#

#

#  Percent Identity  Matrix - created by Clustal2.1

#

#

 

     1: CBL80615.1  100.00   98.97   98.63   98.63   98.28   98.63   98.28   98.28   98.28   97.94   98.28   98.28   98.28   98.63   98.28   98.28   98.28   98.28   98.28   98.28   98.63   97.25   96.56   95.88   80.76   79.38   79.66   79.38   80.07   79.38   79.73   79.73   79.73   79.04   79.38   79.73   79.38   79.38   79.73   79.38   79.73   79.04   79.73   80.41   79.38   80.07   79.73   79.38   79.04   79.38   79.73   79.38   79.38   79.38   79.38   79.73   79.38   79.73   79.73   80.07   79.73   79.73   79.73   79.73   79.73   79.73   80.41   79.73   79.73   79.73   80.07   80.07   80.07   83.85   83.79   83.45   83.16   82.82   82.82   82.82   82.47   82.82   83.16   82.82   83.16   82.41   83.51   80.76   80.41   80.41   80.76   80.76   80.76   80.76   80.76   81.10   80.76   81.10   80.76   81.10   80.76   81.10   81.10   81.10   80.07   80.76   80.07   80.41   80.07   80.41   80.41   80.90   80.41   80.41   80.41   80.76   80.76   80.76   81.18   81.18   81.10   80.41   80.76   80.41   80.41   80.76   81.10   81.44   80.85   81.44   81.44   80.76   80.76   81.10   81.10   80.76   81.44   80.76   81.10   81.10   81.10   81.10   81.10   81.10   81.44   81.44   81.44   80.76   81.79   81.10

     2: CAQ42486.1   98.97  100.00   99.66   98.28   98.63   98.97   98.63   98.63   98.63   98.28   98.63   98.63   98.63   98.97   98.63   98.63   98.63   98.63   98.63   98.63   98.97   97.59   97.59   96.91   80.41   80.07   80.34   80.07   80.76   80.07   80.41   80.41   80.41   79.73   80.07   80.41   80.07   80.07   80.41   80.07   80.41   79.73   80.41   81.10   80.07   80.76   80.41   80.07   79.73   80.07   80.41   80.07   80.07   80.07   80.07   80.41   80.07   80.41   80.41   80.76   80.41   80.41   80.41   80.41   80.41   80.41   81.10   80.41   80.41   80.41   80.76   80.76   80.76   83.51   83.45   83.10   82.82   82.47   82.47   82.47   82.13   83.16   82.82   82.47   82.82   82.07   83.16   80.41   80.07   80.07   80.41   80.41   80.41   80.41   80.41   80.76   80.41   80.76   80.41   80.76   80.41   80.76   80.76   80.76   79.73   80.41   79.73   80.07   79.73   80.07   80.07   80.56   80.07   80.07   80.07   80.41   80.41   80.41   80.84   80.84   80.76   80.07   80.41   80.07   80.07   80.41   80.76   81.10   80.50   81.10   81.10   80.41   80.41   80.76   80.76   80.41   81.10   80.41   80.76   80.76   80.76   80.76   80.76   80.76   81.10   81.10   81.10   81.10   81.44   81.79

     3: AAC32890.1   98.63   99.66  100.00   97.94   98.28   98.63   98.28   98.28   98.28   97.94   98.28   98.28   98.28   98.63   98.28   98.28   98.28   98.28   98.28   98.28   98.63   97.25   97.25   96.56   80.41   80.07   80.34   80.07   80.76   80.07   80.41   80.41   80.41   79.73   80.07   80.41   80.07   80.07   80.41   80.07   80.41   79.73   80.41   81.10   80.07   80.76   80.41   80.07   79.73   80.07   80.41   80.07   80.07   80.07   80.07   80.41   80.07   80.41   80.41   80.76   80.41   80.41   80.41   80.41   80.41   80.41   81.10   80.41   80.41   80.41   80.76   80.76   80.76   83.16   83.10   82.76   82.47   82.13   82.13   82.13   81.79   82.82   82.47   82.13   82.47   81.72   82.82   80.41   80.07   80.07   80.41   80.41   80.41   80.41   80.41   80.76   80.41   80.76   80.41   80.76   80.41   80.76   80.76   80.76   79.73   80.41   79.73   80.07   79.73   80.07   80.07   80.56   80.07   80.07   80.07   80.41   80.41   80.41   80.84   80.84   80.76   80.07   80.41   80.07   80.07   80.41   80.76   81.10   80.50   81.10   81.10   80.41   80.41   80.76   80.76   80.41   81.10   80.41   80.76   80.76   80.76   80.76   80.76   80.76   81.10   81.10   81.10   81.10   81.44   81.79

     4: CAQ42480.1   98.63   98.28   97.94  100.00   98.28   98.63   97.59   97.59   97.59   97.25   97.59   97.59   97.59   97.94   97.59   97.59   97.59   97.59   97.59   97.59   97.94   96.56   95.88   95.19   80.76   79.38   79.66   79.38   80.07   79.38   79.73   79.73   79.73   79.04   79.38   79.73   79.38   79.38   79.73   79.38   79.73   79.04   79.73   80.41   79.38   80.07   79.73   79.38   79.04   79.38   79.73   79.38   79.38   79.38   79.38   79.73   79.38   79.73   79.73   80.07   79.73   79.73   79.73   79.73   79.73   79.73   80.41   79.73   79.73   79.73   80.07   80.07   80.07   83.85   83.79   83.45   83.16   82.82   82.82   82.82   82.47   82.82   83.16   82.82   83.16   82.41   83.51   80.76   80.41   80.41   80.76   80.76   80.76   80.76   80.76   81.10   80.76   81.10   80.76   81.10   80.76   81.10   81.10   81.10   80.07   80.76   80.07   80.41   80.07   80.41   80.41   80.90   80.41   80.41   80.41   80.76   80.76   80.76   81.18   81.18   81.10   80.41   80.76   80.41   80.41   80.76   81.10   81.44   80.85   81.44   81.44   80.76   80.76   81.10   81.10   80.76   81.44   80.76   81.10   81.10   81.10   81.10   81.10   81.10   81.44   81.44   81.44   80.76   81.79   81.10

     5: AIL54055.1   98.28   98.63   98.28   98.28  100.00   99.66   98.63   98.63   98.63   98.28   98.63   98.63   98.63   98.97   98.63   98.63   98.63   98.63   98.63   98.63   98.97   97.59   96.91   96.22   79.73   79.04   79.31   79.04   79.73   79.04   79.38   79.38   79.38   78.69   79.04   79.38   79.04   79.04   79.38   79.04   79.38   78.69   79.38   80.07   79.04   79.73   79.38   79.04   78.69   79.04   79.38   79.04   79.04   79.04   79.04   79.38   79.04   79.38   79.38   79.73   79.38   79.38   79.38   79.38   79.38   79.38   80.07   79.38   79.38   79.38   79.73   79.73   79.73   83.51   83.45   83.10   82.82   82.47   82.47   82.47   82.13   83.16   82.82   82.47   82.82   82.07   83.16   79.73   79.38   79.38   79.73   79.73   79.73   79.73   79.73   80.07   79.73   80.07   79.73   80.07   79.73   80.07   80.07   80.07   79.04   79.73   79.04   79.38   79.04   79.38   79.38   80.21   79.38   79.38   79.38   79.73   79.73   79.73   80.49   80.49   80.07   79.38   79.73   79.38   79.38   79.73   80.07   80.41   80.14   80.41   80.41   79.73   79.73   80.07   80.07   79.73   80.41   79.73   80.07   80.07   80.07   80.07   80.07   80.07   80.41   80.41   80.41   80.41   80.76   80.76

     6: AFH88134.1   98.63   98.97   98.63   98.63   99.66  100.00   98.97   98.97   98.97   98.63   98.97   98.97   98.97   99.31   98.97   98.97   98.97   98.97   98.97   98.97   99.31   97.94   97.25   96.56   80.07   79.38   79.66   79.38   80.07   79.38   79.73   79.73   79.73   79.04   79.38   79.73   79.38   79.38   79.73   79.38   79.73   79.04   79.73   80.41   79.38   80.07   79.73   79.38   79.04   79.38   79.73   79.38   79.38   79.38   79.38   79.73   79.38   79.73   79.73   80.07   79.73   79.73   79.73   79.73   79.73   79.73   80.41   79.73   79.73   79.73   80.07   80.07   80.07   83.85   83.79   83.45   83.16   82.82   82.82   82.82   82.47   83.51   83.16   82.82   83.16   82.41   83.51   80.07   79.73   79.73   80.07   80.07   80.07   80.07   80.07   80.41   80.07   80.41   80.07   80.41   80.07   80.41   80.41   80.41   79.38   80.07   79.38   79.73   79.38   79.73   79.73   80.21   79.73   79.73   79.73   80.07   80.07   80.07   80.49   80.49   80.41   79.73   80.07   79.73   79.73   80.07   80.41   80.76   80.14   80.76   80.76   80.07   80.07   80.41   80.41   80.07   80.76   80.07   80.41   80.41   80.41   80.41   80.41   80.41   80.76   80.76   80.76   80.76   81.10   81.10

     7: AGN11769.1   98.28   98.63   98.28   97.59   98.63   98.97  100.00   99.66   99.31   98.97   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.66   97.59   96.91   96.91   79.73   79.04   79.31   79.04   79.73   79.04   79.38   79.38   79.38   78.69   79.04   79.38   79.04   79.04   79.38   79.04   79.38   78.69   79.38   80.07   79.04   79.73   79.38   79.04   79.38   79.73   79.38   79.04   79.04   79.04   79.04   79.38   79.04   79.38   79.38   79.73   79.38   79.38   79.38   79.38   79.38   79.38   80.07   79.38   79.38   79.38   79.73   79.73   79.73   83.51   83.45   83.10   82.82   82.47   82.47   82.47   82.13   83.16   82.82   82.47   82.82   82.07   83.16   79.73   79.38   79.38   79.73   79.73   79.73   79.73   79.73   80.07   79.73   80.07   79.73   80.07   79.73   80.07   80.07   80.07   79.04   79.73   79.04   79.38   79.04   79.38   79.38   79.86   79.38   79.38   79.38   79.73   79.73   79.73   80.14   80.14   80.07   79.38   79.73   80.07   80.07   80.41   80.07   80.41   79.79   80.41   80.41   79.73   79.73   80.07   80.07   79.73   80.41   79.73   80.07   80.07   80.07   80.07   80.07   80.07   80.41   80.41   80.41   80.41   80.76   80.76

     8: ACY74743.1   98.28   98.63   98.28   97.59   98.63   98.97   99.66  100.00   99.31   98.97   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.66   97.59   96.91   96.91   79.73   79.04   79.31   79.04   79.73   79.04   79.38   79.38   79.38   78.69   79.04   79.38   79.04   79.04   79.38   79.04   79.38   78.69   79.38   80.07   79.04   79.73   79.38   79.04   79.04   79.38   79.38   79.04   79.04   79.04   79.04   79.38   79.04   79.38   79.38   79.73   79.38   79.38   79.38   79.38   79.38   79.38   80.07   79.38   79.38   79.38   79.73   79.73   79.73   83.51   83.45   83.10   82.82   82.47   82.47   82.47   82.13   83.16   82.82   82.47   82.82   82.07   83.16   79.73   79.38   79.38   79.73   79.73   79.73   79.73   79.73   80.07   79.73   80.07   79.73   80.07   79.73   80.07   80.07   80.07   79.04   79.73   79.04   79.38   79.04   79.38   79.38   79.86   79.38   79.38   79.38   79.73   79.73   79.73   80.14   80.14   80.07   79.38   79.73   80.07   80.07   80.41   80.07   80.41   79.79   80.41   80.41   79.73   79.73   80.07   80.07   79.73   80.41   79.73   80.07   80.07   80.07   80.07   80.07   80.07   80.41   80.41   80.41   80.41   80.76   80.76

