82   92.29   92.02   92.55   92.55   92.29   92.29   92.55   92.55   92.82   92.82   92.55   92.55   93.09   93.35   92.02   91.76   92.29   92.82   91.76   92.82   92.82   92.55   92.55   92.29   93.09   92.29   92.02   92.02   92.02   91.76   92.29   92.29

    54: AHA80101.1            94.21   94.74   94.74   95.00   94.67   94.96   95.54   95.54   95.01   95.54   94.75   94.49   95.01   95.79   95.28   95.28   95.28   95.28   95.80   94.75   95.01   95.28   95.28   95.28   95.28   95.28   95.28   95.28   95.28   95.28   95.28   95.28   96.06   95.28   95.28   95.28   95.28   95.01   95.80   95.28   95.28   95.28   95.01   95.28   95.01   95.01   95.28   95.28   95.54   95.28   95.28   95.28   94.68  100.00   98.43   99.21   98.95   99.21   98.95   98.69   95.01   94.49   95.01   94.75   94.75   95.28   95.28   94.75   95.01   94.75   95.01   95.28   95.54   95.01   95.28   95.01   95.01   94.75   94.75   95.01   95.54   95.01   95.28   95.28   95.01   95.28   95.28   95.28   95.80   95.54   93.96   93.70   94.23   95.28   94.75   95.01   95.54   95.54   94.75   95.01   95.80   95.01   94.75   94.75   94.75   94.49   95.01   95.01

    55: AHM76768.1            93.68   94.21   94.21   94.47   94.13   94.43   95.01   95.01   94.49   95.01   94.23   93.96   94.49   95.26   94.75   94.75   94.75   94.75   95.28   94.23   94.49   94.75   94.75   94.75   94.75   94.75   94.75   94.75   94.75   94.75   94.75   94.75   95.54   94.75   94.75   94.75   94.75   94.49   95.28   94.75   94.75   94.75   94.49   94.75   94.49   94.49   94.75   95.28   95.01   94.75   94.75   94.75   94.41   98.43  100.00   98.69   99.48   99.21   99.48   99.21   95.01   94.49   95.01   94.75   94.75   95.28   95.28   94.75   95.01   94.75   95.01   95.28   95.54   95.01   95.28   95.01   95.01   94.75   94.75   95.01   95.54   95.01   95.28   95.28   95.01   95.28   95.28   95.28   95.80   95.54   93.96   93.70   94.23   95.28   94.23   95.01   95.54   95.01   94.75   95.01   95.80   95.01   94.75   94.75   94.75   94.49   95.01   95.01

    56: AFU25635.1            93.95   94.47   94.47   94.74   94.40   94.69   95.28   95.28   94.75   95.28   94.49   94.23   94.75   95.53   95.01   95.01   95.01   95.01   95.54   94.49   94.75   95.01   95.01   95.01   95.01   95.01   95.01   95.01   95.01   95.01   95.01   95.01   95.80   95.01   95.01   95.01   95.01   94.75   95.54   95.01   95.01   95.01   94.75   95.01   94.75   94.75   95.01   95.01   95.28   95.01   95.01   95.01   94.95   99.21   98.69  100.00   99.21   99.48   99.21   98.95   95.28   94.75   95.28   95.01   95.01   95.54   95.54   95.01   95.28   95.01   95.28   95.54   95.80   95.28   95.54   95.28   95.28   95.01   95.01   95.28   95.80   95.28   95.54   95.54   95.28   95.54   95.54   95.54   96.06   95.80   94.23   93.96   94.49   95.54   94.49   95.28   95.80   95.28   95.01   95.28   96.06   95.28   95.01   95.01   95.01   94.75   95.28   95.28

    57: AFU25632.1            93.95   94.47   94.47   94.74   94.40   94.69   95.28   95.28   94.75   95.28   94.49   94.23   94.75   95.53   95.01   95.01   95.01   95.01   95.54   94.49   94.75   95.01   95.01   95.01   95.01   95.01   95.01   95.01   95.01   95.01   95.01   95.01   95.80   95.01   95.01   95.01   95.01   94.75   95.54   95.01   95.01   95.01   94.75   95.01   94.75   94.75   95.01   95.01   95.28   95.01   95.01   95.01   94.68   98.95   99.48   99.21  100.00   99.74   99.48   99.21   95.28   94.75   95.28   95.01   95.01   95.54   95.54   95.01   95.28   95.01   95.28   95.54   95.80   95.28   95.54   95.28   95.28   95.01   95.01   95.28   95.80   95.28   95.54   95.54   95.28   95.54   95.54   95.54   96.06   95.80   94.23   93.96   94.49   95.54   94.49   95.28   95.80   95.28   95.01   95.28   96.06   95.28   95.01   95.01   95.01   94.75   95.28   95.28

    58: AHA80102.1            94.21   94.74   94.74   95.00   94.67   94.96   95.54   95.54   95.01   95.54   94.75   94.49   95.01   95.79   95.28   95.28   95.28   95.28   95.80   94.75   95.01   95.28   95.28   95.28   95.28   95.28   95.28   95.28   95.28   95.28   95.28   95.28   96.06   95.28   95.28   95.28   95.28   95.01   95.80   95.28   95.28   95.28   95.01   95.28   95.01   95.01   95.28   95.28   95.54   95.28   95.28   95.28   94.95   99.21   99.21   99.48   99.74  100.00   99.74   99.48   95.54   95.01   95.54   95.28   95.28   95.80   95.80   95.28   95.54   95.28   95.54   95.80   96.06   95.54   95.80   95.54   95.54   95.28   95.28   95.54   96.06   95.54   95.80   95.80   95.54   95.80   95.80   95.80   96.33   96.06   94.49   94.23   94.75   95.80   94.75   95.54   96.06   95.54   95.28   95.54   96.33   95.54   95.28   95.28   95.28   95.01   95.54   95.54

    59: AHL39324.1            94.21   94.74   94.74   95.00   94.67   94.96   95.54   95.54   95.01   95.54   94.75   94.49   95.01   95.79   95.28   95.28   95.28   95.28   95.80   94.75   95.01   95.28   95.28   95.28   95.28   95.28   95.28   95.28   95.28   95.28   95.28   95.28   96.06   95.28   95.28   95.28   95.28   95.01   95.80   95.28   95.28   95.28   95.01   95.28   95.01   95.01   95.28   95.28   95.54   95.28   95.28   95.28   94.95   98.95   99.48   99.21   99.48   99.74  100.00   99.74   95.54   95.01   95.54   95.28   95.28   95.80   95.80   95.28   95.54   95.28   95.54   95.80   96.06   95.54   95.80   95.54   95.54   95.28   95.28   95.54   96.06   95.54   95.80   95.80   95.54   95.80   95.80   95.80   96.33   96.06   94.49   94.23   94.75   95.80   94.75   95.54   96.06   95.54   95.28   95.54   96.33   95.54   95.28   95.28   95.28   95.01   95.54   95.54

    60: AFU25638.1            93.95   94.47   94.47   94.74   94.40   94.69   95.28   95.28   94.75   95.28   94.49   94.23   94.75   95.53   95.01   95.01   95.01   95.01   95.54   94.49   94.75   95.01   95.01   95.01   95.01   95.01   95.01   95.01   95.01   95.01   95.01   95.01   95.80   95.01   95.01   95.01   95.01   94.75   95.54   95.01   95.01   95.01   94.75   95.01   94.75   94.75   95.01   95.01   95.28   95.01   95.01   95.01   94.68   98.69   99.21   98.95   99.21   99.48   99.74  100.00   95.28   94.75   95.28   95.01   95.01   95.54   95.54   95.01   95.28   95.01   95.28   95.54   95.80   95.28   95.54   95.28   95.28   95.01   95.01   95.54   96.06   95.54   95.54   95.80   95.54   95.54   95.54   95.54   96.06   95.80   94.23   93.96   94.49   95.54   94.49   95.28   95.80   95.28   95.01   95.28   96.06   95.28   95.01   95.01   95.01   94.75   95.28   95.28

    61: AHL39322.1            95.00   95.53   95.53   95.79   95.47   95.76   96.33   96.33   95.54   96.33   95.54   95.28   95.80   96.58   96.06   96.06   96.06   96.06   96.59   95.54   95.80   96.06   96.06   96.06   96.06   96.06   96.06   96.06   96.06   96.06   96.06   96.06   96.85   96.06   96.06   96.06   95.80   95.80   96.59   96.06   96.06   96.06   95.80   96.06   95.80   95.80   96.06   96.06   96.33   96.06   96.06   96.06   91.76   95.01   95.01   95.28   95.28   95.54   95.54   95.28  100.00   98.43   98.95   98.69   97.64   98.16   98.16   97.64   97.64   97.64   97.90   98.16   98.43   97.90   98.16   97.90   97.90   97.64   97.38   97.90   98.43   97.90   97.90   98.16   97.90   98.16   98.16   98.16   98.69   98.43   95.01   94.75   95.28   95.80   94.75   95.80   96.85   95.54   95.80   95.54   96.33   95.54   95.28   95.28   95.28   95.01   95.54   95.54

    62: L0R279|L0R279_CITFR   94.74   95.53   95.53   95.79   95.47   95.76   96.33   96.85   95.54   96.33   95.54   95.28   95.80   96.58   96.06   96.06   96.06   96.06   96.59   95.54   95.80   96.06   96.06   96.06   96.06   96.06   96.06   96.06   96.06   96.06   96.06   96.06   96.85   96.06   96.06   96.06   95.80   95.80   96.59   96.06   96.06   96.06   95.80   96.06   95.80   95.80   96.06   96.06   96.33   96.06   96.06   96.06   92.29   94.49   94.49   94.75   94.75   95.01   95.01   94.75   98.43  100.00   99.48   99.74   98.16   97.64   98.16   98.69   98.69   98.16   97.90   98.16   98.43   98.43   98.69   98.43   97.90   97.64   97.90   97.90   97.90   97.90   97.90   98.16   98.43   98.16   98.16   98.16   98.69   98.95   95.01   94.75   95.28   95.80   94.75   96.33   96.85   95.80   95.80   95.54   96.33   95.54   95.28   95.28   95.28   95.01   95.54   95.54

    63: AFU25641.1            95.00   95.53   95.53   95.79   95.47   95.76   96.33   96.85   95.54   96.33   95.54   95.28   95.80   96.58   96.06   96.06   96.06   96.06   96.59   95.54   95.80   96.06   96.06   96.06   96.06   96.06   96.06   96.06   96.06   96.06   96.06   96.06   96.85   96.06   96.06   96.06   95.80   95.80   96.59   96.06   96.06   96.06   95.80   96.06   95.80   95.80   96.06   96.06   96.33   96.06   96.06   96.06   92.29   95.01   95.01   95.28   95.28   95.54   95.54   95.28   98.95   99.48  100.00   99.74   98.16   98.16   98.16   98.69   98.69   98.69   98.43   98.69   98.95   98.95   99.21   98.43   98.43   98.16   97.90   97.90   98.43   98.43   98.43   98.69   98.43   98.69   98.69   98.69   99.21   98.95   95.01   94.75   95.28   95.80   94.75   96.33   96.85   95.80   95.80   95.54   96.33   95.54   95.28   95.28   95.28   95.01   95.54   95.54

    64: AFK73443.1            94.74   95.26   95.26   95.53   95.20   95.49   96.06   96.59   95.28   96.06   95.28   95.01   95.54   96.32   95.80   95.80   95.80   95.80   96.33   95.28   95.54   95.80   95.80   95.80   95.80   95.80   95.80   95.80   95.80   95.80   95.80   95.80   96.59   95.80   95.80   95.80   95.54   95.54   96.33   95.80   95.80   95.80   95.54   95.80   95.54   95.54   95.80   95.80   96.06   95.80   95.80   95.80   92.02   94.75   94.75   95.01   95.01   95.28   95.28   95.01   98.69   99.74   99.74  100.00   97.90   97.90   97.90   98.43   98.43   98.43   98.16   98.43   98.69   98.69   98.95   98.16   98.16   97.90   97.64   97.64   98.16   98.16   98.16   98.43   98.16   98.43   98.43   98.43   98.95   98.69   94.75   94.49   95.01   95.54   94.49   96.06   96.59   95.54   95.54   95.28   96.06   95.28   95.01   95.01   95.01   94.75   95.28   95.28