     9: CAD99181.1   98.28   98.63   98.28   97.59   98.63   98.97   99.31   99.31  100.00   98.97   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.66   97.59   96.91   96.91   79.73   79.04   79.31   79.04   79.73   79.04   79.38   79.38   79.38   78.69   79.04   79.38   79.04   79.04   79.38   79.04   79.38   78.69   79.38   80.07   79.04   79.73   79.38   79.04   78.69   79.04   79.38   79.04   79.04   79.04   79.04   79.38   79.04   79.38   79.38   79.73   79.38   79.38   79.38   79.38   79.38   79.38   80.07   79.38   79.38   79.38   79.73   79.73   79.73   83.51   83.45   83.10   82.82   82.47   82.47   82.47   82.13   83.16   82.82   82.47   82.82   82.07   83.16   79.73   79.38   79.38   79.73   79.73   79.73   79.73   79.73   80.07   79.73   80.07   79.73   80.07   79.73   80.07   80.07   80.07   79.04   79.73   79.04   79.38   79.04   79.38   79.38   79.86   79.38   79.38   79.38   79.73   79.73   79.73   80.14   80.14   80.07   79.38   79.73   80.07   80.07   80.41   80.07   80.41   79.79   80.41   80.41   79.73   79.73   80.07   80.07   79.73   80.41   79.73   80.07   80.07   80.07   80.07   80.07   80.07   80.41   80.41   80.41   80.41   80.76   80.76

    10: AAZ14955.1   97.94   98.28   97.94   97.25   98.28   98.63   98.97   98.97   98.97  100.00   98.97   99.31   99.66   98.97   98.97   98.97   98.97   99.66   98.97   98.97   99.31   97.25   96.56   96.56   80.07   78.69   78.97   79.38   80.07   79.38   79.38   79.38   79.73   79.04   79.38   79.04   78.69   78.69   79.04   78.69   79.04   78.35   79.04   79.73   78.69   79.38   79.04   79.38   79.04   79.38   79.04   79.38   79.38   79.38   79.38   79.73   79.38   79.04   79.04   79.38   79.04   79.04   79.04   79.04   79.04   79.04   79.73   79.04   79.04   79.38   79.38   79.38   79.38   83.16   83.10   83.10   83.16   82.13   82.13   82.82   82.47   82.82   82.47   82.82   83.16   81.72   82.82   80.07   79.73   79.73   80.07   80.07   80.07   80.07   80.07   80.41   80.07   80.41   80.07   80.41   80.07   80.41   80.41   80.41   79.38   79.38   78.69   79.04   78.69   79.04   79.73   80.21   79.73   79.73   79.73   80.07   80.07   80.07   80.49   80.49   80.41   79.73   80.07   79.73   80.41   80.07   79.73   80.07   79.43   80.07   80.07   79.38   79.38   79.73   79.73   79.38   80.07   80.07   79.73   79.73   79.73   79.73   79.73   79.73   80.07   80.07   80.07   80.76   81.10   81.10

    11: ABD73290.1   98.28   98.63   98.28   97.59   98.63   98.97   99.31   99.31   99.31   98.97  100.00   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.66   97.59   96.91   96.91   80.07   79.38   79.66   79.38   80.07   79.38   79.73   79.73   79.73   79.04   79.38   79.73   79.38   79.38   79.73   79.38   79.73   79.04   79.73   80.41   79.38   80.07   79.73   79.38   79.04   79.38   79.73   79.38   79.38   79.38   79.38   79.73   79.38   79.73   79.73   80.07   79.73   79.73   79.73   79.73   79.73   79.73   80.41   79.73   79.73   79.73   80.07   80.07   80.07   83.85   83.79   83.45   83.16   82.82   82.82   82.82   82.47   83.51   83.16   82.82   83.16   82.41   83.51   80.07   79.73   79.73   80.07   80.07   80.07   80.07   80.07   80.41   80.07   80.41   80.07   80.41   80.07   80.41   80.41   80.41   79.38   80.07   79.38   79.73   79.38   79.73   79.73   80.21   79.73   79.73   79.73   80.07   80.07   80.07   80.49   80.49   80.41   79.73   80.07   80.41   80.41   80.76   80.41   80.76   80.14   80.76   80.76   80.07   80.07   80.41   80.41   80.07   80.76   80.07   80.41   80.41   80.41   80.41   80.41   80.41   80.76   80.76   80.76   80.76   81.10   81.10

    12: ABN48311.1   98.28   98.63   98.28   97.59   98.63   98.97   99.31   99.31   99.31   99.31   99.31  100.00   99.66   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.66   97.59   96.91   96.91   79.73   79.04   79.31   79.38   80.07   79.38   79.73   80.07   79.73   79.04   79.38   79.38   79.04   79.04   79.38   79.04   79.38   78.69   79.38   80.07   79.04   79.73   79.38   79.04   78.69   79.04   79.38   79.04   79.04   79.04   79.04   79.38   79.04   79.38   79.38   79.73   79.38   79.38   79.38   79.38   79.38   79.38   80.07   79.38   79.38   79.38   79.73   79.73   79.73   83.51   83.45   83.79   82.82   82.47   82.47   82.47   82.13   83.16   82.82   82.47   82.82   82.07   83.16   79.73   79.38   79.38   79.73   79.73   79.73   79.73   79.73   80.07   79.73   80.07   79.73   80.07   79.73   80.07   80.07   80.07   79.04   79.73   79.04   79.38   79.04   79.38   79.38   79.86   79.38   79.38   79.38   79.73   79.73   79.73   80.14   80.14   80.07   79.38   79.73   80.07   80.07   80.41   80.07   80.41   79.79   80.41   80.41   79.73   79.73   80.07   80.07   79.73   80.41   79.73   80.07   80.07   80.07   80.07   80.07   80.07   80.41   80.41   80.41   80.41   80.76   80.76

    13: BAA07082.1   98.28   98.63   98.28   97.59   98.63   98.97   99.31   99.31   99.31   99.66   99.31   99.66  100.00   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.66   97.59   96.91   96.91   79.73   79.04   79.31   79.73   80.41   79.73   79.73   79.73   80.07   79.38   79.73   79.38   79.04   79.04   79.38   79.04   79.38   78.69   79.38   80.07   79.04   79.73   79.38   79.04   78.69   79.04   79.38   79.04   79.04   79.04   79.04   79.38   79.04   79.38   79.38   79.73   79.38   79.38   79.38   79.38   79.38   79.38   80.07   79.38   79.38   79.38   79.73   79.73   79.73   83.51   83.45   83.45   82.82   82.47   82.47   82.47   82.13   83.16   82.82   82.47   82.82   82.07   83.16   79.73   79.38   79.38   79.73   79.73   79.73   79.73   79.73   80.07   79.73   80.07   79.73   80.07   79.73   80.07   80.07   80.07   79.04   79.73   79.04   79.38   79.04   79.38   79.38   79.86   79.38   79.38   79.38   79.73   79.73   79.73   80.14   80.14   80.07   79.38   79.73   80.07   80.07   80.41   80.07   80.41   79.79   80.41   80.41   79.73   79.73   80.07   80.07   79.73   80.41   79.73   80.07   80.07   80.07   80.07   80.07   80.07   80.41   80.41   80.41   80.41   80.76   80.76

    14: CAC95175.1   98.63   98.97   98.63   97.94   98.97   99.31   99.31   99.31   99.31   98.97   99.31   99.31   99.31  100.00   99.31   99.31   99.31   99.31   99.31   99.31   99.66   97.94   97.25   96.91   80.07   79.38   79.66   79.38   80.07   79.38   79.73   79.73   79.73   79.04   79.38   79.73   79.38   79.38   79.73   79.38   79.73   79.04   79.73   80.41   79.38   80.07   79.73   79.38   79.04   79.38   79.73   79.38   79.38   79.38   79.38   79.73   79.38   79.73   79.73   80.07   79.73   79.73   79.73   79.73   79.73   79.73   80.41   79.73   79.73   79.73   80.07   80.07   80.07   83.85   83.79   83.45   83.16   82.82   82.82   82.82   82.47   83.51   83.16   82.82   83.16   82.41   83.51   80.07   79.73   79.73   80.07   80.07   80.07   80.07   80.07   80.41   80.07   80.41   80.07   80.41   80.07   80.41   80.41   80.41   79.38   80.07   79.38   79.73   79.38   79.73   79.73   80.21   79.73   79.73   79.73   80.07   80.07   80.07   80.49   80.49   80.41   79.73   80.07   80.07   80.07   80.41   80.41   80.76   80.14   80.76   80.76   80.07   80.07   80.41   80.41   80.07   80.76   80.07   80.41   80.41   80.41   80.41   80.41   80.41   80.76   80.76   80.76   80.76   81.10   81.10

    15: ACS32293.1   98.28   98.63   98.28   97.59   98.63   98.97   99.31   99.31   99.31   98.97   99.31   99.31   99.31   99.31  100.00   99.31   99.31   99.31   99.31   99.31   99.66   97.59   96.91   96.91   79.73   79.04   79.31   79.38   79.73   79.04   79.38   79.38   79.38   78.69   79.04   79.73   79.04   79.38   79.38   79.38   79.38   78.69   79.38   80.07   79.04   79.73   79.38   79.04   78.69   79.04   79.38   79.04   79.04   79.04   79.04   79.38   79.04   79.38   79.38   79.73   79.38   79.38   79.38   79.38   79.38   79.38   80.07   79.38   79.73   79.38   79.73   79.73   79.73   83.51   83.45   83.10   82.82   82.47   82.47   82.47   82.13   83.16   82.82   82.47   82.82   82.07   83.16   79.73   79.38   79.38   79.73   79.73   79.73   79.73   79.73   80.07   79.73   80.07   79.73   80.07   79.73   80.07   80.07   80.07   79.04   79.73   79.73   79.38   79.04   79.38   79.38   79.86   79.38   79.38   79.38   79.73   79.73   79.73   80.14   80.14   80.07   79.38   79.73   80.07   80.07   80.41   80.07   80.41   79.79   80.41   80.41   80.07   80.41   80.07   80.07   79.73   80.41   79.73   80.07   80.76   80.41   80.07   80.41   80.07   80.41   80.41   80.41   80.41   80.76   80.76

    16: ACS32294.1   98.28   98.63   98.28   97.59   98.63   98.97   99.31   99.31   99.31   98.97   99.31   99.31   99.31   99.31   99.31  100.00   99.31   99.31   99.31   99.31   99.66   97.59   96.91   96.91   79.73   79.04   79.31   79.04   79.73   79.04   79.38   79.38   79.38   78.69   79.04   79.38   79.04   79.04   79.38   79.04   79.38   78.69   79.38   80.07   79.04   79.73   79.38   79.04   78.69   79.04   79.38   79.04   79.04   79.04   79.04   79.38   79.04   79.38   79.38   79.73   79.38   79.38   79.38   79.38   79.38   79.38   80.07   79.38   79.38   79.38   79.73   79.73   79.73   84.19   84.14   83.79   83.51   83.16   83.16   83.16   82.82   83.85   83.51   83.16   83.51   82.76   83.85   80.07   79.73   79.73   80.07   80.07   80.07   80.07   80.07   80.41   80.07   80.41   80.07   80.41   80.07   80.41   80.41   80.41   79.38   80.07   79.38   79.73   79.38   79.73   79.73   80.21   79.73   79.73   79.73   80.07   80.07   80.07   80.49   80.49   80.41   79.73   80.07   80.41   80.41   80.76   80.41   80.76   80.14   80.76   80.76   80.07   80.07   80.41   80.41   80.07   80.76   80.07   80.41   80.41   80.41   80.41   80.41   80.41   80.76   80.76   80.76   80.76   81.10   81.10

    17: ADM08178.1   98.28   98.63   98.28   97.59   98.63   98.97   99.31   99.31   99.31   98.97   99.31   99.31   99.31   99.31   99.31   99.31  100.00   99.31   99.31   99.31   99.66   97.59   96.91   96.91   80.07   79.38   79.66   79.38   80.07   79.38   79.73   79.73   79.73   79.04   79.38   79.73   79.38   79.38   79.73   79.38   79.73   79.04   79.73   80.41   79.38   80.07   79.73   79.38   79.04   79.38   79.73   79.38   79.38   79.38   79.38   79.73   79.38   79.73   79.73   80.07   79.73   79.73   79.73   79.73   79.73   79.73   80.41   79.73   79.73   79.73   80.07   80.07   80.07   83.85   83.79   83.45   82.82   82.47   82.47   82.47   82.13   83.16   82.82   82.47   82.82   82.07   83.16   79.73   79.38   79.38   79.73   79.73   79.73   79.73   79.73   80.07   79.73   80.07   79.73   80.07   79.73   80.07   80.07   80.07   79.04   79.73   79.04   79.38   79.04   79.38   79.38   79.86   79.38   79.38   79.38   79.73   79.73   79.73   80.14   80.14   80.07   79.38   79.73   80.07   80.07   80.41   80.07   80.41   79.79   80.41   80.41   79.73   79.73   80.07   80.07   79.73   80.41   80.07   80.41   80.07   80.07   80.07   80.07   80.07   80.41   80.41   80.41   80.41   80.76   80.76

    18: AEW46676.3   98.28   98.63   98.28   97.59   98.63   98.97   99.31   99.31   99.31   99.66   99.31   99.31   99.31   99.31   99.31   99.31   99.31  100.00   99.31   99.31   99.66   97.59   96.91   96.91   80.41   79.04   79.31   79.04   79.73   79.04   79.38   79.38   79.38   78.69   79.04   79.38   79.04   79.04   79.38   79.04   79.38   78.69   79.38   80.07   79.04   79.73   79.38   79.73   79.38   79.73   79.38   79.73   79.73   79.73   79.73   80.07   79.73   79.38   79.38   79.73   79.38   79.38   79.38   79.38   79.38   79.38   80.07   79.38   79.38   79.73   79.73   79.73   79.73   83.51   83.45   83.10   83.51   82.47   82.47   83.16   82.82   83.16   82.82   83.16   83.51   82.07   83.16   80.41   80.07   80.07   80.41   80.41   80.41   80.41   80.41   80.76   80.41   80.76   80.41   80.76   80.41   80.76   80.76   80.76   79.73   79.73   79.04   79.38   79.04   79.38   80.07   80.56   80.07   80.07   80.07   80.41   80.41   80.41   80.84   80.84   80.76   80.07   80.41   80.07   80.76   80.41   80.07   80.41   79.79   80.41   80.41   79.73   79.73   80.07   80.07   79.73   80.41   80.41   80.07   80.07   80.07   80.07   80.07   80.07   80.41   80.41   80.41   81.10   81.44   81.44

    19: AKR53960.1   98.28   98.63   98.28   97.59   98.63   98.97   99.31   99.31   99.31   98.97   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31  100.00   99.31   99.66   97.59   96.91   96.91   80.41   79.73   80.00   79.73   80.41   79.73   80.07   80.07   80.07   79.38   79.73   80.07   79.73   79.73   80.07   79.73   80.07   79.38   80.07   80.07   79.73   79.73   80.07   79.73   79.38   79.73   80.07   79.73   79.73   79.73   79.73   80.07   79.73   80.07   80.07   80.41   80.07   80.07   80.07   80.07   80.07   80.07   80.76   80.07   80.07   80.07   80.41   80.41   80.41   83.51   83.45   83.10   82.82   82.47   82.47   82.47   82.13   83.16   82.82   82.47   82.82   82.07   83.16   80.07   79.73   79.73   80.07   80.07   80.07   80.07   80.07   80.41   80.07   80.41   80.07   80.41   80.07   80.41   80.41   80.41   79.38   80.07   79.38   79.73   79.38   79.73   79.73   80.21   79.73   79.73   79.73   80.07   80.07   80.07   80.49   80.49   80.41   79.73   80.07   80.41   80.41   80.76   80.41   80.76   80.14   80.76   80.76   80.07   80.07   80.41   80.41   80.07   80.76   80.07   80.41   80.41   80.41   80.41   80.41   80.41   80.76   80.76   80.76   80.76   81.10   81.10

    20: ALR99814.1   98.28   98.63   98.28   97.59   98.63   98.97   99.31   99.31   99.31   98.97   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31  100.00   99.66   97.59   96.91   96.91   80.07   79.38   79.66   79.38   80.07   79.38   79.73   79.73   79.73   79.04   79.38   79.73   79.38   79.38   79.73   79.38   79.73   79.04   79.73   80.41   79.38   80.07   79.73   79.38   79.04   79.38   79.73   79.38   79.38   79.38   79.38   79.73   79.38   79.73   79.73   80.07   79.73   79.73   79.73   79.73   79.73   79.73   80.41   79.73   79.73   79.73   80.07   80.07   80.07   83.85   83.79   83.45   82.82   82.47   82.47   82.47   82.13   83.16   82.82   82.47   82.82   82.07   83.16   79.73   79.38   79.38   79.73   79.73   79.73   79.73   79.73   80.07   79.73   80.07   79.73   80.07   79.73   80.07   80.07   80.07   79.04   79.73   79.04   79.38   79.04   79.38   79.38   79.86   79.38   79.38   79.38   79.73   79.73   79.73   80.14   80.14   80.07   79.38   79.73   80.07   80.07   80.41   80.07   80.41   79.79   80.41   80.41   79.73   79.73   80.07   80.07   79.73   80.41   79.73   80.07   80.07   80.07   80.07   80.07   80.07   80.41   80.41   80.41   80.76   80.76   80.76

    21: CAA63263.1   98.63   98.97   98.63   97.94   98.97   99.31   99.66   99.66   99.66   99.31   99.66   99.66   99.66   99.66   99.66   99.66   99.66   99.66   99.66   99.66  100.00   97.94   97.25   97.25   80.07   79.38   79.66   79.38   80.07   79.38   79.73   79.73   79.73   79.04   79.38   79.73   79.38   79.38   79.73   79.38   79.73   79.04   79.73   80.41   79.38   80.07   79.73   79.38   79.04   79.38   79.73   79.38   79.38   79.38   79.38   79.73   79.38   79.73   79.73   80.07   79.73   79.73   79.73   79.73   79.73   79.73   80.41   79.73   79.73   79.73   80.07   80.07   80.07   83.85   83.79   83.45   83.16   82.82   82.82   82.82   82.47   83.51   83.16   82.82   83.16   82.41   83.51   80.07   79.73   79.73   80.07   80.07   80.07   80.07   80.07   80.41   80.07   80.41   80.07   80.41   80.07   80.41   80.41   80.41   79.38   80.07   79.38   79.73   79.38   79.73   79.73   80.21   79.73   79.73   79.73   80.07   80.07   80.07   80.49   80.49   80.41   79.73   80.07   80.41   80.41   80.76   80.41   80.76   80.14   80.76   80.76   80.07   80.07   80.41   80.41   80.07   80.76   80.07   80.41   80.41   80.41   80.41   80.41   80.41   80.76   80.76   80.76   80.76   81.10   81.10

    22: CAA06311.1   97.25   97.59   97.25   96.56   97.59   97.94   97.59   97.59   97.59   97.25   97.59   97.59   97.59   97.94   97.59   97.59   97.59   97.59   97.59   97.59   97.94  100.00   98.28   97.59   79.04   78.35   78.62   78.35   79.04   78.35   78.69   78.69   78.69   78.01   78.35   78.69   78.35   78.35   78.69   78.35   78.69   78.01   78.69   79.38   78.35   79.04   78.69   78.35   78.01   78.35   78.69   78.35   78.35   78.35   78.35   78.69   78.35   78.69   78.69   79.04   78.69   78.69   78.69   78.69   78.69   78.69   79.38   78.69   78.69   78.69   79.04   79.04   79.04   82.82   82.76   82.41   82.13   81.79   81.79   81.79   81.44   82.47   82.13   81.79   82.13   81.38   82.47   78.69   78.35   78.35   78.69   78.69   78.69   78.69   78.69   79.04   78.69   79.04   78.69   79.04   78.69   79.04   79.04   79.04   78.01   78.69   78.01   78.35   78.01   78.35   78.35   78.82   78.35   78.35   78.35   78.69   78.69   78.69   79.09   79.09   79.04   78.35   78.69   78.35   78.35   78.69   79.04   79.38   78.72   79.38   79.38   78.69   78.69   79.04   79.04   78.69   79.38   78.69   79.04   79.04   79.04   79.04   79.04   79.04   79.38   79.38   79.38   79.73   79.73   79.73

    23: CAA06312.1   96.56   97.59   97.25   95.88   96.91   97.25   96.91   96.91   96.91   96.56   96.91   96.91   96.91   97.25   96.91   96.91   96.91   96.91   96.91   96.91   97.25   98.28  100.00   98.63   78.35   78.01   78.28   78.01   78.69   78.01   78.35   78.35   78.35   77.66   78.01   78.35   78.01   78.01   78.35   78.01   78.35   78.01   78.35   79.04   78.01   78.69   78.35   78.01   77.66   78.01   78.35   78.01   78.01   78.01   78.35   78.35   78.01   78.35   78.35   78.69   78.35   78.35   78.35   78.35   78.35   78.35   79.04   78.35   78.35   78.35   78.69   78.69   78.69   82.13   82.07   81.72   81.44   81.10   81.10   81.10   80.76   81.79   81.44   81.10   81.44   80.69   81.79   78.01   77.66   77.66   78.01   78.01   78.01   78.01   78.01   78.35   78.01   78.35   78.01   78.35   78.01   78.35   78.35   78.35   77.32   78.01   77.32   77.66   77.32   77.66   77.66   78.12   77.66   77.66   77.66   78.01   78.01   78.01   78.40   78.40   78.35   77.66   78.01   77.66   77.66   78.01   78.35   78.69   78.01   78.69   78.69   78.01   78.01   78.35   78.35   78.01   78.69   78.01   78.35   78.35   78.35   78.35   78.35   78.35   78.69   78.69   78.69   79.04   79.04   79.38

    24: CAA74573.1   95.88   96.91   96.56   95.19   96.22   96.56   96.91   96.91   96.91   96.56   96.91   96.91   96.91   96.91   96.91   96.91   96.91   96.91   96.91   96.91   97.25   97.59   98.63  100.00   77.66   77.32   77.59   77.32   78.01   77.32   77.66   77.66   77.66   76.98   77.32   77.66   77.32   77.32   77.66   77.32   77.66   77.32   77.66   78.35   77.32   78.01   77.66   77.32   76.98   77.32   77.66   77.32   77.32   77.32   77.32   77.66   77.32   77.66   77.66   78.01   77.66   77.66   77.66   77.66   77.66   77.66   78.35   77.66   77.66   77.66   78.01   78.01   78.01   81.44   81.38   81.03   80.76   80.41   80.41   80.41   80.07   81.10   80.76   80.41   80.76   80.00   81.10   77.32   76.98   76.98   77.32   77.32   77.32   77.32   77.32   77.66   77.32   77.66   77.32   77.66   77.32   77.66   77.66   77.66   76.63   77.32   76.63   76.98   76.63   76.98   76.98   77.43   76.98   76.98   76.98   77.32   77.32   77.32   77.70   77.70   77.66   76.98   77.32   77.66   77.66   78.01   77.66   78.01   77.30   78.01   78.01   77.32   77.32   77.66   77.66   77.32   78.01   77.32   77.66   77.66   77.66   77.66   77.66   77.66   78.01   78.01   78.01   78.35   78.35   78.69