    65: AIT76097.1            95.00   95.79   95.79   96.05   95.73   96.02   96.59   97.11   95.80   96.59   95.80   95.54   96.06   96.84   96.33   96.33   96.33   96.33   96.85   95.80   96.06   96.33   96.33   96.33   96.33   96.33   96.33   96.33   96.33   96.33   96.33   96.33   97.11   96.33   96.33   96.33   96.06   96.06   96.85   96.33   96.33   96.33   96.06   96.33   96.06   96.06   96.33   96.33   96.59   96.33   96.33   96.33   92.55   94.75   94.75   95.01   95.01   95.28   95.28   95.01   97.64   98.16   98.16   97.90  100.00   98.95   99.48   98.43   98.43   97.90   97.64   97.90   98.16   98.16   98.43   98.69   98.16   97.90   98.69   98.16   98.16   98.16   98.69   98.43   98.69   98.43   98.95   98.95   98.95   99.21   95.28   95.01   95.80   96.06   95.01   96.59   97.11   96.06   96.06   95.80   96.59   95.80   95.54   95.54   95.54   95.28   95.80   95.80

    66: AFK73446.1            95.26   95.79   95.79   96.05   95.73   96.02   96.59   96.59   95.80   96.59   95.80   95.54   96.06   96.84   96.33   96.33   96.33   96.33   96.85   95.80   96.06   96.33   96.33   96.33   96.33   96.33   96.33   96.33   96.33   96.33   96.33   96.33   97.11   96.33   96.33   96.33   96.06   96.06   96.85   96.33   96.33   96.33   96.06   96.33   96.06   96.06   96.33   96.33   96.59   96.33   96.33   96.33   92.02   95.28   95.28   95.54   95.54   95.80   95.80   95.54   98.16   97.64   98.16   97.90   98.95  100.00   99.48   97.90   97.90   97.90   98.16   98.43   98.69   98.16   98.43   98.16   98.16   98.16   98.16   98.16   98.69   98.16   98.69   98.43   98.16   98.43   98.95   98.95   98.95   98.69   95.28   95.01   95.80   96.06   95.01   96.06   97.11   95.80   96.06   95.80   96.59   95.80   95.54   95.54   95.54   95.28   95.80   95.80

    67: AIT76093.1            95.53   96.32   96.32   96.58   96.27   96.55   97.11   97.11   96.33   97.11   96.33   96.06   96.59   97.37   96.85   96.85   96.85   96.85   97.38   96.33   96.59   96.85   96.85   96.85   96.85   96.85   96.85   96.85   96.85   96.85   96.85   96.85   97.64   96.85   96.85   96.85   96.59   96.59   97.38   96.85   96.85   96.85   96.59   96.85   96.59   96.59   96.85   96.85   97.11   96.85   96.85   96.85   92.55   95.28   95.28   95.54   95.54   95.80   95.80   95.54   98.16   98.16   98.16   97.90   99.48   99.48  100.00   98.43   98.43   97.90   98.16   98.43   98.69   98.16   98.43   98.69   98.16   97.90   98.69   98.69   98.69   98.16   98.69   98.43   98.69   98.43   98.95   98.95   98.95   99.21   95.80   95.54   96.33   96.59   95.54   96.59   97.64   96.33   96.59   96.33   97.11   96.33   96.06   96.06   96.06   95.80   96.33   96.33

    68: AIT76099.1            95.00   95.79   95.79   96.05   95.73   96.02   96.59   97.11   95.80   96.59   95.80   95.54   96.06   96.84   96.33   96.33   96.33   96.33   96.85   95.80   96.06   96.33   96.33   96.33   96.33   96.33   96.33   96.33   96.33   96.33   96.33   96.33   97.11   96.33   96.33   96.33   96.06   96.06   96.85   96.33   96.33   96.33   96.06   96.33   96.06   96.06   96.33   96.33   96.59   96.33   96.33   96.33   92.55   94.75   94.75   95.01   95.01   95.28   95.28   95.01   97.64   98.69   98.69   98.43   98.43   97.90   98.43  100.00   99.48   99.48   98.95   99.21   99.21   99.48   99.48   98.95   98.43   98.16   98.16   98.43   98.16   98.43   98.69   98.43   98.69   98.43   98.43   98.43   98.95   99.21   95.28   95.01   95.54   96.06   95.01   96.59   97.11   96.06   96.06   95.80   96.59   95.80   95.54   95.54   95.54   95.28   95.80   95.80

    69: AIT76089.1            95.00   95.79   95.79   96.05   95.73   96.02   96.59   97.11   96.06   96.59   95.80   95.54   96.06   96.84   96.33   96.33   96.33   96.33   96.85   95.80   96.06   96.33   96.33   96.33   96.33   96.33   96.33   96.33   96.33   96.33   96.33   96.33   97.11   96.33   96.33   96.33   96.06   96.06   96.85   96.33   96.33   96.33   96.06   96.33   96.06   96.06   96.33   96.33   96.59   96.33   96.33   96.33   92.82   95.01   95.01   95.28   95.28   95.54   95.54   95.28   97.64   98.69   98.69   98.43   98.43   97.90   98.43   99.48  100.00   98.95   98.69   98.95   99.21   99.21   99.48   98.69   98.16   97.90   98.16   98.16   98.16   98.16   99.21   98.43   98.69   98.43   98.43   98.43   98.95   99.21   95.54   95.28   95.80   96.33   95.28   96.85   97.11   96.33   96.33   96.06   96.85   96.06   95.80   95.80   95.80   95.54   96.06   96.06

    70: AFK73452.1            94.74   95.26   95.26   95.53   95.20   95.49   96.06   96.59   95.28   96.06   95.28   95.01   95.54   96.32   95.80   95.80   95.80   95.80   96.33   95.28   95.54   95.80   95.80   95.80   95.80   95.80   95.80   95.80   95.80   95.80   95.80   95.80   96.59   95.80   95.80   95.80   95.54   95.54   96.33   95.80   95.80   95.80   95.54   95.80   95.54   95.54   95.80   95.80   96.06   95.80   95.80   95.80   92.02   94.75   94.75   95.01   95.01   95.28   95.28   95.01   97.64   98.16   98.69   98.43   97.90   97.90   97.90   99.48   98.95  100.00   98.95   99.21   99.21   99.48   99.48   98.43   98.43   98.16   97.64   97.90   98.16   98.43   98.69   98.43   98.16   98.43   98.43   98.43   98.95   98.69   94.75   94.49   95.01   95.54   94.49   96.06   96.59   95.54   95.54   95.54   96.06   95.54   95.28   95.28   95.28   95.01   95.54   95.54

    71: AEZ49855.1            95.00   95.53   95.53   95.79   95.47   95.76   96.33   96.33   95.54   96.33   95.54   95.28   95.80   96.58   96.06   96.06   96.06   96.06   96.59   95.54   95.80   96.06   96.06   96.06   96.06   96.06   96.06   96.06   96.06   96.06   96.06   96.06   96.85   96.06   96.06   96.06   95.80   95.80   96.59   96.06   96.06   96.06   95.80   96.06   95.80   95.80   96.06   96.06   96.33   96.06   96.06   96.06   91.76   95.01   95.01   95.28   95.28   95.54   95.54   95.28   97.90   97.90   98.43   98.16   97.64   98.16   98.16   98.95   98.69   98.95  100.00   99.74   99.48   99.48   99.21   98.43   98.43   98.16   97.38   98.43   98.43   98.43   98.43   98.16   97.90   98.16   98.16   98.16   98.69   98.43   95.01   94.75   95.28   95.80   94.75   95.80   96.85   95.54   95.80   95.54   96.33   95.54   95.28   95.28   95.28   95.01   95.54   95.54

    72: AHL39330.1            95.26   95.79   95.79   96.05   95.73   96.02   96.59   96.59   95.80   96.59   95.80   95.54   96.06   96.84   96.33   96.33   96.33   96.33   96.85   95.80   96.06   96.33   96.33   96.33   96.33   96.33   96.33   96.33   96.33   96.33   96.33   96.33   97.11   96.33   96.33   96.33   96.06   96.06   96.85   96.33   96.33   96.33   96.06   96.33   96.06   96.06   96.33   96.33   96.59   96.33   96.33   96.33   92.02   95.28   95.28   95.54   95.54   95.80   95.80   95.54   98.16   98.16   98.69   98.43   97.90   98.43   98.43   99.21   98.95   99.21   99.74  100.00   99.74   99.74   99.48   98.69   98.69   98.43   97.64   98.69   98.69   98.69   98.69   98.43   98.16   98.43   98.43   98.43   98.95   98.69   95.28   95.01   95.54   96.06   95.01   96.06   97.11   95.80   96.06   95.80   96.59   95.80   95.54   95.54   95.54   95.28   95.80   95.80

    73: AFK73434.1            95.53   96.05   96.05   96.32   96.00   96.29   96.85   96.85   96.06   96.85   96.06   95.80   96.33   97.11   96.59   96.59   96.59   96.59   97.11   96.06   96.33   96.59   96.59   96.59   96.59   96.59   96.59   96.59   96.59   96.59   96.59   96.59   97.38   96.59   96.59   96.59   96.33   96.33   97.11   96.59   96.59   96.59   96.33   96.59   96.33   96.33   96.59   96.59   96.85   96.59   96.59   96.59   92.29   95.54   95.54   95.80   95.80   96.06   96.06   95.80   98.43   98.43   98.95   98.69   98.16   98.69   98.69   99.21   99.21   99.21   99.48   99.74  100.00   99.48   99.74   98.43   98.43   98.16   97.90   98.43   98.95   98.43   98.95   98.69   98.43   98.69   98.69   98.69   99.21   98.95   95.54   95.28   95.80   96.33   95.28   96.33   97.38   96.06   96.33   96.06   96.85   96.06   95.80   95.80   95.80   95.54   96.06   96.06

    74: ADH82410.1            95.00   95.53   95.53   95.79   95.47   95.76   96.33   96.85   95.54   96.33   95.54   95.28   95.80   96.58   96.06   96.06   96.06   96.06   96.59   95.54   95.80   96.06   96.06   96.06   96.06   96.06   96.06   96.06   96.06   96.06   96.06   96.06   96.85   96.06   96.06   96.06   95.80   95.80   96.59   96.06   96.06   96.06   95.80   96.06   95.80   95.80   96.06   96.06   96.33   96.06   96.06   96.06   92.29   95.01   95.01   95.28   95.28   95.54   95.54   95.28   97.90   98.43   98.95   98.69   98.16   98.16   98.16   99.48   99.21   99.48   99.48   99.74   99.48  100.00   99.74   98.95   98.95   98.69   97.90   98.43   98.43   98.95   98.95   98.69   98.43   98.69   98.69   98.69   99.21   98.95   95.01   94.75   95.28   95.80   94.75   96.33   96.85   95.80   95.80   95.54   96.33   95.54   95.28   95.28   95.28   95.01   95.54   95.54

    75: AEI52842.1            95.26   95.79   95.79   96.05   95.73   96.02   96.59   97.11   95.80   96.59   95.80   95.54   96.06   96.84   96.33   96.33   96.33   96.33   96.85   95.80   96.06   96.33   96.33   96.33   96.33   96.33   96.33   96.33   96.33   96.33   96.33   96.33   97.11   96.33   96.33   96.33   96.06   96.06   96.85   96.33   96.33   96.33   96.06   96.33   96.06   96.06   96.33   96.33   96.59   96.33   96.33   96.33   92.55   95.28   95.28   95.54   95.54   95.80   95.80   95.54   98.16   98.69   99.21   98.95   98.43   98.43   98.43   99.48   99.48   99.48   99.21   99.48   99.74   99.74  100.00   98.69   98.69   98.43   98.16   98.16   98.69   98.69   99.21   98.95   98.69   98.95   98.95   98.95   99.48   99.21   95.28   95.01   95.54   96.06   95.01   96.59   97.11   96.06   96.06   95.80   96.59   95.80   95.54   95.54   95.54   95.28   95.80   95.80