    25: BAO37256.1   80.76   80.41   80.41   80.76   79.73   80.07   79.73   79.73   79.73   80.07   80.07   79.73   79.73   80.07   79.73   79.73   80.07   80.41   80.41   80.07   80.07   79.04   78.35   77.66  100.00   92.10   93.10   93.13   93.13   93.13   93.47   93.47   93.47   92.78   93.13   93.47   93.13   93.13   93.47   93.13   92.78   92.78   93.47   93.47   93.13   93.13   93.47   93.81   93.47   93.81   93.13   93.81   93.81   93.81   93.81   94.16   93.81   93.47   93.47   93.81   93.47   93.47   93.47   93.47   93.47   93.47   93.47   93.47   93.47   93.81   93.47   93.81   93.81   85.91   85.86   85.52   83.51   82.82   82.82   83.51   83.16   82.82   83.16   83.51   83.85   83.45   84.19   85.57   85.22   85.22   85.57   85.57   86.25   85.57   85.57   85.57   85.57   85.57   85.57   85.91   85.57   85.57   85.91   85.91   84.54   84.54   83.85   84.54   83.85   84.19   85.22   85.07   85.22   85.22   85.22   85.57   85.57   85.57   85.37   85.37   85.57   84.88   85.22   84.88   85.57   85.22   85.22   85.57   84.40   84.88   85.22   84.88   84.54   85.22   84.88   85.22   84.88   85.91   85.57   85.22   85.22   85.22   85.22   85.22   85.57   85.57   85.57   90.03   89.00   85.91

    26: CAD08929.1   79.38   80.07   80.07   79.38   79.04   79.38   79.04   79.04   79.04   78.69   79.38   79.04   79.04   79.38   79.04   79.04   79.38   79.04   79.73   79.38   79.38   78.35   78.01   77.32   92.10  100.00   97.59   97.59   97.59   97.59   97.94   97.94   97.94   97.25   97.59   97.94   97.59   97.59   97.94   97.59   97.25   97.25   97.94   97.94   97.59   97.59   97.94   97.59   97.25   97.59   97.59   97.59   97.59   97.59   97.59   97.94   97.59   97.94   97.94   97.94   97.94   97.94   97.94   97.94   97.94   97.94   97.94   97.94   97.94   97.94   97.94   98.28   98.28   84.19   84.48   84.14   81.10   81.10   81.10   81.10   80.76   81.79   81.44   81.10   81.44   81.72   82.82   78.35   78.01   78.01   78.35   78.35   79.04   78.35   78.35   78.35   78.35   78.35   78.35   78.69   79.04   78.69   78.69   78.69   77.66   78.35   77.66   78.01   77.66   78.01   78.01   78.12   78.35   78.01   78.01   78.35   78.35   78.35   78.40   78.40   78.69   78.69   78.35   78.35   78.35   78.69   78.69   79.04   79.08   78.35   79.04   78.35   78.35   78.69   78.69   78.69   78.35   78.69   79.04   78.69   78.69   78.69   78.69   78.69   79.04   79.04   79.04   86.94   81.79   84.19

    27: ADZ31262.1   79.66   80.34   80.34   79.66   79.31   79.66   79.31   79.31   79.31   78.97   79.66   79.31   79.31   79.66   79.31   79.31   79.66   79.31   80.00   79.66   79.66   78.62   78.28   77.59   93.10   97.59  100.00   98.62   98.62   99.31   98.97   98.97   98.97   98.28   98.62   98.97   98.62   98.62   98.97   98.62   98.28   98.28   98.97   98.97   98.62   98.62   98.97   98.62   98.28   98.62   98.97   98.62   98.62   98.62   98.62   98.97   98.62   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   99.31   99.31   84.83   85.12   84.78   81.72   81.72   81.72   81.72   81.38   82.41   82.07   81.72   82.07   82.35   83.10   78.62   78.28   78.28   78.62   78.62   79.31   79.31   78.62   78.62   78.62   78.62   78.62   78.97   79.31   78.97   78.97   78.97   77.93   78.62   77.93   78.28   77.93   78.28   78.28   78.47   78.62   78.28   78.28   78.62   78.62   78.62   79.44   78.75   78.97   78.97   78.62   78.62   78.62   78.97   78.97   79.31   79.43   78.62   79.31   78.62   78.62   78.97   78.97   78.97   78.62   78.97   79.31   78.97   78.97   78.97   78.97   78.97   79.31   79.31   79.31   87.24   82.07   84.48

    28: ADL27532.1   79.38   80.07   80.07   79.38   79.04   79.38   79.04   79.04   79.04   79.38   79.38   79.38   79.73   79.38   79.38   79.04   79.38   79.04   79.73   79.38   79.38   78.35   78.01   77.32   93.13   97.59   98.62  100.00   99.31   99.31   99.31   99.31   99.66   98.97   99.31   99.66   98.63   99.31   98.97   98.97   98.28   98.28   98.97   98.97   98.63   98.63   98.97   98.63   98.28   98.63   98.63   98.63   98.63   98.63   98.63   98.97   98.63   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   99.31   98.97   98.97   99.31   99.31   84.54   84.83   84.83   81.44   81.44   81.44   81.44   81.10   82.13   81.79   81.44   81.79   82.07   82.82   78.69   78.35   78.35   78.69   78.69   79.38   78.69   78.69   78.69   78.69   78.69   78.69   79.04   79.38   79.04   79.04   79.04   78.01   78.69   78.35   78.35   78.01   78.35   78.35   78.47   78.69   78.35   78.35   78.69   78.69   78.69   78.75   78.75   79.04   79.04   78.69   78.69   78.69   79.04   79.04   79.38   79.43   78.69   79.38   79.38   79.04   79.04   79.04   79.04   78.69   79.04   79.38   79.38   79.73   79.04   79.38   79.04   79.38   79.38   79.38   87.29   82.13   84.54

    29: AFA51700.1   80.07   80.76   80.76   80.07   79.73   80.07   79.73   79.73   79.73   80.07   80.07   80.07   80.41   80.07   79.73   79.73   80.07   79.73   80.41   80.07   80.07   79.04   78.69   78.01   93.13   97.59   98.62   99.31  100.00   99.31   99.31   99.31   99.66   98.97   99.31   98.97   98.63   98.63   98.97   98.63   98.63   98.28   98.97   98.97   98.63   98.63   98.97   98.63   98.28   98.63   98.63   98.63   98.63   98.63   98.63   98.97   98.63   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   99.31   99.31   84.54   84.83   84.83   81.79   81.79   81.79   81.79   81.44   82.47   82.13   81.79   82.13   82.07   83.16   79.04   78.69   78.69   79.04   79.04   79.73   79.04   79.04   79.04   79.04   79.04   79.04   79.38   79.73   79.38   79.38   79.38   78.35   79.04   78.35   78.69   78.35   78.69   78.69   78.82   79.04   78.69   78.69   79.04   79.04   79.04   79.09   79.09   79.38   79.38   79.04   79.04   79.04   79.38   79.38   79.73   79.79   79.04   79.73   79.04   79.04   79.38   79.38   79.38   79.04   79.38   79.73   79.38   79.38   79.38   79.38   79.38   79.73   79.73   79.73   87.29   82.13   84.54

    30: AFJ59957.1   79.38   80.07   80.07   79.38   79.04   79.38   79.04   79.04   79.04   79.38   79.38   79.38   79.73   79.38   79.04   79.04   79.38   79.04   79.73   79.38   79.38   78.35   78.01   77.32   93.13   97.59   99.31   99.31   99.31  100.00   99.31   99.31   99.66   98.97   99.31   98.97   98.63   98.63   98.97   98.63   98.28   98.28   98.97   98.97   98.63   98.63   98.97   98.63   98.28   98.63   98.63   98.63   98.63   98.63   98.63   98.97   98.63   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   99.31   99.31   84.54   84.83   84.83   81.44   81.44   81.44   81.44   81.10   82.13   81.79   81.44   81.79   82.07   82.82   78.69   78.35   78.35   78.69   78.69   79.38   79.38   78.69   78.69   78.69   78.69   78.69   79.04   79.38   79.04   79.04   79.04   78.01   78.69   78.01   78.35   78.01   78.35   78.35   78.47   78.69   78.35   78.35   78.69   78.69   78.69   78.75   78.75   79.04   79.04   78.69   78.69   78.69   79.04   79.04   79.38   79.43   78.69   79.38   78.69   78.69   79.04   79.04   79.04   78.69   79.04   79.38   79.04   79.04   79.04   79.04   79.04   79.38   79.38   79.38   87.29   82.13   84.54

    31: AFO69261.1   79.73   80.41   80.41   79.73   79.38   79.73   79.38   79.38   79.38   79.38   79.73   79.73   79.73   79.73   79.38   79.38   79.73   79.38   80.07   79.73   79.73   78.69   78.35   77.66   93.47   97.94   98.97   99.31   99.31   99.31  100.00   99.66   99.66   98.97   99.31   99.31   98.97   98.97   99.31   98.97   98.63   98.63   99.31   99.31   98.97   98.97   99.31   98.97   98.63   98.97   98.97   98.97   98.97   98.97   98.97   99.31   98.97   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.66   99.66   84.88   85.17   85.17   81.79   81.79   81.79   81.79   81.44   82.47   82.13   81.79   82.13   82.41   83.16   79.04   78.69   78.69   79.04   79.04   79.73   79.04   79.04   79.04   79.04   79.04   79.04   79.38   79.73   79.38   79.38   79.38   78.35   79.04   78.35   78.69   78.35   78.69   78.69   78.82   79.04   78.69   78.69   79.04   79.04   79.04   79.09   79.09   79.38   79.38   79.04   79.04   79.04   79.38   79.38   79.73   79.79   79.04   79.73   79.04   79.04   79.38   79.38   79.38   79.04   79.38   79.73   79.38   79.38   79.38   79.38   79.38   79.73   79.73   79.73   87.63   82.47   84.88

    32: ADY02555.1   79.73   80.41   80.41   79.73   79.38   79.73   79.38   79.38   79.38   79.38   79.73   80.07   79.73   79.73   79.38   79.38   79.73   79.38   80.07   79.73   79.73   78.69   78.35   77.66   93.47   97.94   98.97   99.31   99.31   99.31   99.66  100.00   99.66   98.97   99.31   99.31   98.97   98.97   99.31   98.97   98.63   98.63   99.31   99.31   98.97   98.97   99.31   98.97   98.63   98.97   98.97   98.97   98.97   98.97   98.97   99.31   98.97   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.66   99.66   84.88   85.17   85.52   81.79   81.79   81.79   81.79   81.44   82.47   82.13   81.79   82.13   82.41   83.16   79.04   78.69   78.69   79.04   79.04   79.73   79.04   79.04   79.04   79.04   79.04   79.04   79.38   79.73   79.38   79.38   79.38   78.35   79.04   78.35   78.69   78.35   78.69   78.69   78.82   79.04   78.69   78.69   79.04   79.04   79.04   79.09   79.09   79.38   79.38   79.04   79.04   79.04   79.38   79.38   79.73   79.79   79.04   79.73   79.04   79.04   79.38   79.38   79.38   79.04   79.38   79.73   79.38   79.38   79.38   79.38   79.38   79.73   79.73   79.73   87.63   82.47   84.88

    33: AAN38836.1   79.73   80.41   80.41   79.73   79.38   79.73   79.38   79.38   79.38   79.73   79.73   79.73   80.07   79.73   79.38   79.38   79.73   79.38   80.07   79.73   79.73   78.69   78.35   77.66   93.47   97.94   98.97   99.66   99.66   99.66   99.66   99.66  100.00   99.31   99.66   99.31   98.97   98.97   99.31   98.97   98.63   98.63   99.31   99.31   98.97   98.97   99.31   98.97   98.63   98.97   98.97   98.97   98.97   98.97   98.97   99.31   98.97   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.66   99.66   84.88   85.17   85.17   81.79   81.79   81.79   81.79   81.44   82.47   82.13   81.79   82.13   82.41   83.16   79.04   78.69   78.69   79.04   79.04   79.73   79.04   79.04   79.04   79.04   79.04   79.04   79.38   79.73   79.38   79.38   79.38   78.35   79.04   78.35   78.69   78.35   78.69   78.69   78.82   79.04   78.69   78.69   79.04   79.04   79.04   79.09   79.09   79.38   79.38   79.04   79.04   79.04   79.38   79.38   79.73   79.79   79.04   79.73   79.04   79.04   79.38   79.38   79.38   79.04   79.38   79.73   79.38   79.38   79.38   79.38   79.38   79.73   79.73   79.73   87.63   82.47   84.88

    34: AHX39589.1   79.04   79.73   79.73   79.04   78.69   79.04   78.69   78.69   78.69   79.04   79.04   79.04   79.38   79.04   78.69   78.69   79.04   78.69   79.38   79.04   79.04   78.01   77.66   76.98   92.78   97.25   98.28   98.97   98.97   98.97   98.97   98.97   99.31  100.00   99.66   98.63   98.97   98.97   99.31   98.97   97.94   97.94   98.63   98.63   98.28   98.28   98.63   98.97   98.63   98.28   98.28   98.28   98.28   98.28   98.28   98.63   98.28   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.97   98.97   84.19   84.48   84.48   81.10   81.79   81.79   81.79   81.44   81.79   81.44   81.10   81.44   81.72   82.47   78.35   78.01   78.01   78.35   78.35   79.04   78.35   78.35   78.35   78.35   78.35   78.35   78.69   79.04   78.69   78.69   78.69   78.35   78.35   78.35   78.69   78.35   78.69   78.69   78.12   78.35   78.69   78.69   79.04   79.04   79.04   78.40   78.40   78.69   79.38   79.04   79.04   78.35   78.69   78.69   79.04   79.08   78.35   79.04   79.04   79.04   79.38   79.38   78.69   78.35   78.69   79.04   78.69   78.69   78.69   78.69   78.69   79.04   79.04   79.04   86.94   81.79   84.19

    35: ABN69105.1   79.38   80.07   80.07   79.38   79.04   79.38   79.04   79.04   79.04   79.38   79.38   79.38   79.73   79.38   79.04   79.04   79.38   79.04   79.73   79.38   79.38   78.35   78.01   77.32   93.13   97.59   98.62   99.31   99.31   99.31   99.31   99.31   99.66   99.66  100.00   98.97   99.31   99.31   99.66   99.31   98.28   98.28   98.97   98.97   98.63   98.63   98.97   99.31   98.97   98.63   98.63   98.63   98.63   98.63   98.63   98.97   98.63   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   99.31   99.31   84.54   84.83   84.83   81.44   82.13   82.13   82.13   81.79   82.13   81.79   81.44   81.79   82.07   82.82   78.69   78.35   78.35   78.69   78.69   79.38   78.69   78.69   78.69   78.69   78.69   78.69   79.04   79.38   79.04   79.04   79.04   78.69   78.69   78.69   79.04   78.69   79.04   79.04   78.47   78.69   79.04   79.04   79.38   79.38   79.38   78.75   78.75   79.04   79.73   79.38   79.38   78.69   79.04   79.04   79.38   79.43   78.69   79.38   79.38   79.38   79.73   79.73   79.04   78.69   79.04   79.38   79.04   79.04   79.04   79.04   79.04   79.38   79.38   79.38   87.29   82.13   84.54

    36: AAK55534.1   79.73   80.41   80.41   79.73   79.38   79.73   79.38   79.38   79.38   79.04   79.73   79.38   79.38   79.73   79.73   79.38   79.73   79.38   80.07   79.73   79.73   78.69   78.35   77.66   93.47   97.94   98.97   99.66   98.97   98.97   99.31   99.31   99.31   98.63   98.97  100.00   98.97   99.66   99.31   99.31   98.63   98.63   99.31   99.31   98.97   98.97   99.31   98.97   98.63   98.97   98.97   98.97   98.97   98.97   98.97   99.31   98.97   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.66   99.31   99.31   99.66   99.66   84.88   85.17   84.83   81.79   81.79   81.79   81.79   81.44   82.47   82.13   81.79   82.13   82.41   83.16   79.04   78.69   78.69   79.04   79.04   79.73   79.04   79.04   79.04   79.04   79.04   79.04   79.38   79.73   79.38   79.38   79.38   78.35   79.04   78.69   78.69   78.35   78.69   78.69   78.82   79.04   78.69   78.69   79.04   79.04   79.04   79.09   79.09   79.38   79.38   79.04   79.04   79.04   79.38   79.38   79.73   79.79   79.04   79.73   79.73   79.38   79.38   79.38   79.38   79.04   79.38   79.73   79.73   80.07   79.38   79.73   79.38   79.73   79.73   79.73   87.63   82.47   84.88

    37: ABA62022.1   79.38   80.07   80.07   79.38   79.04   79.38   79.04   79.04   79.04   78.69   79.38   79.04   79.04   79.38   79.04   79.04   79.38   79.04   79.73   79.38   79.38   78.35   78.01   77.32   93.13   97.59   98.62   98.63   98.63   98.63   98.97   98.97   98.97   98.97   99.31   98.97  100.00   99.31   99.66   99.31   98.28   98.28   98.97   98.97   98.63   98.63   98.97   99.31   98.97   98.63   98.63   98.63   98.63   98.63   98.63   98.97   99.31   98.97   99.66   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   99.31   99.31   84.54   84.83   84.48   81.44   82.13   82.13   82.13   81.79   82.13   81.79   81.44   81.79   82.07   82.82   78.69   78.35   78.35   78.69   78.69   79.38   78.69   78.69   78.69   78.69   78.69   78.69   79.04   79.38   79.04   79.04   79.04   78.69   78.69   78.69   79.04   78.69   79.04   79.04   78.47   78.69   79.04   79.04   79.38   79.38   79.38   78.75   78.75   79.04   79.73   79.38   79.38   78.69   79.04   79.04   79.38   79.43   78.69   79.38   79.38   79.38   79.73   79.73   79.04   78.69   79.04   79.38   79.04   79.04   79.04   79.04   79.04   79.38   79.38   79.38   87.29   82.13   84.54

    38: AHA80961.1   79.38   80.07   80.07   79.38   79.04   79.38   79.04   79.04   79.04   78.69   79.38   79.04   79.04   79.38   79.38   79.04   79.38   79.04   79.73   79.38   79.38   78.35   78.01   77.32   93.13   97.59   98.62   99.31   98.63   98.63   98.97   98.97   98.97   98.97   99.31   99.66   99.31  100.00   99.66   99.66   98.28   98.28   98.97   98.97   98.63   98.63   98.97   99.31   98.97   98.63   98.63   98.63   98.63   98.63   98.63   98.97   98.63   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   99.31   98.97   98.97   99.31   99.31   84.54   84.83   84.48   81.44   82.13   82.13   82.13   81.79   82.13   81.79   81.44   81.79   82.07   82.82   78.69   78.35   78.35   78.69   78.69   79.38   78.69   78.69   78.69   78.69   78.69   78.69   79.04   79.38   79.04   79.04   79.04   78.69   78.69   79.04   79.04   78.69   79.04   79.04   78.47   78.69   79.04   79.04   79.38   79.38   79.38   78.75   78.75   79.04   79.73   79.38   79.38   78.69   79.04   79.04   79.38   79.43   78.69   79.38   80.07   79.73   79.73   79.73   79.04   78.69   79.04   79.38   79.38   79.73   79.04   79.38   79.04   79.38   79.38   79.38   87.29   82.13   84.54

    39: ACQ99521.1   79.73   80.41   80.41   79.73   79.38   79.73   79.38   79.38   79.38   79.04   79.73   79.38   79.38   79.73   79.38   79.38   79.73   79.38   80.07   79.73   79.73   78.69   78.35   77.66   93.47   97.94   98.97   98.97   98.97   98.97   99.31   99.31   99.31   99.31   99.66   99.31   99.66   99.66  100.00   99.66   98.63   98.63   99.31   99.31   98.97   98.97   99.31   99.66   99.31   98.97   98.97   98.97   98.97   98.97   98.97   99.31   98.97   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.66   99.66   84.88   85.17   84.83   81.79   82.47   82.47   82.47   82.13   82.47   82.13   81.79   82.13   82.41   83.16   79.04   78.69   78.69   79.04   79.04   79.73   79.04   79.04   79.04   79.04   79.04   79.04   79.38   79.73   79.38   79.38   79.38   79.04   79.04   79.04   79.38   79.04   79.38   79.38   78.82   79.04   79.38   79.38   79.73   79.73   79.73   79.09   79.09   79.38   80.07   79.73   79.73   79.04   79.38   79.38   79.73   79.79   79.04   79.73   79.73   79.73   80.07   80.07   79.38   79.04   79.38   79.73   79.38   79.38   79.38   79.38   79.38   79.73   79.73   79.73   87.63   82.47   84.88

    40: ACB41777.1   79.38   80.07   80.07   79.38   79.04   79.38   79.04   79.04   79.04   78.69   79.38   79.04   79.04   79.38   79.38   79.04   79.38   79.04   79.73   79.38   79.38   78.35   78.01   77.32   93.13   97.59   98.62   98.97   98.63   98.63   98.97   98.97   98.97   98.97   99.31   99.31   99.31   99.66   99.66  100.00   98.28   98.28   98.97   98.97   98.63   98.63   98.97   99.31   98.97   98.63   98.63   98.63   98.63   98.63   98.63   98.97   98.63   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   99.31   98.97   98.97   99.31   99.31   84.54   84.83   84.48   81.44   82.13   82.13   82.13   81.79   82.13   81.79   81.44   81.79   82.07   82.82   78.69   78.35   78.35   78.69   78.69   79.38   78.69   78.69   78.69   78.69   78.69   78.69   79.04   79.38   79.04   79.04   79.04   78.69   78.69   79.04   79.04   78.69   79.04   79.04   78.47   78.69   79.04   79.04   79.38   79.38   79.38   78.75   78.75   79.04   79.73   79.38   79.38   78.69   79.04   79.04   79.38   79.43   78.69   79.38   79.73   79.73   79.73   79.73   79.04   78.69   79.04   79.38   79.38   79.38   79.04   79.38   79.04   79.38   79.38   79.38   87.29   82.13   84.54

    41: AAF72531.1   79.73   80.41   80.41   79.73   79.38   79.73   79.38   79.38   79.38   79.04   79.73   79.38   79.38   79.73   79.38   79.38   79.73   79.38   80.07   79.73   79.73   78.69   78.35   77.66   92.78   97.25   98.28   98.28   98.63   98.28   98.63   98.63   98.63   97.94   98.28   98.63   98.28   98.28   98.63   98.28  100.00   97.94   98.63   98.63   98.28   98.28   98.63   98.28   97.94   98.28   98.28   98.28   98.28   98.28   98.28   98.63   98.28   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.97   98.97   84.19   84.48   84.14   81.44   81.44   81.44   81.44   81.10   82.13   81.79   81.44   81.79   81.72   82.82   79.04   78.69   78.69   79.04   79.04   79.73   79.04   79.04   79.04   79.04   79.04   79.04   79.38   79.73   79.38   79.38   79.38   78.35   79.04   78.35   78.69   78.35   78.69   78.69   78.82   79.04   78.69   78.69   79.04   79.04   79.04   79.09   79.09   79.38   79.38   79.04   79.04   79.04   79.38   79.38   79.73   79.79   79.04   79.73   79.04   79.04   79.38   79.38   79.38   79.04   79.38   79.73   79.38   79.38   79.38   79.38   79.38   79.73   79.73   79.73   87.29   82.13   84.54