    76: AIT76090.1            95.26   96.05   96.05   96.32   96.00   96.29   96.85   97.38   96.06   96.85   96.06   95.80   96.33   97.11   96.59   96.59   96.59   96.59   97.11   96.06   96.33   96.59   96.59   96.59   96.59   96.59   96.59   96.59   96.59   96.59   96.59   96.59   97.38   96.59   96.59   96.59   96.33   96.33   97.11   96.59   96.59   96.59   96.33   96.59   96.33   96.33   96.59   96.59   96.85   96.59   96.59   96.59   92.82   95.01   95.01   95.28   95.28   95.54   95.54   95.28   97.90   98.43   98.43   98.16   98.69   98.16   98.69   98.95   98.69   98.43   98.43   98.69   98.43   98.95   98.69  100.00   99.48   99.21   98.43   98.95   98.95   98.95   98.43   98.69   98.95   98.69   98.69   98.69   99.21   99.48   95.54   95.28   95.80   96.33   95.28   96.85   97.38   96.33   96.33   96.06   96.85   96.06   95.80   95.80   95.80   95.54   96.06   96.06

    77: BAG14343.1            95.00   95.53   95.53   95.79   95.47   95.76   96.33   96.85   95.54   96.33   95.54   95.28   95.80   96.58   96.06   96.06   96.06   96.06   96.59   95.54   95.80   96.06   96.06   96.06   96.06   96.06   96.06   96.06   96.06   96.06   96.06   96.06   96.85   96.06   96.06   96.06   95.80   95.80   96.59   96.06   96.06   96.06   95.80   96.06   95.80   95.80   96.06   96.06   96.33   96.06   96.06   96.06   92.29   95.01   95.01   95.28   95.28   95.54   95.54   95.28   97.90   97.90   98.43   98.16   98.16   98.16   98.16   98.43   98.16   98.43   98.43   98.69   98.43   98.95   98.69   99.48  100.00   99.74   97.90   98.43   98.95   98.95   98.43   98.69   98.43   98.69   98.69   98.69   99.21   98.95   95.01   94.75   95.28   95.80   94.75   96.33   96.85   95.80   95.80   95.54   96.33   95.54   95.28   95.28   95.28   95.01   95.54   95.54

    78: AHA80104.1            94.74   95.26   95.26   95.53   95.20   95.49   96.06   96.59   95.28   96.06   95.28   95.01   95.54   96.32   95.80   95.80   95.80   95.80   96.33   95.28   95.54   95.80   95.80   95.80   95.80   95.80   95.80   95.80   95.80   95.80   95.80   95.80   96.59   95.80   95.80   95.80   95.54   95.54   96.33   95.80   95.80   95.80   95.54   95.80   95.54   95.54   95.80   95.80   96.06   95.80   95.80   95.80   92.02   94.75   94.75   95.01   95.01   95.28   95.28   95.01   97.64   97.64   98.16   97.90   97.90   98.16   97.90   98.16   97.90   98.16   98.16   98.43   98.16   98.69   98.43   99.21   99.74  100.00   97.64   98.16   98.69   98.69   98.16   98.43   98.16   98.43   98.43   98.43   98.95   98.69   94.75   94.49   95.01   95.54   94.49   96.06   96.59   95.54   95.54   95.28   96.06   95.28   95.01   95.01   95.01   94.75   95.28   95.28

    79: AIT76092.1            95.00   95.79   95.79   96.05   95.73   96.02   96.59   97.11   95.80   96.59   95.80   95.54   96.06   96.84   96.33   96.33   96.33   96.33   96.85   95.80   96.06   96.33   96.33   96.33   96.33   96.33   96.33   96.33   96.33   96.33   96.33   96.33   97.11   96.33   96.33   96.33   96.06   96.06   96.85   96.33   96.33   96.33   96.06   96.33   96.06   96.06   96.33   96.33   96.59   96.33   96.33   96.33   92.55   94.75   94.75   95.01   95.01   95.28   95.28   95.01   97.38   97.90   97.90   97.64   98.69   98.16   98.69   98.16   98.16   97.64   97.38   97.64   97.90   97.90   98.16   98.43   97.90   97.64  100.00   97.90   97.90   97.90   98.43   98.16   98.43   98.16   98.69   98.69   98.69   98.95   95.28   95.01   95.54   96.06   95.01   96.59   97.64   96.06   96.06   95.80   96.59   95.80   95.54   95.54   95.54   95.28   95.80   95.80

    80: CBI75447.1            95.26   96.05   96.05   96.32   96.00   96.29   96.85   96.85   96.06   96.85   96.06   95.80   96.33   97.11   96.59   96.59   96.59   96.59   97.11   96.06   96.33   96.59   96.59   96.59   96.59   96.59   96.59   96.59   96.59   96.59   96.59   96.59   97.38   96.59   96.59   96.59   96.33   96.33   97.11   96.59   96.59   96.59   96.33   96.59   96.33   96.33   96.59   96.59   96.85   96.59   96.59   96.59   92.55   95.01   95.01   95.28   95.28   95.54   95.54   95.54   97.90   97.90   97.90   97.64   98.16   98.16   98.69   98.43   98.16   97.90   98.43   98.69   98.43   98.43   98.16   98.95   98.43   98.16   97.90  100.00   98.95   98.95   97.90   98.69   98.95   98.43   98.16   98.16   98.69   98.95   95.54   95.28   95.80   96.33   95.28   96.33   97.38   96.06   96.33   96.06   96.85   96.06   95.80   95.80   95.80   95.54   96.06   96.06

    81: AFK73437.1            95.53   96.05   96.05   96.32   96.00   96.29   96.85   96.85   96.06   96.85   96.06   95.80   96.33   97.11   96.59   96.59   96.59   96.59   97.11   96.06   96.33   96.59   96.59   96.59   96.59   96.59   96.59   96.59   96.59   96.59   96.59   96.59   97.38   96.59   96.59   96.59   96.33   96.33   97.11   96.59   96.59   96.59   96.33   96.59   96.33   96.33   96.59   96.59   96.85   96.59   96.59   96.59   92.29   95.54   95.54   95.80   95.80   96.06   96.06   96.06   98.43   97.90   98.43   98.16   98.16   98.69   98.69   98.16   98.16   98.16   98.43   98.69   98.95   98.43   98.69   98.95   98.95   98.69   97.90   98.95  100.00   98.95   98.43   99.21   98.95   98.69   98.69   98.69   99.21   98.95   95.54   95.28   95.80   96.33   95.28   96.33   97.38   96.06   96.33   96.06   96.85   96.06   95.80   95.80   95.80   95.54   96.06   96.06

    82: AFK08541.1            95.00   95.53   95.53   95.79   95.47   95.76   96.33   96.85   95.54   96.33   95.54   95.28   95.80   96.58   96.06   96.06   96.06   96.06   96.59   95.54   95.80   96.06   96.06   96.06   96.06   96.06   96.06   96.06   96.06   96.06   96.06   96.06   96.85   96.06   96.06   96.06   95.80   95.80   96.59   96.06   96.06   96.06   95.80   96.06   95.80   95.80   96.06   96.06   96.33   96.06   96.06   96.06   92.29   95.01   95.01   95.28   95.28   95.54   95.54   95.54   97.90   97.90   98.43   98.16   98.16   98.16   98.16   98.43   98.16   98.43   98.43   98.69   98.43   98.95   98.69   98.95   98.95   98.69   97.90   98.95   98.95  100.00   98.43   99.21   98.95   98.69   98.69   98.69   99.21   98.95   95.01   94.75   95.28   95.80   94.75   96.33   96.85   95.80   95.80   96.06   96.33   95.54   95.28   95.28   95.28   95.01   95.54   95.54

    83: AEZ49849.1            95.00   95.53   95.53   95.79   95.47   95.76   96.33   96.85   95.80   96.33   95.54   95.28   95.80   96.58   96.06   96.06   96.06   96.06   96.59   95.54   95.80   96.06   96.06   96.06   96.06   96.06   96.06   96.06   96.06   96.06   96.06   96.06   96.85   96.06   96.06   96.06   95.80   95.80   96.59   96.06   96.06   96.06   95.80   96.06   95.80   95.80   96.06   96.06   96.33   96.06   96.06   96.06   92.55   95.28   95.28   95.54   95.54   95.80   95.80   95.54   97.90   97.90   98.43   98.16   98.69   98.69   98.69   98.69   99.21   98.69   98.43   98.69   98.95   98.95   99.21   98.43   98.43   98.16   98.43   97.90   98.43   98.43  100.00   98.69   98.43   98.69   99.21   99.21   99.21   98.95   95.28   95.01   95.54   96.06   95.01   96.59   96.85   96.06   96.06   95.80   96.59   95.80   95.54   95.54   95.54   95.28   95.80   95.80

    84: AFK73431.1            95.26   95.79   95.79   96.05   95.73   96.02   96.59   97.11   95.80   96.59   95.80   95.54   96.06   96.84   96.33   96.33   96.33   96.33   96.85   95.80   96.06   96.33   96.33   96.33   96.33   96.33   96.33   96.33   96.33   96.33   96.33   96.33   97.11   96.33   96.33   96.33   96.06   96.06   96.85   96.33   96.33   96.33   96.06   96.33   96.06   96.06   96.33   96.33   96.59   96.33   96.33   96.33   92.55   95.28   95.28   95.54   95.54   95.80   95.80   95.80   98.16   98.16   98.69   98.43   98.43   98.43   98.43   98.43   98.43   98.43   98.16   98.43   98.69   98.69   98.95   98.69   98.69   98.43   98.16   98.69   99.21   99.21   98.69  100.00   99.74   98.95   98.95   98.95   99.48   99.21   95.28   95.01   95.54   96.06   95.01   96.59   97.11   96.06   96.06   95.80   96.59   95.80   95.54   95.54   95.54   95.28   95.80   95.80

    85: BAL63057.1            95.26   96.05   96.05   96.32   96.00   96.29   96.85   97.38   96.06   96.85   96.06   95.80   96.33   97.11   96.59   96.59   96.59   96.59   97.11   96.06   96.33   96.59   96.59   96.59   96.59   96.59   96.59   96.59   96.59   96.59   96.59   96.59   97.38   96.59   96.59   96.59   96.33   96.33   97.11   96.59   96.59   96.59   96.33   96.59   96.33   96.33   96.59   96.59   96.85   96.59   96.59   96.59   92.82   95.01   95.01   95.28   95.28   95.54   95.54   95.54   97.90   98.43   98.43   98.16   98.69   98.16   98.69   98.69   98.69   98.16   97.90   98.16   98.43   98.43   98.69   98.95   98.43   98.16   98.43   98.95   98.95   98.95   98.43   99.74  100.00   98.69   98.69   98.69   99.21   99.48   95.54   95.28   95.80   96.33   95.28   96.85   97.38   96.33   96.33   96.06   96.85   96.06   95.80   95.80   95.80   95.54   96.06   96.06

    86: BAO05497.1            95.26   95.79   95.79   96.05   95.73   96.02   96.59   97.11   95.80   96.59   95.80   95.54   96.06   96.84   96.33   96.33   96.33   96.33   96.85   95.80   96.06   96.33   96.33   96.33   96.33   96.33   96.33   96.33   96.33   96.33   96.33   96.33   97.11   96.33   96.33   96.33   96.06   96.06   96.85   96.33   96.33   96.33   96.06   96.33   96.06   96.06   96.33   96.33   96.59   96.33   96.33   96.33   92.82   95.28   95.28   95.54   95.54   95.80   95.80   95.54   98.16   98.16   98.69   98.43   98.43   98.43   98.43   98.43   98.43   98.43   98.16   98.43   98.69   98.69   98.95   98.69   98.69   98.43   98.16   98.43   98.69   98.69   98.69   98.95   98.69  100.00   98.95   98.95   99.48   99.21   95.28   95.01   95.54   96.06   95.01   96.59   97.11   96.06   96.06   95.80   96.59   95.80   95.54   95.54   95.54   95.28   95.80   95.80

    87: AFK73455.1            95.26   95.79   95.79   96.05   95.73   96.02   96.59   97.11   95.80   96.59   95.80   95.54   96.06   96.84   96.33   96.33   96.33   96.33   96.85   95.80   96.06   96.33   96.33   96.33   96.33   96.33   96.33   96.33   96.33   96.33   96.33   96.33   97.11   96.33   96.33   96.33   96.06   96.06   96.85   96.33   96.33   96.33   96.06   96.33   96.06   96.06   96.33   96.33   96.59   96.33   96.33   96.33   92.55   95.28   95.28   95.54   95.54   95.80   95.80   95.54   98.16   98.16   98.69   98.43   98.95   98.95   98.95   98.43   98.43   98.43   98.16   98.43   98.69   98.69   98.95   98.69   98.69   98.43   98.69   98.16   98.69   98.69   99.21   98.95   98.69   98.95  100.00   99.48   99.48   99.21   95.28   95.01   95.54   96.06   95.01   96.59   97.11   96.06   96.06   95.80   96.59   95.80   95.54   95.54   95.54   95.28   95.80   95.80

    88: AKP17985.1            95.26   95.79   95.79   96.05   95.73   96.02   96.59   97.11   95.80   96.59   95.80   95.54   96.06   96.84   96.33   96.33   96.33   96.33   96.85   95.80   96.06   96.33   96.33   96.33   96.33   96.33   96.33   96.33   96.33   96.33   96.33   96.33   97.11   96.33   96.33   96.33   96.06   96.06   96.85   96.33   96.33   96.33   96.06   96.33   96.06   96.06   96.33   96.33   96.59   96.33   96.33   96.33   92.55   95.28   95.28   95.54   95.54   95.80   95.80   95.54   98.16   98.16   98.69   98.43   98.95   98.95   98.95   98.43   98.43   98.43   98.16   98.43   98.69   98.69   98.95   98.69   98.69   98.43   98.69   98.16   98.69   98.69   99.21   98.95   98.69   98.95   99.48  100.00   99.48   99.21   95.28   95.01   95.54   96.06   95.01   96.59   97.11   96.06   96.06   95.80   96.59   95.80   95.54   95.54   95.54   95.28   95.80   95.80

    89: ADP02979.1            95.79   96.32   96.32   96.58   96.27   96.55   97.11   97.64   96.33   97.11   96.33   96.06   96.59   97.37   96.85   96.85   96.85   96.85   97.38   96.33   96.59   96.85   96.85   96.85   96.85   96.85   96.85   96.85   96.85   96.85   96.85   96.85   97.64   96.85   96.85   96.85   96.59   96.59   97.38   96.85   96.85   96.85   96.59   96.85   96.59   96.59   96.85   96.85   97.11   96.85   96.85   96.85   93.09   95.80   95.80   96.06   96.06   96.33   96.33   96.06   98.69   98.69   99.21   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.69   98.95   99.21   99.21   99.48   99.21   99.21   98.95   98.69   98.69   99.21   99.21   99.21   99.48   99.21   99.48   99.48   99.48  100.00   99.74   95.80   95.54   96.06   96.59   95.54   97.11   97.64   96.59   96.59   96.33   97.11   96.33   96.06   96.06   96.06   95.80   96.33   96.33

    90: AIT76091.1            95.79   96.58   96.58   96.84   96.53   96.82   97.38   97.90   96.59   97.38   96.59   96.33   96.85   97.63   97.11   97.11   97.11   97.11   97.64   96.59   96.85   97.11   97.11   97.11   97.11   97.11   97.11   97.11   97.11   97.11   97.11   97.11   97.90   97.11   97.11   97.11   96.85   96.85   97.64   97.11   97.11   97.11   96.85   97.11   96.85   96.85   97.11   97.11   97.38   97.11   97.11   97.11   93.35   95.54   95.54   95.80   95.80   96.06   96.06   95.80   98.43   98.95   98.95   98.69   99.21   98.69   99.21   99.21   99.21   98.69   98.43   98.69   98.95   98.95   99.21   99.48   98.95   98.69   98.95   98.95   98.95   98.95   98.95   99.21   99.48   99.21   99.21   99.21   99.74  100.00   96.06   95.80   96.33   96.85   95.80   97.38   97.90   96.85   96.85   96.59   97.38   96.59   96.33   96.33   96.33   96.06   96.59   96.59

    91: ACV32310.1            95.00   95.79   95.79   96.05   95.73   96.02   96.59   96.06   96.85   96.59   95.80   95.54   96.06   96.84   96.33   96.33   96.33   96.33   96.85   95.80   96.06   96.33   96.33   96.33   96.33   96.33   96.33   96.33   96.33   96.33   96.33   96.33   97.11   96.33   96.33   96.33   96.06   96.06   96.85   96.33   96.33   96.33   96.06   96.33   96.06   96.06   96.33   96.33   96.59   96.33   96.33   96.33   92.02   93.96   93.96   94.23   94.23   94.49   94.49   94.23   95.01   95.01   95.01   94.75   95.28   95.28   95.80   95.28   95.54   94.75   95.01   95.28   95.54   95.01   95.28   95.54   95.01   94.75   95.28   95.54   95.54   95.01   95.28   95.28   95.54   95.28   95.28   95.28   95.80   96.06  100.00   98.69   98.69   98.16   96.59   95.28   96.06   95.80   97.11   96.33   97.11   96.33   96.59   96.06   96.59   96.33   96.85   96.85

    92: ACU00152.1            95.26   96.05   96.05   96.32   96.00   96.29   96.85   96.33   97.11   96.85   96.06   95.80   96.33   97.11   96.59   96.59   96.59   96.59   97.11   96.06   96.33   96.59   96.59   96.59   96.59   96.59   96.59   96.59   96.59   96.59   96.59   96.59   97.38   96.59   96.59   96.59   96.33   96.33   97.11   96.59   96.59   96.59   96.33   96.59   96.33   96.33   96.59   96.59   96.85   96.59   96.59   96.59   91.76   93.70   93.70   93.96   93.96   94.23   94.23   93.96   94.75   94.75   94.75   94.49   95.01   95.01   95.54   95.01   95.28   94.49   94.75   95.01   95.28   94.75   95.01   95.28   94.75   94.49   95.01   95.28   95.28   94.75   95.01   95.01   95.28   95.01   95.01   95.01   95.54   95.80   98.69  100.00   98.95   97.90   96.85   95.54   96.33   96.06   97.38   96.59   97.38   96.59   96.85   96.33   96.85   96.59   97.11   97.11

    93: AJH76980.1            95.79   96.58   96.58   96.84   96.53   96.82   97.38   96.85   97.64   97.38   96.59   96.33   96.85   97.63   97.11   97.11   97.11   97.11   97.64   96.59   96.85   97.11   97.11   97.11   97.11   97.11   97.11   97.11   97.11   97.11   97.11   97.11   97.90   97.11   97.11   97.11   96.85   96.85   97.64   97.11   97.11   97.11   96.85   97.11   96.85   96.85   97.11   97.11   97.38   97.11   97.11   97.11   92.29   94.23   94.23   94.49   94.49   94.75   94.75   94.49   95.28   95.28   95.28   95.01   95.80   95.80   96.33   95.54   95.80   95.01   95.28   95.54   95.80   95.28   95.54   95.80   95.28   95.01   95.54   95.80   95.80   95.28   95.54   95.54   95.80   95.54   95.54   95.54   96.06   96.33   98.69   98.95  100.00   98.43   97.38   96.06   96.85   96.59   97.90   97.11   97.90   97.11   97.38   96.85   97.38   97.11   97.64   97.64

    94: AAQ16660.2            95.79   96.58   96.58   96.84   96.53   96.82   97.38   96.85   97.64   97.38   96.59   96.33   96.85   97.63   97.11   97.11   97.11   97.11   97.64   96.59   96.85   97.11   97.11   97.11   97.11   97.11   97.11   97.11   97.11   97.11   97.11   97.11   97.90   97.11   97.11   97.11   96.85   96.85   97.64   97.11   97.11   97.11   96.85   97.11   96.85   96.85   97.11   97.11   97.38   97.11   97.11   97.11   92.82   95.28   95.28   95.54   95.54   95.80   95.80   95.54   95.80   95.80   95.80   95.54   96.06   96.06   96.59   96.06   96.33   95.54   95.80   96.06   96.33   95.80   96.06   96.33   95.80   95.54   96.06   96.33   96.33   95.80   96.06   96.06   96.33   96.06   96.06   96.06   96.59   96.85   98.16   97.90   98.43  100.00   98.43   96.06   96.85   97.11   97.90   97.64   98.43   97.64   97.90   97.38   97.90   97.64   98.16   98.16

    95: BAF56185.1            95.26   96.05   96.05   96.32   96.00   96.29   96.85   96.33   97.11   96.85   96.06   95.80   96.33   97.11   96.59   96.59   96.59   96.59   97.11   96.06   96.33   96.59   96.59   96.59   96.59   96.59   96.59   96.59   96.59   96.59   96.59   96.59   97.38   96.59   96.59   96.59   96.33   96.33   97.11   96.59   96.59   96.59   96.33   96.59   96.33   96.33   96.59   96.59   96.85   96.59   96.59   96.59   91.76   94.75   94.23   94.49   94.49   94.75   94.75   94.49   94.75   94.75   94.75   94.49   95.01   95.01   95.54   95.01   95.28   94.49   94.75   95.01   95.28   94.75   95.01   95.28   94.75   94.49   95.01   95.28   95.28   94.75   95.01   95.01   95.28   95.01   95.01   95.01   95.54   95.80   96.59   96.85   97.38   98.43  100.00   95.54   96.33   97.64   97.38   97.11   97.90   97.38   96.85   96.85   96.85   96.59   97.11   97.11

    96: AGR82311.1            95.26   96.05   96.05   96.32   96.00   96.29   96.85   97.38   96.33   96.85   96.06   95.80   96.33   97.11   96.59   96.59   96.59   96.59   97.38   96.06   96.33   96.59   96.59   96.59   96.59   96.59   96.59   96.59   96.59   96.59   96.59   96.59   97.38   96.59   96.59   96.59   96.33   96.33   97.11   96.59   96.59   96.59   96.33   96.59   96.33   96.33   96.59   96.59   96.85   96.59   96.59   96.59   92.82   95.01   95.01   95.28   95.28   95.54   95.54   95.28   95.80   96.33   96.33   96.06   96.59   96.06   96.59   96.59   96.85   96.06   95.80   96.06   96.33   96.33   96.59   96.85   96.33   96.06   96.59   96.33   96.33   96.33   96.59   96.59   96.85   96.59   96.59   96.59   97.11   97.38   95.28   95.54   96.06   96.06   95.54  100.00   97.38   96.59   96.59   96.33   97.11   96.33   96.06   96.06   96.06   95.80   96.33   96.33