    42: ABV57756.3   79.04   79.73   79.73   79.04   78.69   79.04   78.69   78.69   78.69   78.35   79.04   78.69   78.69   79.04   78.69   78.69   79.04   78.69   79.38   79.04   79.04   78.01   78.01   77.32   92.78   97.25   98.28   98.28   98.28   98.28   98.63   98.63   98.63   97.94   98.28   98.63   98.28   98.28   98.63   98.28   97.94  100.00   98.63   98.63   98.28   98.28   98.63   98.28   97.94   98.28   98.28   98.28   98.28   98.28   98.28   98.63   98.28   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.97   98.97   84.19   84.48   84.14   81.10   81.10   81.10   81.10   80.76   81.79   81.44   81.10   81.44   81.72   82.47   78.35   78.01   78.01   78.35   78.35   79.04   78.35   78.35   78.35   78.35   78.35   78.35   78.69   79.04   78.69   78.69   78.69   77.66   78.35   77.66   78.01   77.66   78.01   78.01   78.12   78.35   78.01   78.01   78.35   78.35   78.35   78.40   78.40   78.69   78.69   78.35   78.35   78.35   78.69   78.69   79.04   79.08   78.35   79.04   78.35   78.35   78.69   78.69   78.69   78.35   78.69   79.04   78.69   78.69   78.69   78.69   78.69   79.04   79.04   79.04   86.94   81.79   84.19

    43: AAV97952.1   79.73   80.41   80.41   79.73   79.38   79.73   79.38   79.38   79.38   79.04   79.73   79.38   79.38   79.73   79.38   79.38   79.73   79.38   80.07   79.73   79.73   78.69   78.35   77.66   93.47   97.94   98.97   98.97   98.97   98.97   99.31   99.31   99.31   98.63   98.97   99.31   98.97   98.97   99.31   98.97   98.63   98.63  100.00   99.31   99.66   98.97   99.31   98.97   98.63   98.97   98.97   98.97   98.97   98.97   98.97   99.31   98.97   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.66   99.66   84.88   85.17   84.83   81.79   81.79   81.79   81.79   81.44   82.47   82.13   81.79   82.13   82.41   83.16   79.04   78.69   78.69   79.04   79.04   79.73   79.04   79.04   79.04   79.04   79.04   79.04   79.38   79.73   79.38   79.38   79.38   78.35   79.04   78.35   78.69   78.35   78.69   78.69   78.82   79.04   78.69   78.69   79.04   79.04   79.04   79.09   79.09   79.38   79.38   79.04   79.04   79.04   79.38   79.38   79.73   79.79   79.04   79.73   79.04   79.04   79.38   79.38   79.38   79.04   79.38   79.73   79.38   79.38   79.38   79.38   79.38   79.73   79.73   79.73   87.63   82.47   84.88

    44: AAV97953.1   80.41   81.10   81.10   80.41   80.07   80.41   80.07   80.07   80.07   79.73   80.41   80.07   80.07   80.41   80.07   80.07   80.41   80.07   80.07   80.41   80.41   79.38   79.04   78.35   93.47   97.94   98.97   98.97   98.97   98.97   99.31   99.31   99.31   98.63   98.97   99.31   98.97   98.97   99.31   98.97   98.63   98.63   99.31  100.00   98.97   99.66   99.31   98.97   98.63   98.97   98.97   98.97   98.97   98.97   98.97   99.31   98.97   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.66   99.66   85.57   85.86   85.52   82.47   82.47   82.47   82.47   82.13   83.16   82.82   82.47   82.82   83.10   83.85   79.38   79.04   79.04   79.38   79.38   80.07   79.38   79.38   79.38   79.38   79.38   79.38   79.73   80.07   79.73   79.73   79.73   78.69   79.38   78.69   79.04   78.69   79.04   79.04   79.17   79.38   79.04   79.04   79.38   79.38   79.38   79.44   79.44   79.73   79.73   79.38   79.38   79.38   79.73   79.73   80.07   80.14   79.38   80.07   79.38   79.38   79.73   79.73   79.73   79.38   79.73   80.07   79.73   79.73   79.73   79.73   79.73   80.07   80.07   80.07   87.97   82.82   85.22

    45: AAV97954.1   79.38   80.07   80.07   79.38   79.04   79.38   79.04   79.04   79.04   78.69   79.38   79.04   79.04   79.38   79.04   79.04   79.38   79.04   79.73   79.38   79.38   78.35   78.01   77.32   93.13   97.59   98.62   98.63   98.63   98.63   98.97   98.97   98.97   98.28   98.63   98.97   98.63   98.63   98.97   98.63   98.28   98.28   99.66   98.97  100.00   99.31   99.66   98.63   98.28   98.63   98.63   98.63   98.63   98.63   98.63   98.97   98.63   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   99.31   99.31   84.54   84.83   84.48   81.44   81.44   81.44   81.44   81.10   82.13   81.79   81.44   81.79   82.07   82.82   78.69   78.35   78.35   78.69   78.69   79.38   78.69   78.69   78.69   78.69   78.69   78.69   79.04   79.38   79.04   79.04   79.04   78.01   78.69   78.01   78.35   78.01   78.35   78.35   78.47   78.69   78.35   78.35   78.69   78.69   78.69   78.75   78.75   79.04   79.04   78.69   78.69   78.69   79.04   79.04   79.38   79.43   78.69   79.38   78.69   78.69   79.04   79.04   79.04   78.69   79.04   79.38   79.04   79.04   79.04   79.04   79.04   79.38   79.38   79.38   87.29   82.13   84.54

    46: AAV97956.1   80.07   80.76   80.76   80.07   79.73   80.07   79.73   79.73   79.73   79.38   80.07   79.73   79.73   80.07   79.73   79.73   80.07   79.73   79.73   80.07   80.07   79.04   78.69   78.01   93.13   97.59   98.62   98.63   98.63   98.63   98.97   98.97   98.97   98.28   98.63   98.97   98.63   98.63   98.97   98.63   98.28   98.28   98.97   99.66   99.31  100.00   99.66   98.63   98.28   98.63   98.63   98.63   98.63   98.63   98.63   98.97   98.63   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   99.31   99.31   85.22   85.52   85.17   82.13   82.13   82.13   82.13   81.79   82.82   82.47   82.13   82.47   82.76   83.51   79.04   78.69   78.69   79.04   79.04   79.73   79.04   79.04   79.04   79.04   79.04   79.04   79.38   79.73   79.38   79.38   79.38   78.35   79.04   78.35   78.69   78.35   78.69   78.69   78.82   79.04   78.69   78.69   79.04   79.04   79.04   79.09   79.09   79.38   79.38   79.04   79.04   79.04   79.38   79.38   79.73   79.79   79.04   79.73   79.04   79.04   79.38   79.38   79.38   79.04   79.38   79.73   79.38   79.38   79.38   79.38   79.38   79.73   79.73   79.73   87.63   82.47   84.88

    47: AAV97955.1   79.73   80.41   80.41   79.73   79.38   79.73   79.38   79.38   79.38   79.04   79.73   79.38   79.38   79.73   79.38   79.38   79.73   79.38   80.07   79.73   79.73   78.69   78.35   77.66   93.47   97.94   98.97   98.97   98.97   98.97   99.31   99.31   99.31   98.63   98.97   99.31   98.97   98.97   99.31   98.97   98.63   98.63   99.31   99.31   99.66   99.66  100.00   98.97   98.63   98.97   98.97   98.97   98.97   98.97   98.97   99.31   98.97   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.66   99.66   84.88   85.17   84.83   81.79   81.79   81.79   81.79   81.44   82.47   82.13   81.79   82.13   82.41   83.16   79.04   78.69   78.69   79.04   79.04   79.73   79.04   79.04   79.04   79.04   79.04   79.04   79.38   79.73   79.38   79.38   79.38   78.35   79.04   78.35   78.69   78.35   78.69   78.69   78.82   79.04   78.69   78.69   79.04   79.04   79.04   79.09   79.09   79.38   79.38   79.04   79.04   79.04   79.38   79.38   79.73   79.79   79.04   79.73   79.04   79.04   79.38   79.38   79.38   79.04   79.38   79.73   79.38   79.38   79.38   79.38   79.38   79.73   79.73   79.73   87.63   82.47   84.88

    48: ADO17948.1   79.38   80.07   80.07   79.38   79.04   79.38   79.04   79.04   79.04   79.38   79.38   79.04   79.04   79.38   79.04   79.04   79.38   79.73   79.73   79.38   79.38   78.35   78.01   77.32   93.81   97.59   98.62   98.63   98.63   98.63   98.97   98.97   98.97   98.97   99.31   98.97   99.31   99.31   99.66   99.31   98.28   98.28   98.97   98.97   98.63   98.63   98.97  100.00   99.66   99.31   98.63   99.31   99.31   99.31   99.31   99.66   99.31   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   99.31   98.97   99.31   99.31   84.54   84.83   84.48   82.13   82.13   82.13   82.82   82.47   82.13   81.79   82.13   82.47   82.07   82.82   79.38   79.04   79.04   79.38   79.38   80.07   79.38   79.38   79.38   79.38   79.38   79.38   79.73   80.07   79.73   79.73   79.73   79.38   78.69   78.69   79.04   78.69   79.04   79.73   79.17   79.38   79.73   79.73   80.07   80.07   80.07   79.44   79.44   79.73   80.41   80.07   79.38   79.38   79.04   79.04   79.38   79.43   78.69   79.38   79.38   79.38   79.73   79.73   79.04   78.69   79.73   79.38   79.04   79.04   79.04   79.04   79.04   79.38   79.38   79.38   87.97   82.82   85.22

    49: ADY02554.1   79.04   79.73   79.73   79.04   78.69   79.04   79.38   79.04   78.69   79.04   79.04   78.69   78.69   79.04   78.69   78.69   79.04   79.38   79.38   79.04   79.04   78.01   77.66   76.98   93.47   97.25   98.28   98.28   98.28   98.28   98.63   98.63   98.63   98.63   98.97   98.63   98.97   98.97   99.31   98.97   97.94   97.94   98.63   98.63   98.28   98.28   98.63   99.66  100.00   99.66   98.28   98.97   98.97   98.97   98.97   99.31   98.97   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.97   98.63   98.97   98.97   84.19   84.48   84.14   81.79   81.79   81.79   82.47   82.13   81.79   81.44   81.79   82.13   81.72   82.47   79.04   78.69   78.69   79.04   79.04   79.73   79.04   79.04   79.04   79.04   79.04   79.04   79.38   79.73   79.38   79.38   79.38   79.04   78.35   78.35   78.69   78.35   78.69   79.38   78.82   79.04   79.38   79.38   79.73   79.73   79.73   79.09   79.09   79.38   80.07   79.73   79.04   79.04   78.69   78.69   79.04   79.08   78.35   79.04   79.04   79.04   79.38   79.38   78.69   78.35   79.38   79.04   78.69   78.69   78.69   78.69   78.69   79.04   79.04   79.04   87.63   82.47   84.88

    50: ADY02546.1   79.38   80.07   80.07   79.38   79.04   79.38   79.73   79.38   79.04   79.38   79.38   79.04   79.04   79.38   79.04   79.04   79.38   79.73   79.73   79.38   79.38   78.35   78.01   77.32   93.81   97.59   98.62   98.63   98.63   98.63   98.97   98.97   98.97   98.28   98.63   98.97   98.63   98.63   98.97   98.63   98.28   98.28   98.97   98.97   98.63   98.63   98.97   99.31   99.66  100.00   98.63   99.31   99.31   99.31   99.31   99.66   99.31   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   99.31   98.97   99.31   99.31   84.54   84.83   84.48   82.13   81.44   81.44   82.13   81.79   82.13   81.79   82.13   82.47   82.07   82.82   79.38   79.04   79.04   79.38   79.38   80.07   79.38   79.38   79.38   79.38   79.38   79.38   79.73   80.07   79.73   79.73   79.73   78.69   78.69   78.01   78.35   78.01   78.35   79.04   79.17   79.38   79.04   79.04   79.38   79.38   79.38   79.44   79.44   79.73   79.73   79.38   78.69   79.38   79.04   79.04   79.38   79.43   78.69   79.38   78.69   78.69   79.04   79.04   79.04   78.69   79.73   79.38   79.04   79.04   79.04   79.04   79.04   79.38   79.38   79.38   87.97   82.82   85.22