    97: ACA30422.1            96.32   97.11   97.11   97.37   97.07   97.35   97.90   97.90   97.11   97.90   97.38   96.85   97.38   98.16   97.64   97.64   97.64   97.64   98.16   97.11   97.38   97.64   97.64   97.64   97.64   97.64   97.64   97.64   97.64   97.64   97.64   97.64   98.43   97.64   97.64   97.64   97.64   97.64   98.16   97.64   97.64   97.64   97.64   97.64   97.38   97.38   97.90   97.64   97.90   97.64   97.64   97.64   92.82   95.54   95.54   95.80   95.80   96.06   96.06   95.80   96.85   96.85   96.85   96.59   97.11   97.11   97.64   97.11   97.11   96.59   96.85   97.11   97.38   96.85   97.11   97.38   96.85   96.59   97.64   97.38   97.38   96.85   96.85   97.11   97.38   97.11   97.11   97.11   97.64   97.90   96.06   96.33   96.85   96.85   96.33   97.38  100.00   97.11   97.38   97.11   97.90   97.11   96.85   96.85   96.85   96.59   97.11   97.11

    98: BAF36388.1            96.05   96.84   96.84   97.11   97.07   97.08   97.64   97.38   97.38   97.64   96.85   96.59   97.11   97.89   97.38   97.38   97.38   97.38   97.90   96.85   97.11   97.38   97.38   97.38   97.38   97.38   97.38   97.38   97.38   97.38   97.38   97.38   98.16   97.38   97.38   97.38   97.11   97.11   97.90   97.38   97.38   97.38   97.11   97.38   97.11   97.11   97.38   97.38   97.64   97.38   97.38   97.38   92.55   95.54   95.01   95.28   95.28   95.54   95.54   95.28   95.54   95.80   95.80   95.54   96.06   95.80   96.33   96.06   96.33   95.54   95.54   95.80   96.06   95.80   96.06   96.33   95.80   95.54   96.06   96.06   96.06   95.80   96.06   96.06   96.33   96.06   96.06   96.06   96.59   96.85   95.80   96.06   96.59   97.11   97.64   96.59   97.11  100.00   97.11   97.38   98.16   97.38   97.11   97.11   97.11   96.85   97.38   97.38

    99: AIT76098.1            95.79   96.58   96.58   96.84   96.53   96.82   97.38   96.85   97.64   97.38   96.59   96.33   96.85   97.63   97.11   97.11   97.11   97.11   97.64   96.59   96.85   97.11   97.11   97.11   97.11   97.11   97.11   97.11   97.11   97.11   97.11   97.11   97.90   97.11   97.11   97.11   96.85   96.85   97.64   97.11   97.11   97.11   96.85   97.11   96.85   96.85   97.11   97.11   97.38   97.11   97.11   97.11   92.55   94.75   94.75   95.01   95.01   95.28   95.28   95.01   95.80   95.80   95.80   95.54   96.06   96.06   96.59   96.06   96.33   95.54   95.80   96.06   96.33   95.80   96.06   96.33   95.80   95.54   96.06   96.33   96.33   95.80   96.06   96.06   96.33   96.06   96.06   96.06   96.59   96.85   97.11   97.38   97.90   97.90   97.38   96.59   97.38   97.11  100.00   97.64   98.43   97.64   97.38   97.38   97.38   97.11   97.64   97.64

   100: AHL39327.1            95.53   96.32   96.32   96.58   96.27   96.55   97.11   96.59   97.38   97.11   96.33   96.06   96.59   97.37   96.85   96.85   96.85   96.85   97.38   96.33   96.59   96.85   96.85   96.85   96.85   96.85   96.85   96.85   96.85   96.85   96.85   96.85   97.64   96.85   96.85   96.85   96.59   96.59   97.38   96.85   96.85   96.85   96.59   96.85   96.59   96.59   96.85   96.85   97.11   96.85   96.85   96.85   92.29   95.01   95.01   95.28   95.28   95.54   95.54   95.28   95.54   95.54   95.54   95.28   95.80   95.80   96.33   95.80   96.06   95.54   95.54   95.80   96.06   95.54   95.80   96.06   95.54   95.28   95.80   96.06   96.06   96.06   95.80   95.80   96.06   95.80   95.80   95.80   96.33   96.59   96.33   96.59   97.11   97.64   97.11   96.33   97.11   97.38   97.64  100.00   99.21   98.43   98.16   98.69   98.69   98.43   98.43   98.43

   101: AGZ20169.1            96.32   97.11   97.11   97.37   97.07   97.35   97.90   97.38   98.16   97.90   97.11   96.85   97.38   98.16   97.64   97.64   97.64   97.64   98.16   97.11   97.38   97.64   97.64   97.64   97.64   97.64   97.64   97.64   97.64   97.64   97.64   97.64   98.43   97.64   97.64   97.64   97.38   97.38   98.16   97.64   97.64   97.64   97.38   97.64   97.38   97.38   97.64   97.64   97.90   97.64   97.64   97.64   93.09   95.80   95.80   96.06   96.06   96.33   96.33   96.06   96.33   96.33   96.33   96.06   96.59   96.59   97.11   96.59   96.85   96.06   96.33   96.59   96.85   96.33   96.59   96.85   96.33   96.06   96.59   96.85   96.85   96.33   96.59   96.59   96.85   96.59   96.59   96.59   97.11   97.38   97.11   97.38   97.90   98.43   97.90   97.11   97.90   98.16   98.43   99.21  100.00   98.69   98.43   98.43   98.43   98.16   98.69   98.69

   102: AFK73449.1            95.53   96.32   96.32   96.58   96.27   96.55   97.11   96.59   97.38   97.11   96.33   96.06   96.59   97.37   96.85   96.85   96.85   96.85   97.38   96.33   96.59   96.85   96.85   96.85   96.85   96.85   96.85   96.85   96.85   96.85   96.85   96.85   97.64   96.85   96.85   96.85   96.59   96.59   97.38   96.85   96.85   96.85   96.59   96.85   96.59   96.59   96.85   96.85   97.11   96.85   96.85   96.85   92.29   95.01   95.01   95.28   95.28   95.54   95.54   95.28   95.54   95.54   95.54   95.28   95.80   95.80   96.33   95.80   96.06   95.54   95.54   95.80   96.06   95.54   95.80   96.06   95.54   95.28   95.80   96.06   96.06   95.54   95.80   95.80   96.06   95.80   95.80   95.80   96.33   96.59   96.33   96.59   97.11   97.64   97.38   96.33   97.11   97.38   97.64   98.43   98.69  100.00   98.16   98.69   98.16   97.90   98.43   98.43

   103: ADW84690.1            95.79   96.58   96.58   96.84   96.53   96.82   97.38   96.85   98.16   97.38   96.59   96.33   96.85   97.63   97.11   97.11   97.11   97.11   97.64   96.59   96.85   97.11   97.11   97.11   97.11   97.11   97.11   97.11   97.11   97.11   97.11   97.11   97.90   97.11   97.11   97.11   96.85   96.85   97.64   97.11   97.11   97.11   96.85   97.11   96.85   96.85   97.11   97.11   97.38   97.11   97.11   97.11   92.02   94.75   94.75   95.01   95.01   95.28   95.28   95.01   95.28   95.28   95.28   95.01   95.54   95.54   96.06   95.54   95.80   95.28   95.28   95.54   95.80   95.28   95.54   95.80   95.28   95.01   95.54   95.80   95.80   95.28   95.54   95.54   95.80   95.54   95.54   95.54   96.06   96.33   96.59   96.85   97.38   97.90   96.85   96.06   96.85   97.11   97.38   98.16   98.43   98.16  100.00   98.95   99.48   98.69   99.21   99.21

   104: BAF95726.1            95.26   96.05   96.05   96.32   96.00   96.29   96.85   96.33   97.64   96.85   96.06   95.80   96.33   97.11   96.59   96.59   96.59   96.59   97.11   96.06   96.33   96.59   96.59   96.59   96.59   96.59   96.59   96.59   96.59   96.59   96.59   96.59   97.38   96.59   96.59   96.59   96.33   96.33   97.11   96.59   96.59   96.59   96.33   96.59   96.33   96.33   96.59   96.59   96.85   96.59   96.59   96.59   92.02   94.75   94.75   95.01   95.01   95.28   95.28   95.01   95.28   95.28   95.28   95.01   95.54   95.54   96.06   95.54   95.80   95.28   95.28   95.54   95.80   95.28   95.54   95.80   95.28   95.01   95.54   95.80   95.80   95.28   95.54   95.54   95.80   95.54   95.54   95.54   96.06   96.33   96.06   96.33   96.85   97.38   96.85   96.06   96.85   97.11   97.38   98.69   98.43   98.69   98.95  100.00   99.48   98.69   98.69   98.69

   105: AFU25644.1            95.79   96.58   96.58   96.84   96.53   96.82   97.38   96.85   98.16   97.38   96.59   96.33   96.85   97.63   97.11   97.11   97.11   97.11   97.64   96.59   96.85   97.11   97.11   97.11   97.11   97.11   97.11   97.11   97.11   97.11   97.11   97.11   97.90   97.11   97.11   97.11   96.85   96.85   97.64   97.11   97.11   97.11   96.85   97.11   96.85   96.85   97.11   97.11   97.38   97.11   97.11   97.11   92.02   94.75   94.75   95.01   95.01   95.28   95.28   95.01   95.28   95.28   95.28   95.01   95.54   95.54   96.06   95.54   95.80   95.28   95.28   95.54   95.80   95.28   95.54   95.80   95.28   95.01   95.54   95.80   95.80   95.28   95.54   95.54   95.80   95.54   95.54   95.54   96.06   96.33   96.59   96.85   97.38   97.90   96.85   96.06   96.85   97.11   97.38   98.69   98.43   98.16   99.48   99.48  100.00   99.21   99.21   99.21

   106: AFK08538.1            95.53   96.32   96.32   96.58   96.27   96.55   97.11   96.59   97.90   97.11   96.33   96.06   96.59   97.37   96.85   97.38   96.85   96.85   97.38   96.33   96.59   96.85   96.85   96.85   96.85   96.85   96.85   96.85   96.85   96.85   96.85   96.85   97.64   96.85   96.85   96.85   96.59   96.59   97.38   96.85   96.85   96.85   96.59   96.85   96.59   96.59   96.85   96.85   97.11   96.85   96.85   96.85   91.76   94.49   94.49   94.75   94.75   95.01   95.01   94.75   95.01   95.01   95.01   94.75   95.28   95.28   95.80   95.28   95.54   95.01   95.01   95.28   95.54   95.01   95.28   95.54   95.01   94.75   95.28   95.54   95.54   95.01   95.28   95.28   95.54   95.28   95.28   95.28   95.80   96.06   96.33   96.59   97.11   97.64   96.59   95.80   96.59   96.85   97.11   98.43   98.16   97.90   98.69   98.69   99.21  100.00   98.95   99.48

   107: CBH19182.1            96.05   96.84   96.84   97.11   96.80   97.08   97.64   97.11   98.43   97.64   96.85   96.59   97.38   97.89   97.38   97.38   97.38   97.38   97.90   96.85   97.11   97.38   97.38   97.38   97.38   97.38   97.38   97.38   97.38   97.38   97.38   97.38   98.16   97.38   97.38   97.38   97.11   97.11   97.90   97.38   97.38   97.38   97.11   97.38   97.11   97.11   97.38   97.38   97.64   97.38   97.38   97.38   92.29   95.01   95.01   95.28   95.28   95.54   95.54   95.28   95.54   95.54   95.54   95.28   95.80   95.80   96.33   95.80   96.06   95.54   95.54   95.80   96.06   95.54   95.80   96.06   95.54   95.28   95.80   96.06   96.06   95.54   95.80   95.80   96.06   95.80   95.80   95.80   96.33   96.59   96.85   97.11   97.64   98.16   97.11   96.33   97.11   97.38   97.64   98.43   98.69   98.43   99.21   98.69   99.21   98.95  100.00   99.48