    51: AEM44648.1   79.73   80.41   80.41   79.73   79.38   79.73   79.38   79.38   79.38   79.04   79.73   79.38   79.38   79.73   79.38   79.38   79.73   79.38   80.07   79.73   79.73   78.69   78.35   77.66   93.13   97.59   98.97   98.63   98.63   98.63   98.97   98.97   98.97   98.28   98.63   98.97   98.63   98.63   98.97   98.63   98.28   98.28   98.97   98.97   98.63   98.63   98.97   98.63   98.28   98.63  100.00   98.63   98.63   98.63   98.63   98.97   98.63   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   99.31   99.31   84.88   85.17   84.83   81.79   81.79   81.79   81.79   81.44   82.47   82.13   81.79   82.13   82.41   83.16   78.69   78.35   78.35   78.69   78.69   79.38   78.69   78.69   78.69   78.69   78.69   78.69   79.04   79.38   79.04   79.04   79.04   78.01   78.69   78.01   78.35   78.01   78.35   78.35   78.82   78.69   78.35   78.35   78.69   78.69   78.69   79.09   79.09   79.04   79.04   78.69   78.69   78.69   79.04   79.04   79.38   79.79   78.69   79.38   78.69   78.69   79.04   79.04   79.04   78.69   79.04   79.38   79.04   79.04   79.04   79.04   79.04   79.38   79.38   79.38   87.29   82.13   84.54

    52: ADN26580.1   79.38   80.07   80.07   79.38   79.04   79.38   79.04   79.04   79.04   79.38   79.38   79.04   79.04   79.38   79.04   79.04   79.38   79.73   79.73   79.38   79.38   78.35   78.01   77.32   93.81   97.59   98.62   98.63   98.63   98.63   98.97   98.97   98.97   98.28   98.63   98.97   98.63   98.63   98.97   98.63   98.28   98.28   98.97   98.97   98.63   98.63   98.97   99.31   98.97   99.31   98.63  100.00   99.31   99.31   99.31   99.66   99.31   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   99.31   98.97   99.31   99.31   84.54   84.83   84.48   82.13   81.44   81.44   82.13   81.79   82.13   81.79   82.13   82.47   82.07   82.82   79.38   79.04   79.04   79.38   79.38   80.07   79.38   79.38   79.38   79.38   79.38   79.38   79.73   80.07   79.73   79.73   79.73   78.69   78.69   78.01   78.35   78.01   78.35   79.04   79.17   79.38   79.04   79.04   79.38   79.38   79.38   79.44   79.44   79.73   79.73   79.38   78.69   79.38   79.04   79.04   79.38   79.43   78.69   79.38   78.69   78.69   79.04   79.04   79.04   78.69   79.73   79.38   79.04   79.04   79.04   79.04   79.04   79.38   79.38   79.38   87.97   82.82   85.22

    53: AFA51699.1   79.38   80.07   80.07   79.38   79.04   79.38   79.04   79.04   79.04   79.38   79.38   79.04   79.04   79.38   79.04   79.04   79.38   79.73   79.73   79.38   79.38   78.35   78.01   77.32   93.81   97.59   98.62   98.63   98.63   98.63   98.97   98.97   98.97   98.28   98.63   98.97   98.63   98.63   98.97   98.63   98.28   98.28   98.97   98.97   98.63   98.63   98.97   99.31   98.97   99.31   98.63   99.31  100.00   99.31   99.31   99.66   99.31   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   99.31   98.97   99.31   99.31   85.22   84.83   84.48   82.13   81.44   81.44   82.13   81.79   82.13   81.79   82.13   82.47   82.07   82.82   79.38   79.04   79.04   79.38   79.38   80.07   79.38   79.38   79.38   79.38   79.38   79.38   79.73   80.07   79.73   79.73   79.73   78.69   78.69   78.01   78.35   78.01   78.35   79.04   79.17   79.38   79.04   79.04   79.38   79.38   79.38   79.44   79.44   79.73   79.73   79.38   78.69   79.38   79.04   79.04   79.38   79.43   78.69   79.38   78.69   78.69   79.04   79.04   79.04   78.69   79.73   79.38   79.04   79.04   79.04   79.04   79.04   79.38   79.38   79.38   87.97   82.82   85.22

    54: AFJ59956.1   79.38   80.07   80.07   79.38   79.04   79.38   79.04   79.04   79.04   79.38   79.38   79.04   79.04   79.38   79.04   79.04   79.38   79.73   79.73   79.38   79.38   78.35   78.01   77.32   93.81   97.59   98.62   98.63   98.63   98.63   98.97   98.97   98.97   98.28   98.63   98.97   98.63   98.63   98.97   98.63   98.28   98.28   98.97   98.97   98.63   98.63   98.97   99.31   98.97   99.31   98.63   99.31   99.31  100.00   99.31   99.66   99.31   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   99.31   98.97   99.31   99.31   84.54   84.83   84.48   82.13   81.44   81.44   82.13   81.79   82.13   81.79   82.13   82.47   82.07   82.82   79.38   79.04   79.04   79.38   79.38   80.07   79.38   79.38   79.38   79.38   79.38   79.38   79.73   80.07   79.73   79.73   79.73   78.69   78.69   78.01   78.35   78.01   78.35   79.04   79.17   79.38   79.04   79.04   79.38   79.38   79.38   79.44   79.44   79.73   79.73   79.38   78.69   79.38   79.04   79.04   79.38   79.43   78.69   79.38   78.69   78.69   79.04   79.04   79.04   78.69   79.73   79.38   79.04   79.04   79.04   79.04   79.04   79.38   79.38   79.38   87.97   82.82   85.22

    55: BAP18874.1   79.38   80.07   80.07   79.38   79.04   79.38   79.04   79.04   79.04   79.38   79.38   79.04   79.04   79.38   79.04   79.04   79.38   79.73   79.73   79.38   79.38   78.35   78.35   77.32   93.81   97.59   98.62   98.63   98.63   98.63   98.97   98.97   98.97   98.28   98.63   98.97   98.63   98.63   98.97   98.63   98.28   98.28   98.97   98.97   98.63   98.63   98.97   99.31   98.97   99.31   98.63   99.31   99.31   99.31  100.00   99.66   99.31   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   99.31   98.97   99.31   99.31   84.54   84.83   84.48   82.13   81.44   81.44   82.13   81.79   82.13   81.79   82.13   82.47   82.07   82.82   79.38   79.04   79.04   79.38   79.38   80.07   79.38   79.38   79.38   79.38   79.38   79.38   79.73   80.07   79.73   79.73   79.73   78.69   78.69   78.01   78.35   78.01   78.35   79.04   79.17   79.38   79.04   79.04   79.38   79.38   79.38   79.44   79.44   79.73   79.73   79.38   78.69   79.38   79.04   79.04   79.38   79.43   78.69   79.38   78.69   78.69   79.04   79.04   79.04   78.69   79.73   79.38   79.04   79.04   79.04   79.04   79.04   79.38   79.38   79.38   87.97   82.82   85.22

    56: AAO61597.1   79.73   80.41   80.41   79.73   79.38   79.73   79.38   79.38   79.38   79.73   79.73   79.38   79.38   79.73   79.38   79.38   79.73   80.07   80.07   79.73   79.73   78.69   78.35   77.66   94.16   97.94   98.97   98.97   98.97   98.97   99.31   99.31   99.31   98.63   98.97   99.31   98.97   98.97   99.31   98.97   98.63   98.63   99.31   99.31   98.97   98.97   99.31   99.66   99.31   99.66   98.97   99.66   99.66   99.66   99.66  100.00   99.66   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.66   99.31   99.66   99.66   84.88   85.17   84.83   82.47   81.79   81.79   82.47   82.13   82.47   82.13   82.47   82.82   82.41   83.16   79.73   79.38   79.38   79.73   79.73   80.41   79.73   79.73   79.73   79.73   79.73   79.73   80.07   80.41   80.07   80.07   80.07   79.04   79.04   78.35   78.69   78.35   78.69   79.38   79.51   79.73   79.38   79.38   79.73   79.73   79.73   79.79   79.79   80.07   80.07   79.73   79.04   79.73   79.38   79.38   79.73   79.79   79.04   79.73   79.04   79.04   79.38   79.38   79.38   79.04   80.07   79.73   79.38   79.38   79.38   79.38   79.38   79.73   79.73   79.73   88.32   83.16   85.57

    57: AAK32961.1   79.38   80.07   80.07   79.38   79.04   79.38   79.04   79.04   79.04   79.38   79.38   79.04   79.04   79.38   79.04   79.04   79.38   79.73   79.73   79.38   79.38   78.35   78.01   77.32   93.81   97.59   98.62   98.63   98.63   98.63   98.97   98.97   98.97   98.28   98.63   98.97   99.31   98.63   98.97   98.63   98.28   98.28   98.97   98.97   98.63   98.63   98.97   99.31   98.97   99.31   98.63   99.31   99.31   99.31   99.31   99.66  100.00   98.97   99.66   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   99.31   98.97   99.31   99.31   84.54   84.83   84.48   82.13   81.44   81.44   82.13   81.79   82.13   81.79   82.13   82.47   82.07   82.82   79.38   79.04   79.04   79.38   79.38   80.07   79.38   79.38   79.38   79.38   79.38   79.38   79.73   80.07   79.73   79.73   79.73   78.69   78.69   78.01   78.35   78.01   78.35   79.04   79.17   79.38   79.04   79.04   79.38   79.38   79.38   79.44   79.44   79.73   79.73   79.38   78.69   79.38   79.04   79.04   79.38   79.43   78.69   79.38   78.69   78.69   79.04   79.04   79.04   78.69   79.73   79.38   79.04   79.04   79.04   79.04   79.04   79.38   79.38   79.38   87.97   82.82   85.22

    58: AAV70602.1   79.73   80.41   80.41   79.73   79.38   79.73   79.38   79.38   79.38   79.04   79.73   79.38   79.38   79.73   79.38   79.38   79.73   79.38   80.07   79.73   79.73   78.69   78.35   77.66   93.47   97.94   98.97   98.97   98.97   98.97   99.31   99.31   99.31   98.63   98.97   99.31   98.97   98.97   99.31   98.97   98.63   98.63   99.31   99.31   98.97   98.97   99.31   98.97   98.63   98.97   98.97   98.97   98.97   98.97   98.97   99.31   98.97  100.00   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.66   99.66   84.88   85.17   84.83   81.79   81.79   81.79   81.79   81.44   82.47   82.13   81.79   82.13   82.41   83.16   79.04   78.69   78.69   79.04   79.04   79.73   79.04   79.04   79.04   79.04   79.04   79.04   79.38   79.73   79.38   79.38   79.38   78.35   79.04   78.35   78.69   78.35   78.69   78.69   78.82   79.04   78.69   78.69   79.04   79.04   79.04   79.09   79.09   79.38   79.38   79.04   79.04   79.04   79.38   79.38   79.73   79.79   79.04   79.73   79.04   79.04   79.38   79.38   79.38   79.04   79.38   79.73   79.38   79.38   79.38   79.38   79.38   79.73   79.73   79.73   87.63   82.47   84.88