   108: AET07387.1            96.05   96.84   96.84   97.11   96.80   97.08   97.64   97.11   98.43   97.64   96.85   96.59   97.11   97.89   97.38   97.90   97.38   97.38   97.90   96.85   97.11   97.38   97.38   97.38   97.38   97.38   97.38   97.38   97.38   97.38   97.38   97.38   98.16   97.38   97.38   97.38   97.11   97.11   97.90   97.38   97.38   97.38   97.11   97.38   97.11   97.11   97.38   97.38   97.64   97.38   97.38   97.38   92.29   95.01   95.01   95.28   95.28   95.54   95.54   95.28   95.54   95.54   95.54   95.28   95.80   95.80   96.33   95.80   96.06   95.54   95.54   95.80   96.06   95.54   95.80   96.06   95.54   95.28   95.80   96.06   96.06   95.54   95.80   95.80   96.06   95.80   95.80   95.80   96.33   96.59   96.85   97.11   97.64   98.16   97.11   96.33   97.11   97.38   97.64   98.43   98.69   98.43   99.21   98.69   99.21   99.48   99.48  100.00

 

 

CLUSTAL O(1.2.4) multiple sequence alignment

 

 

AEM97673.1               -MMNRYAAALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY

B3LDH1|B3LDH1_PROMI      MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY

O54038|O54038_PROMI      MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY

Q70Q39|Q70Q39_PROMI      MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY

ACJ65711.1               MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY

ACA97847.1               MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY

ADK55604.1               MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY

ADQ38362.1               MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY

ABN51007.1               MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY

AAU95778.1               MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY

AKG51729.1               MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY

D2U4S1|D2U4S1_PROMI      MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY

ABY58049.1               MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY

AAX58682.2               -MKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY

AKZ20821.1               MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY

AKZ20822.1               MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY

AHW47897.1               MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY

ALE33733.1               MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY

AHA80103.1               MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNCTITPLMQEQAIPGMAVAVIYQGKPYY

AGU59995.1               MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY

AGC54799.1               MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY

AGC54798.1               MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY

WP_063859861.1           MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY

AEM97674.1               MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY

AEM97672.1               MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY

BAJ17544.1               MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY

ADY19254.1               MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY

ADP37961.1               MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY

ADT91162.1               MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY

ADK55605.1               MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY

ACJ05361.1               MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY

ADM21467.1               MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY

ABN51006.1               MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY

ACA97846.1               MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY

ABR18736.1               MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY

ABS12249.1               MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY

ABS12248.1               MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY

ABQ51091.1               MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY

ACA30420.1               MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY

ABN69070.1               MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY

ABF06441.1               MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY

ABB72431.1               MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY

AAZ66866.1               MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY

AAS13399.1               MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY

Q4LCT4|Q4LCT4_PROMI      MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY

Q70Q38|Q70Q38_PROMI      MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY

Q9S6R4|Q9S6R4_ECOLX      MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY

Q9XB33|Q9XB33_KLEOX      MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY

Q48434|Q48434_KLEPN      MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY

O33446|O33446_PROMI      MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY

Q9S6R5|Q9S6R5_ECOLX      MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY

ACA30421.1               MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY

AGH70380.1               MAAQSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAIIYQGKPYY

AHA80101.1               MMKKSICCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAIIYQGKPYY

AHM76768.1               MMKKSICCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAIIYQGKPYY

AFU25635.1               MMKKSICCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAIIYQGKPYY

AFU25632.1               MMKKSICCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAIIYQGKPYY

AHA80102.1               MMKKSICCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAIIYQGKPYY

AHL39324.1               MMKKSICCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAIIYQGKPYY

AFU25638.1               MMKKSICCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAIIYQGKPYY

AHL39322.1               MMKKSICCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAIIYEGKPYY

L0R279|L0R279_CITFR      MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAIIYEGKPYY

AFU25641.1               MMKKSICCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAIIYEGKPYY

AFK73443.1               MMKKSICCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAIIYEGKPYY

AIT76097.1               MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAIIYEGKPYY

AFK73446.1               MMKKSICCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAIIYEGKPYY

AIT76093.1               MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAIIYEGKPYY

AIT76099.1               MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAIIYEGKPYY

AIT76089.1               MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAIIYEGKPYY

AFK73452.1               MMKKSICCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAIIYEGKPYY

AEZ49855.1               MMKKSICCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGIAVAIIYEGKPYY

AHL39330.1               MMKKSICCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAIIYEGKPYY

AFK73434.1               MMKKSICCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAIIYEGKPYY

ADH82410.1               MMKKSICCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAIIYEGKPYY

AEI52842.1               MMKKSICCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAIIYEGKPYY

AIT76090.1               MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAIIYEEKPYY

BAG14343.1               MMKKSICCALLLTASFSTFAATKTEQQIADIVNRTITPLMQEQAIPGMAVAIIYEEKPYY

AHA80104.1               MMKKSICCALLLTASFSTFAATKTEQQIADIVNRTITPLMQEQAIPGMAVAIIYEEKPYY

AIT76092.1               MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAIIYKGKPYY

CBI75447.1               MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAIIYEGKPYY

AFK73437.1               MMKKSICCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAIIYEEKPYY

AFK08541.1               MMKKSICCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAIIYEGKPYY

AEZ49849.1               MMKKSICCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAIIYEGKPYY

AFK73431.1               MMKKSICCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAIIYEGKPYY

BAL63057.1               MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAIIYEGKPYY

BAO05497.1               MMKKSICCALLLTASFSKFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAIIYEGKPYY

AFK73455.1               MMKKSICCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAIIYEGKPYY

AKP17985.1               MMKKSICCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAIIYEGKPYY

ADP02979.1               MMKKSICCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAIIYEGKPYY

AIT76091.1               MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAIIYEGKPYY

ACV32310.1               MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAIIYQGKPYY

ACU00152.1               MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVLYQGKPYY

AJH76980.1               MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY

AAQ16660.2               MMKKSLCCALLLTASFSTFASAKTEQQIADIVNRTITPLMQEQAIPGMAVAIIYQGKPYY

BAF56185.1               MMKKSLCCALLLTASFSTFASAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKTYY

AGR82311.1               MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNHTITPLMQKQAIPGMAVAVIYQGKPYY

ACA30422.1               MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY

BAF36388.1               MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY

AIT76098.1               MMKKSLCCALLLTASFSTFASAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY

AHL39327.1               MMKKSLCCALLLTAPFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY

AGZ20169.1               MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY

AFK73449.1               MMKKSLCCALLLTASFSTFAAAKTEPQIADIVNRTITPLMQEQAIPGMAVAVIYQGKSYY

ADW84690.1               MMKKSLCCALLLTASLSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAIAVIYQGKPYY

BAF95726.1               MMKKSLCCALLLTAPLSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY

AFU25644.1               MMKKSLCCALLLTAPLSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY

AFK08538.1               MMKKSLCCALLLTAPFSTFAAAKTEQQIADTVNRTITPLMQEQAIPGMAVAVIYQGKPYY

CBH19182.1               MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY

AET07387.1               MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY

                            :  ..****** :*.**::*** **** ** *******:*****:*:*::*: * **

 

AEM97673.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

B3LDH1|B3LDH1_PROMI      FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

O54038|O54038_PROMI      FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

Q70Q39|Q70Q39_PROMI      FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

ACJ65711.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

ACA97847.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

ADK55604.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

ADQ38362.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

ABN51007.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

AAU95778.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

AKG51729.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

D2U4S1|D2U4S1_PROMI      FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

ABY58049.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDCIARGEIKLSDPVTKYWPELTGKQ

AAX58682.2               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

AKZ20821.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

AKZ20822.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

AHW47897.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

ALE33733.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

AHA80103.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

AGU59995.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

AGC54799.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

AGC54798.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

WP_063859861.1           FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

AEM97674.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

AEM97672.1               FTWGKADIANNHPVTQQTLFELGSVSKTFIGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

BAJ17544.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

ADY19254.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

ADP37961.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

ADT91162.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

ADK55605.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGEAIARGEIKLSDPVTKYWPELTGKQ

ACJ05361.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

ADM21467.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

ABN51006.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

ACA97846.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

ABR18736.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

ABS12249.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

ABS12248.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

ABQ51091.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

ACA30420.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

ABN69070.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

ABF06441.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

ABB72431.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

AAZ66866.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

AAS13399.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

Q4LCT4|Q4LCT4_PROMI      FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

Q70Q38|Q70Q38_PROMI      FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

Q9S6R4|Q9S6R4_ECOLX      FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

Q9XB33|Q9XB33_KLEOX      FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKFSDPVTKYWPELTGKQ

Q48434|Q48434_KLEPN      FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

O33446|O33446_PROMI      FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

Q9S6R5|Q9S6R5_ECOLX      FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

ACA30421.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

AGH70380.1               FTWGKADIANDRPVTRQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTQYWPELTGKQ

AHA80101.1               FTWGKADIANNRPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTQYWPELTGKQ

AHM76768.1               FTWGKADIANNRPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKFSDPVTHYWPELTGKQ

AFU25635.1               FTWGKADIANNRPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTQYWPELTGKQ

AFU25632.1               FTWGKADIANNRPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTHYWPELTGKQ

AHA80102.1               FTWGKADIANNRPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTHYWPELTGKQ

AHL39324.1               FTWGKADIANNRPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTHYWPELTGKQ

AFU25638.1               FTWGKADIANNRPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTHYWPELTGKQ

AHL39322.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

L0R279|L0R279_CITFR      FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

AFU25641.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

AFK73443.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

AIT76097.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

AFK73446.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

AIT76093.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

AIT76099.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

AIT76089.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

AFK73452.1               FTWGKADIVNNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

AEZ49855.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

AHL39330.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

AFK73434.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

ADH82410.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

AEI52842.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

AIT76090.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

BAG14343.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

AHA80104.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

AIT76092.1               FTWGKADIANNHPVTQHTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

CBI75447.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

AFK73437.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

AFK08541.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

AEZ49849.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

AFK73431.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLNDPVTKYWPELTGKQ

BAL63057.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLNDPVTKYWPELTGKQ

BAO05497.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

AFK73455.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPALTGKQ

AKP17985.1               FTWGKADIANNHLVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

ADP02979.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

AIT76091.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

ACV32310.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

ACU00152.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYLPELTGKQ

AJH76980.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

AAQ16660.2               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

BAF56185.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

AGR82311.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

ACA30422.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

BAF36388.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWSELTGKQ

AIT76098.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

AHL39327.1               FTWGKADITNNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

AGZ20169.1               FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

AFK73449.1               FTWGKADITNNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

ADW84690.1               FTWGKADITNNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

BAF95726.1               FTWGKADITNNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

AFU25644.1               FTWGKADITNNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

AFK08538.1               FTWGKADITNNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

CBH19182.1               FTWGKADITNNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

AET07387.1               FTWGKADITNNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ

                         ********.*:: **::************ *****:.*******:.****:*   *****

 

AEM97673.1               WQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGA

B3LDH1|B3LDH1_PROMI      WQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGA

O54038|O54038_PROMI      WQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYSNSSIGLFGA

Q70Q39|Q70Q39_PROMI      WQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGA

ACJ65711.1               WQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGA

ACA97847.1               WQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGA

ADK55604.1               WQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGA

ADQ38362.1               WQGICLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGA

ABN51007.1               WQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGA

AAU95778.1               WQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGA

AKG51729.1               WQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGE

D2U4S1|D2U4S1_PROMI      WQGIRLLHLATYTAGGLPLKIPDDVRDKAALLHFYQNWQPQWTPGAKRLYSNSSIGLFGA

ABY58049.1               WQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGA

AAX58682.2               WQGISLLHLATYTAGGLPLQIPDDVTDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGA

AKZ20821.1               WQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGA

AKZ20822.1               WQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGA

AHW47897.1               WQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGA

ALE33733.1               WQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGA

AHA80103.1               WQGISLLHLATYTAGGLPLQIPDDVTDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGA

AGU59995.1               WQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYSNSSIGLFGA

AGC54799.1               WQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGA

AGC54798.1               WQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGA

WP_063859861.1           WQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGA

AEM97674.1               WQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFSA

AEM97672.1               WQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGA

BAJ17544.1               WQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGA

ADY19254.1               WQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGA

ADP37961.1               WQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGA

ADT91162.1               WQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGA

ADK55605.1               WQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGA

ACJ05361.1               WQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFAA

ADM21467.1               WQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGA

ABN51006.1               WQGISLLHLATYTAGGLPLQIPDDVTDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGA

ACA97846.1               WQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGA

ABR18736.1               WQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGA

ABS12249.1               WQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGA

ABS12248.1               WQGIRLLHLATYTAGGLPLQFPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGE

ABQ51091.1               WQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGE

ACA30420.1               WQGIRLLHLATYTAGGLPLQIPDDVTDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGA

ABN69070.1               WQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGA

ABF06441.1               WQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGA

ABB72431.1               WQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGA

AAZ66866.1               WQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGE

AAS13399.1               WQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGA

Q4LCT4|Q4LCT4_PROMI      WQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYSNSSIGLFGA

Q70Q38|Q70Q38_PROMI      WQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGA

Q9S6R4|Q9S6R4_ECOLX      WQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGE

Q9XB33|Q9XB33_KLEOX      WQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGA

Q48434|Q48434_KLEPN      WQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGA

O33446|O33446_PROMI      WQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGA

Q9S6R5|Q9S6R5_ECOLX      WQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGA

ACA30421.1               WQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGA

AGH70380.1               WQGISLLHLATYTAGGLPLQVPDDVTDKAALLRFYQNWQPQWAPGAKRLYANSSIGLFGA

AHA80101.1               WQGISLLHLATYTAGGLPLQVPDDVTDKAALLHFYQNWQPQWASGAKRLYANSSIGLFGA

AHM76768.1               WQGISLLHLATYTAGGLPLQVPDDVTDKAALLRFYQNWQPQWAPGAKRLYANSSIGLFGA

AFU25635.1               WQGISLLHLATYTAGGLPLQVPDDVTDKAALLRFYQNWQPQWAPGAKRLYANSSIGLFGA

AFU25632.1               WQGISLLHLATYTAGGLPLQVPDDVTDKAALLRFYQNWQPQWAPGAKRLYANSSIGLFGA

AHA80102.1               WQGISLLHLATYTAGGLPLQVPDDVTDKAALLRFYQNWQPQWAPGAKRLYANSSIGLFGA

AHL39324.1               WQGISLLHLATYTAGGLPLQVPDDVTDKAALLRFYQNWQPQWAPGAKRLYANSSIGLFGA

AFU25638.1               WQGISLLHLATYTAGGLPLQVPDDVTDKAALLRFYQNWQPQWAPGAKRLYANSSIGLFGA

AHL39322.1               WRGISLLHLATYTAGGLPLQIPDDVTDKAALLRFYQNWQPQWTPGAKRLYANSSIGLFGA

L0R279|L0R279_CITFR      WRGISLLHLATYTAGGLPLQIPGDVTDKAELLRFYQNWQPQWTPGAKRLYANSSIGLFGA

AFU25641.1               WRGISLLHLATYTAGGLPLQIPDDVTDKAELLRFYQNWQPQWTPGAKRLYANSSIGLFGA

AFK73443.1               WRGISLLHLATYTAGGLPLQIPGDVTDKAELLRFYQNWQPQWTPGAKRLYANSSIGLFGA

AIT76097.1               WRGISLLHLATYTAGGLPLQIPDDITDKAALLRFYQNWQPQWTPGAKRLYANSSIGLFGA

AFK73446.1               WRGISLLHLATYTAGGLPLQIPDDITDKAALLRFYQNWQPQWTPGAKRLYANSSIGLFGA

AIT76093.1               WRGISLLHLATYTAGGLPLQIPDDITDKAALLRFYQNWQPQWTPGAKRLYANSSIGLFGA

AIT76099.1               WRGISLLHLATYTAGGLPLQIPDYVTDKAELLRFYQNWQPQWTPGAKRLYANSSIGLFGA

AIT76089.1               WRGISLLHLATYTAGGLPLQIPDDVTDKAELLRFYQNWQPQWTPGAKRLYANSSIGLFGA

AFK73452.1               WRGISLLHLATYTAGGLPLQIPDYVTDKAELLRFYQNWQPQWTPGAKRLYANSSIGLFGA

AEZ49855.1               WRGISLLHLATYTAGGLPLQIPDEVTDKAELLRFYQNWQPQWTPGAKRLYANSSIGLFGA

AHL39330.1               WRGISLLHLATYTAGGLPLQIPDEVTDKAELLRFYQNWQPQWTPGAKRLYANSSIGLFGA

AFK73434.1               WRGISLLHLATYTAGGLPLQIPDDVTDKAELLRFYQNWQPQWTPGAKRLYANSSIGLFGA

ADH82410.1               WRGISLLHLATYTAGGLPLQIPDEVTDKAELLRFYQNWQPQWTPGAKRLYANSSIGLFGA

AEI52842.1               WRGISLLHLATYTAGGLPLQIPDDVTDKAELLRFYQNWQPQWTPGAKRLYANSSIGLFGA

AIT76090.1               WRGISLLHLATYTAGGLPLQIPDEVTDKAALLRFYQNWQPQWTPGAKRLYANSSIGLFGA

BAG14343.1               WRGISLLHLATYTAGGLPLQIPDEVTDKAALLRFYQNWQPQWTPGAKRLYANSSIGLFGA

AHA80104.1               WRGISLLHLATYTAGGLPLQIPDEVTDKAALLRFYQNWQPQWTPGAKRLYANSSIGLFGA

AIT76092.1               WRGISLLHLATYTAGGLPLQIPDDITDKAALLRFYQNWQPQWTPGAKRLYANSSIGLFGA

CBI75447.1               WRGISLLHLATYTAGGLPLQIPDEVTDKAALLRFYQNWQPQWTPGAKRLYANSSIGLFGA

AFK73437.1               WRGISLLHLATYTAGGLPLQIPDDVTDKAALLRFYQNWQPQWTPGAKRLYANSSIGLFGA

AFK08541.1               WRGISLLHLATYTAGGLPLQIPDEVTDKAALLRFYQNWQPQWTPGAKRLYANSSIGLFGA

AEZ49849.1               WRGISLLHLATYTAGGLPLQIPDDITDKAALLRFYQNWQPQWTPGAKRLYANSSIGLFGA

AFK73431.1               WRGISLLHLATYTAGGLPLQIPDDVTDKAALLRFYQNWQPQWTPGAKRLYANSSIGLFGA

BAL63057.1               WRGISLLHLATYTAGGLPLQIPDDVTDKAALLRFYQNWQPQWTPGAKRLYANSSIGLFGA

BAO05497.1               WRGISLLHLATYTAGGLPLQIPDDVTDKAALLRFYQNWQPQWTPGAKRLYANSSIGLFGA

AFK73455.1               WRGISLLHLATYTAGGLPLQIPDDITDKAALLRFYQNWQPQWTPGAKRLYANSSIGLFGA

AKP17985.1               WRGISLLHLATYTAGGLPLQIPDDITDKAALLRFYQNWQPQWTPGAKRLYANSSIGLFGA

ADP02979.1               WRGISLLHLATYTAGGLPLQIPDDVTDKAALLRFYQNWQPQWTPGAKRLYANSSIGLFGA

AIT76091.1               WRGISLLHLATYTAGGLPLQIPDDVTDKAALLRFYQNWQPQWTPGAKRLYANSSIGLFGA

ACV32310.1               WQGISLLHLATYTAGGLPLQIPDDVTDKAALLRFYQNWQPQWTPGAKRLYANSSIGLFGA

ACU00152.1               WQGISLLHLATYTAGGLPLQIPDDVTDKAALLRFYQNWQPQWTPGAKRLYANSSIGLFGA

AJH76980.1               WQGISLLHLATYTAGGLPLQIPDDVTDKAALLRFYQNWQPQWTPGAKRLYANSSIGLFGA

AAQ16660.2               WQGISLLHLATYTAGGLPLQIPDDVTDKAALLRFYQNWQPQWAPGAKRLYANSSIGLFGA

BAF56185.1               WQDISLLHLATYTAGGLPLQIPDDVTDKTALLHFYQNWQPQWAPGAKRLYANSSIGLFGA

AGR82311.1               WQGISLLHLATYTAGGLPLQIPDDVTDKAALLRFYQNWQPQWTPSTKRLYANSSIGLFGA

ACA30422.1               WQGISLLHLATYTAGGLPLQIPDDVTDKAALLRFYQNWQPQWTPGAKRLYANSSIGLFGT

BAF36388.1               WQGISLLHLATYTAGGLPLQIPDDVTDKTALLHFYQNWQPQWAPGAKRLYANSSIGLFGA

AIT76098.1               WQGISLLHLATYTAGGLPLQIPDDVTDKAALLRFYQNWQPQWTPGAKRLYANSSIGLFGA

AHL39327.1               WQGISLLHLATYTAGGLPLQIPDDVTDKAALLRFYQNWQPQWAPGAKRLYANSSIGLFGA

AGZ20169.1               WQGISLLHLATYTAGGLPLQIPDDVTDKAALLRFYQNWQPQWAPGAKRLYANSSIGLFGA

AFK73449.1               WQGISLLHLATYTAGGLPLQIPDDVTDKAALLRFYQNWQPQWAPGAKRLYANSSIGLFGA

ADW84690.1               WQGISLLHLATYTAGGLPLQIPDDVTDKAALLRFYQNWQPQWAPGAKRLYANSSIGLFGA

BAF95726.1               WQGISLLHLATYTAGGLPLQIPDDVTDKAALLRFYQNWQPQWAPGAKRLYANSSIGLFGA

AFU25644.1               WQGISLLHLATYTAGGLPLQIPDDVTDKAALLRFYQNWQPQWAPGAKRLYANSSIGLFGA

AFK08538.1               WQGISLLHLATYTAGGLPLQIPDDVTDKAALLRFYQNWQPQWAPGAKRLYANSSIGLFGA

CBH19182.1               WQGISLLHLATYTAGGLPLQIPDDVTDKAALLRFYQNWQPQWAPGAKRLYANSSIGLFGA

AET07387.1               WQGISLLHLATYTAGGLPLQIPDDVTDKAALLRFYQNWQPQWAPGAKRLYANSSIGLFGA

                         *:.* **************:.*. : **: **:*********: .:****:*******.

 

AEM97673.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHVSPGQL--DA

B3LDH1|B3LDH1_PROMI      LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYARGYREGKPVHVSPGQL--NA

O54038|O54038_PROMI      LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYARGYREGKPVHVSPGQL--DA

Q70Q39|Q70Q39_PROMI      LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYARGYREGKPVHVSPGQL--DA

ACJ65711.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHVSPGQL--DA

ACA97847.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHVSPGQL--DA

ADK55604.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHVSPGQLELDA

ADQ38362.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHVSPGQL--DA

ABN51007.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKAVHVSPGQL--DA

AAU95778.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHVSPGQL--DA

AKG51729.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHVSPRQL--GA

D2U4S1|D2U4S1_PROMI      LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYARGYREGKPVHVSPGQL--DA

ABY58049.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPENEQKDYAWGYREGKPVHVSPGQL--DA

AAX58682.2               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHVSPGQL--DA

AKZ20821.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHVSPGQL--DA

AKZ20822.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHVSPGQL--DA

AHW47897.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHVSPGQL--DV

ALE33733.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDCAWGYREGKPVHVSPGQL--DA

AHA80103.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHVSPGQL--DA

AGU59995.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYARGYREGKPVHVSPGQL--DA

AGC54799.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHASPGQL--DA

AGC54798.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHVSPGQL--DA

WP_063859861.1           LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHVSPGQL--DA

AEM97674.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHVSPGQL--DA

AEM97672.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHVSPGQL--DA

BAJ17544.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHASPGQL--DA

ADY19254.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHVSPGQL--DA

ADP37961.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHVSPGQF--DA

ADT91162.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHVSPGQL--DA

ADK55605.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHVSPGQL--DA

ACJ05361.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHVSPGQL--DA

ADM21467.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHSSPGQL--DA

ABN51006.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHVSPGQL--DA

ACA97846.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHVSPEQL--DA

ABR18736.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHVSPGRL--DA

ABS12249.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHGSPGQL--DA

ABS12248.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHVSPGQL--DA

ABQ51091.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHVSPGQL--DA

ACA30420.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHVSPGQL--DA

ABN69070.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVYVSPGQL--DA

ABF06441.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHVSPGQL--DA

ABB72431.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHVSPGQL--DA

AAZ66866.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHVSPGKL--DA

AAS13399.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHVSPGQL--DA

Q4LCT4|Q4LCT4_PROMI      LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYARGYREGKPVHVSPGQL--DA

Q70Q38|Q70Q38_PROMI      LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYARGYREGKPVHVSPGQL--DA

Q9S6R4|Q9S6R4_ECOLX      LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHVSPGQL--DA

Q9XB33|Q9XB33_KLEOX      LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHVSPGQL--DA

Q48434|Q48434_KLEPN      LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHVSPGQL--DA

O33446|O33446_PROMI      LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYARGYREGKPVHVSPGQL--DA

Q9S6R5|Q9S6R5_ECOLX      LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYALGYREGKPVHVSPGQL--DA

ACA30421.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYACGYREGKPVHVSPGQL--DA

AGH70380.1               LAVKPSGMGYEEAMTKRVLQPLKLAHTWITVPQSEQKDYAWGYREGKPVHVSPGQL--DA

AHA80101.1               LAVKPSGMSYEEAMTKRVLHPLKLAHTWITVPQSEQKDYAWGYREGKPVHVSPGQL--DA

AHM76768.1               LAVKPSGMSYEEAMTKRVLRPLKLAHTWITVPQSEQKDYAWGYREGKPVHVSPGQL--DA

AFU25635.1               LAVKPSGMSYEEAMSKRVLHPLKLAHTWITVPQSEQKDYAWGYREGKPVHVSPGQL--DA

AFU25632.1               LAVKPSGMSYEEAMTKRVLHPLKLAHTWITVPQSEQKDYAWGYREGKPVHVSPGQL--DA

AHA80102.1               LAVKPSGMSYEEAMTKRVLHPLKLAHTWITVPQSEQKDYAWGYREGKPVHVSPGQL--DA

AHL39324.1               LAVKPSGMSYEEAMTKRVLRPLKLAHTWITVPQSEQKDYAWGYREGKPVHVSPGQL--DA

AFU25638.1               LAVNPSGMSYEEAMTKRVLRPLKLAHTWITVPQSEQKDYAWGYREGKPVHVSPGQL--DA

AHL39322.1               LAVKSSGMSYEEAMTRRVLQPLKLAHTWITVPQSEQKNYAWGYLEGKPLHVSPGQL--DA

L0R279|L0R279_CITFR      LAVKSSGMSYEEAMTRRVLQPLKLAHTWITVPQSEQKNYAWGYLEGKPVHVSPGQL--DA

AFU25641.1               LAVKSSGMSYEEAMTRRVLQPLKLAHTWITVPQSEQKNYAWGYLEGKPVHVSPGQL--DA

AFK73443.1               LAVKSSGMSYEEAMTRRVLQPLKLAHTWITVPQSEQKNYAWGYLEGKPVHVSPGQL--DA

AIT76097.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQSEQKNYAWGYREGKPVHVSPGQL--DA

AFK73446.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQSEQKNYAWGYREGKPVHVSPGQL--DA

AIT76093.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQSEQKNYAWGYREGKPVHVSPGQL--DA

AIT76099.1               LVVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQSEQKNYAWGYREGKPVHVSPGQL--DA

AIT76089.1               LVVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQSEQKNYAWGYREGKPVHVSPGQL--DA

AFK73452.1               LVVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQSEQKNYAWGYREGKPVHVSPGQL--DA

AEZ49855.1               LVVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQSEQKNYAWGYREGKPVHVSPGQL--DA

AHL39330.1               LVVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQSEQKNYAWGYREGKPVHVSPGQL--DA

AFK73434.1               LVVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQSEQKNYAWGYREGKPVHVSPGQL--DA

ADH82410.1               LVVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQSEQKNYAWGYREGKPVHVSPGQL--DA

AEI52842.1               LVVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQSEQKNYAWGYREGKPVHVSPGQL--DA

AIT76090.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQSEQKNYAWGYREGKPVHVSPGQL--DA

BAG14343.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQSEQKNYAWGYREGKPVHVSPGQL--DA

AHA80104.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQSEQKNYAWGYREGKPVHVSPGQL--DA

AIT76092.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQSEQKNYAWGYREGKPVHVSPGQL--DA

CBI75447.1               LAVQPSGMSYEEAMTRRVLQPLKLAHTWITVPQSEQKNYAWGYREGKPVHVSPGQL--DA

AFK73437.1               LAVQPSGMSYEEAMTRRVLQPLKLAHTWITVPQSEQKNYAWGYREGKPVHVSPGQL--DA

AFK08541.1               LAVQPSGMSYEEAMTRRVLQPLKLAHTWITVPQSEQKNYAWGYREGKPVHVSPGQL--DA

AEZ49849.1               LVVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQSEQKNYAWGYREGKPVHVSPGQL--DA

AFK73431.1               LAVQPSGMSYEEAMTRRVLQPLKLAHTWITVPQSEQKNYAWGYREGKPVHVSPGQL--DA

BAL63057.1               LAVQPSGMSYEEAMTRRVLQPLKLAHTWITVPQSEQKNYAWGYREGKPVHVSPGQL--DA

BAO05497.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQSEQKNYAWGYREGKPVHVSPGQL--DA

AFK73455.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQSEQKNYAWGYREGKPVHVSPGQL--DA

AKP17985.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQSEQKNYAWGYREGKPVHVSPGQL--DA

ADP02979.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQSEQKNYAWGYREGKPVHVSPGQL--DA

AIT76091.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQSEQKNYAWGYREGKPVHVSPGQL--DA

ACV32310.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHVTPGQL--DA

ACU00152.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHVTPGQL--DA

AJH76980.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHVTPGQL--DA

AAQ16660.2               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHVSPGQL--DA

BAF56185.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQSEQKDYAWGYREGKPVHVSPGQL--DA

AGR82311.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQSEQKDYAWGYREGKPVHVSPGQL--DA

ACA30422.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQSEQKDYAWGYREGKPVHVSPGQL--DA

BAF36388.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQSEQKDYAWGYREGKPVHVSPGQL--DA

AIT76098.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQSEQKDYAWGYREGKPVHVSPGQL--DA

AHL39327.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQSEQKDYAWGYREGKPVHVSPGQL--DA

AGZ20169.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQSEQKDYAWGYREGKPVHVSPGQL--DA

AFK73449.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWIKVPQSEQKDYAWGYREGKPVHVSPGQL--DA

ADW84690.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKAVHVSPGQL--DA

BAF95726.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWIKVPQSEQKDYAWGYREGKAVHVSPGQL--DA

AFU25644.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKAVHVSPGQL--DA

AFK08538.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKAVHVSPGQL--DA

CBH19182.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPKNEQKDYAWGYREGKAVHVSPGQL--DA

AET07387.1               LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKAVHVSPGQL--DA

                         *.*: ***.*****::***:*********.**:.***: * ** *** :: :* ::  ..

 

AEM97673.1               EAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPL

B3LDH1|B3LDH1_PROMI      EAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPL

O54038|O54038_PROMI      EAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPL

Q70Q39|Q70Q39_PROMI      EAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPL

ACJ65711.1               EAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPL

ACA97847.1               EAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPL

ADK55604.1               EAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPL

ADQ38362.1               EAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIELAQSRYWRIGDMYQGLGWEMLNWPL

ABN51007.1               EAYGVKSSVIDMARWVQVNMDASRVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPL

AAU95778.1               EAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPL

AKG51729.1               EAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPL

D2U4S1|D2U4S1_PROMI      EAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPL

ABY58049.1               EAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPL

AAX58682.2               EAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPL

AKZ20821.1               EAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPL

AKZ20822.1               EAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPL

AHW47897.1               EAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPL

ALE33733.1               EAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPL

AHA80103.1               EAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPL

AGU59995.1               EAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPL

AGC54799.1               EAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPL

AGC54798.1               EAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPL

WP_063859861.1           EAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPL

AEM97674.1               EAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPL

AEM97672.1               EAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPL

BAJ17544.1               EAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPL

ADY19254.1               EAYCVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPL

ADP37961.1               EAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPL

ADT91162.1               EAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPL

ADK55605.1               EAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPL

ACJ05361.1               EAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPL

ADM21467.1               EAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPL

ABN51006.1               EAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPL

ACA97846.1               EAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPL

ABR18736.1               EAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPL

ABS12249.1               EAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPL

ABS12248.1               EAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPL

ABQ51091.1               EAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPL

ACA30420.1               EAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPL

ABN69070.1               EAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPL

ABF06441.1               GAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPL

ABB72431.1               EAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPL

AAZ66866.1               EAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPL

AAS13399.1               EAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPL

Q4LCT4|Q4LCT4_PROMI      EAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPL

Q70Q38|Q70Q38_PROMI      EAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPL

Q9S6R4|Q9S6R4_ECOLX      EAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPL

Q9XB33|Q9XB33_KLEOX      EAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPL

Q48434|Q48434_KLEPN      EAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPL

O33446|O33446_PROMI      EAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPL

Q9S6R5|Q9S6R5_ECOLX      EAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPL

ACA30421.1               EAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPL

AGH70380.1               EAYGVKSSLVDMTRWIQANMDASQVQEKTLRQGIEIAQARYWHIGDMYQGLGWEMLNWPV

AHA80101.1               EAYGVKSSVIDMTRWVQANMDASQVQEKTLQQGIELAQSRYWRIGDMYQGLGWEMLNWPV

AHM76768.1               EAYGVKSSVIDMTRWVQANMDASQVQEKTLQQGIELAQSRYWRVGDMYQGLGWEMLNWPV

AFU25635.1               EAYGVKSSVIDMTRWVQANMDASQVQEKTLQQGIELAQSRYWRIGDMYQGLGWEMLNWPV

AFU25632.1               EAYGVKSSVIDMTRWVQANMDASQVQEKTLQQGIELAQSRYWRVGDMYQGLGWEMLNWPV

AHA80102.1               EAYGVKSSVIDMTRWVQANMDASQVQEKTLQQGIELAQSRYWRIGDMYQGLGWEMLNWPV

AHL39324.1               EAYGVKSSVIDMTRWVQANMDASQVQEKTLQQGIELAQSRYWRIGDMYQGLGWEMLNWPV

AFU25638.1               EAYGVKSSVIDMTRWVQANMDASQVQEKTLQQGIELAQSRYWRIGDMYQGLGWEMLNWPV

AHL39322.1               EAYGVKSSVIDMARWVQANMDASHVQEKTLQLGIELAQSRYWRIGDMYQGLGWEMLNWPL

L0R279|L0R279_CITFR      EAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIELAQSRYWRIGDMYQGLGWEMLNWPL

AFU25641.1               EAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIELAQSRYWRIGDMYQGLGWEMLNWPL

AFK73443.1               EAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIELAQSRYWRIGDMYQGLGWEMLNWPL

AIT76097.1               EAYGVKSSVIDMARWVQANMDASHAQEKTLQQGIELAQSRYWRIGDMYQGLGWEMLNWPL

AFK73446.1               EAYGVKSSVIDMARWVQANMDASHVQDKTLQQGIELAQSR