    59: AAF05311.2   79.73   80.41   80.41   79.73   79.38   79.73   79.38   79.38   79.38   79.04   79.73   79.38   79.38   79.73   79.38   79.38   79.73   79.38   80.07   79.73   79.73   78.69   78.35   77.66   93.47   97.94   98.97   98.97   98.97   98.97   99.31   99.31   99.31   98.63   98.97   99.31   99.66   98.97   99.31   98.97   98.63   98.63   99.31   99.31   98.97   98.97   99.31   98.97   98.63   98.97   98.97   98.97   98.97   98.97   98.97   99.31   99.66   99.31  100.00   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.66   99.66   84.88   85.17   84.83   81.79   81.79   81.79   81.79   81.44   82.47   82.13   81.79   82.13   82.41   83.16   79.04   78.69   78.69   79.04   79.04   79.73   79.04   79.04   79.04   79.04   79.04   79.04   79.38   79.73   79.38   79.38   79.38   78.35   79.04   78.35   78.69   78.35   78.69   78.69   78.82   79.04   78.69   78.69   79.04   79.04   79.04   79.09   79.09   79.38   79.38   79.04   79.04   79.04   79.38   79.38   79.73   79.79   79.04   79.73   79.04   79.04   79.38   79.38   79.38   79.04   79.38   79.73   79.38   79.38   79.38   79.38   79.38   79.73   79.73   79.73   87.63   82.47   84.88

    60: AAK71471.1   80.07   80.76   80.76   80.07   79.73   80.07   79.73   79.73   79.73   79.38   80.07   79.73   79.73   80.07   79.73   79.73   80.07   79.73   80.41   80.07   80.07   79.04   78.69   78.01   93.81   97.94   98.97   98.97   98.97   98.97   99.31   99.31   99.31   98.63   98.97   99.31   98.97   98.97   99.31   98.97   98.63   98.63   99.31   99.31   98.97   98.97   99.31   98.97   98.63   98.97   98.97   98.97   98.97   98.97   98.97   99.31   98.97   99.31   99.31  100.00   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.66   99.66   85.22   85.52   85.17   82.13   82.13   82.13   82.13   81.79   82.82   82.47   82.13   82.47   82.76   83.51   79.38   79.04   79.04   79.38   79.38   80.07   79.38   79.38   79.38   79.38   79.38   79.38   79.73   80.07   79.73   79.73   79.73   78.69   79.38   78.69   79.04   78.69   79.04   79.04   79.51   79.38   79.04   79.04   79.38   79.38   79.38   79.44   79.44   79.73   79.73   79.38   79.38   79.38   79.73   79.73   80.07   80.14   79.38   80.07   79.38   79.38   79.73   79.73   79.73   79.38   79.73   80.07   79.73   79.73   79.73   79.73   79.73   80.07   80.07   80.07   87.97   82.82   85.22

    61: ABS90365.1   79.73   80.41   80.41   79.73   79.38   79.73   79.38   79.38   79.38   79.04   79.73   79.38   79.38   79.73   79.38   79.38   79.73   79.38   80.07   79.73   79.73   78.69   78.35   77.66   93.47   97.94   98.97   98.97   98.97   98.97   99.31   99.31   99.31   98.63   98.97   99.31   98.97   98.97   99.31   98.97   98.63   98.63   99.31   99.31   98.97   98.97   99.31   98.97   98.63   98.97   98.97   98.97   98.97   98.97   98.97   99.31   98.97   99.31   99.31   99.31  100.00   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.66   99.66   84.88   85.17   84.83   81.79   81.79   81.79   81.79   81.44   82.47   82.13   81.79   82.13   82.41   83.16   79.04   78.69   78.69   79.73   79.04   79.73   79.04   79.04   79.04   79.04   79.04   79.04   79.38   79.73   79.38   79.38   79.38   78.35   79.04   78.35   78.69   78.35   78.69   78.69   78.82   79.04   78.69   78.69   79.04   79.04   79.04   79.09   79.09   79.38   79.38   79.04   79.04   79.04   79.38   79.38   79.73   79.79   79.04   79.73   79.04   79.04   79.38   79.38   79.38   79.04   79.38   79.73   79.38   79.38   79.38   79.38   79.38   79.73   79.73   79.73   87.63   82.47   84.88

    62: ACI29345.1   79.73   80.41   80.41   79.73   79.38   79.73   79.38   79.38   79.38   79.04   79.73   79.38   79.38   79.73   79.38   79.38   79.73   79.38   80.07   79.73   79.73   78.69   78.35   77.66   93.47   97.94   98.97   98.97   98.97   98.97   99.31   99.31   99.31   98.63   98.97   99.31   98.97   98.97   99.31   98.97   98.63   98.63   99.31   99.31   98.97   98.97   99.31   98.97   98.63   98.97   98.97   98.97   98.97   98.97   98.97   99.31   98.97   99.31   99.31   99.31   99.31  100.00   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.66   99.66   84.88   85.17   84.83   81.79   81.79   81.79   81.79   81.44   82.47   82.13   81.79   82.13   82.41   83.16   79.04   78.69   78.69   79.04   79.04   79.73   79.04   79.04   79.04   79.04   79.04   79.04   79.38   79.73   79.38   79.38   79.38   78.35   79.04   78.35   78.69   78.35   78.69   78.69   79.17   79.04   78.69   78.69   79.04   79.04   79.04   79.09   79.09   79.38   79.38   79.04   79.04   79.04   79.38   79.38   79.73   79.79   79.04   79.73   79.04   79.04   79.38   79.38   79.38   79.04   79.38   79.73   79.38   79.38   79.38   79.38   79.38   79.73   79.73   79.73   87.63   82.47   84.88

    63: ACI29346.1   79.73   80.41   80.41   79.73   79.38   79.73   79.38   79.38   79.38   79.04   79.73   79.38   79.38   79.73   79.38   79.38   79.73   79.38   80.07   79.73   79.73   78.69   78.35   77.66   93.47   97.94   98.97   98.97   98.97   98.97   99.31   99.31   99.31   98.63   98.97   99.31   98.97   98.97   99.31   98.97   98.63   98.63   99.31   99.31   98.97   98.97   99.31   98.97   98.63   98.97   98.97   98.97   98.97   98.97   98.97   99.31   98.97   99.31   99.31   99.31   99.31   99.31  100.00   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.66   99.66   84.88   85.17   84.83   82.13   82.13   82.13   82.13   81.79   82.82   82.47   82.13   82.47   82.76   83.16   79.04   78.69   78.69   79.04   79.04   79.73   79.04   79.04   79.04   79.04   79.04   79.04   79.38   79.73   79.38   79.38   79.38   78.35   79.04   78.35   78.69   78.35   78.69   78.69   78.82   79.04   78.69   78.69   79.04   79.04   79.04   79.09   79.09   79.38   79.38   79.04   79.04   79.04   79.38   79.38   79.73   79.79   79.04   79.73   79.04   79.04   79.38   79.38   79.38   79.04   79.38   79.73   79.38   79.38   79.38   79.38   79.38   79.73   79.73   79.73   87.63   82.47   84.88

    64: ACI29347.1   79.73   80.41   80.41   79.73   79.38   79.73   79.38   79.38   79.38   79.04   79.73   79.38   79.38   79.73   79.38   79.38   79.73   79.38   80.07   79.73   79.73   78.69   78.35   77.66   93.47   97.94   98.97   98.97   98.97   98.97   99.31   99.31   99.31   98.63   98.97   99.31   98.97   98.97   99.31   98.97   98.63   98.63   99.31   99.31   98.97   98.97   99.31   98.97   98.63   98.97   98.97   98.97   98.97   98.97   98.97   99.31   98.97   99.31   99.31   99.31   99.31   99.31   99.31  100.00   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.66   99.66   84.88   85.17   84.83   82.13   82.13   82.13   82.13   81.79   82.82   82.47   82.13   82.13   82.41   83.16   79.04   78.69   78.69   79.04   79.04   79.73   79.04   79.04   79.04   79.04   79.04   79.04   79.38   79.73   79.38   79.38   79.38   78.35   79.04   78.35   78.69   78.35   78.69   78.69   78.82   79.04   78.69   78.69   79.04   79.04   79.04   79.09   79.09   79.38   79.38   79.04   79.04   79.04   79.38   79.38   79.73   80.50   79.04   79.73   79.04   79.04   79.38   79.38   79.38   79.04   79.38   79.73   79.38   79.38   79.38   79.38   79.38   79.73   79.73   79.73   87.63   82.47   84.88

    65: ACI29348.1   79.73   80.41   80.41   79.73   79.38   79.73   79.38   79.38   79.38   79.04   79.73   79.38   79.38   79.73   79.38   79.38   79.73   79.38   80.07   79.73   79.73   78.69   78.35   77.66   93.47   97.94   98.97   98.97   98.97   98.97   99.31   99.31   99.31   98.63   98.97   99.31   98.97   98.97   99.31   98.97   98.63   98.63   99.31   99.31   98.97   98.97   99.31   98.97   98.63   98.97   98.97   98.97   98.97   98.97   98.97   99.31   98.97   99.31   99.31   99.31   99.31   99.31   99.31   99.31  100.00   99.31   99.31   99.31   99.31   99.31   99.31   99.66   99.66   84.88   85.17   84.83   81.79   81.79   81.79   81.79   81.44   82.47   82.13   81.79   82.13   82.41   83.16   79.04   78.69   78.69   79.04   79.04   79.73   79.04   79.04   79.04   79.04   79.04   79.04   79.38   79.73   79.38   79.38   79.38   78.35   79.04   78.35   78.69   78.35   78.69   78.69   78.82   79.04   78.69   78.69   79.04   79.04   79.04   79.09   79.09   79.38   79.38   79.04   79.04   79.04   79.38   79.38   79.73   79.79   79.04   79.73   79.04   79.04   79.38   79.38   79.38   79.04   79.38   79.73   79.38   79.38   79.38   79.38   79.38   79.73   79.73   79.73   87.63   82.47   84.88

    66: AEM44649.1   79.73   80.41   80.41   79.73   79.38   79.73   79.38   79.38   79.38   79.04   79.73   79.38   79.38   79.73   79.38   79.38   79.73   79.38   80.07   79.73   79.73   78.69   78.35   77.66   93.47   97.94   98.97   98.97   98.97   98.97   99.31   99.31   99.31   98.63   98.97   99.31   98.97   98.97   99.31   98.97   98.63   98.63   99.31   99.31   98.97   98.97   99.31   98.97   98.63   98.97   98.97   98.97   98.97   98.97   98.97   99.31   98.97   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31  100.00   99.31   99.31   99.31   99.31   99.31   99.66   99.66   84.88   85.17   84.83   81.79   81.79   81.79   81.79   81.44   82.47   82.13   81.79   82.13   82.41   83.16   79.04   78.69   78.69   79.04   79.04   79.73   79.04   79.04   79.04   79.04   79.04   79.04   79.38   79.73   79.38   79.38   79.38   78.35   79.04   78.35   78.69   78.35   78.69   78.69   78.82   79.04   78.69   78.69   79.04   79.04   79.04   79.09   79.09   79.38   79.38   79.04   79.04   79.04   79.38   79.38   79.73   79.79   79.04   79.73   79.04   79.04   79.38   79.38   79.38   79.04   79.38   79.73   79.38   79.38   79.38   79.38   79.38   79.73   79.73   79.73   87.63   82.47   84.88

    67: AEM44652.1   80.41   81.10   81.10   80.41   80.07   80.41   80.07   80.07   80.07   79.73   80.41   80.07   80.07   80.41   80.07   80.07   80.41   80.07   80.76   80.41   80.41   79.38   79.04   78.35   93.47   97.94   98.97   98.97   98.97   98.97   99.31   99.31   99.31   98.63   98.97   99.31   98.97   98.97   99.31   98.97   98.63   98.63   99.31   99.31   98.97   98.97   99.31   98.97   98.63   98.97   98.97   98.97   98.97   98.97   98.97   99.31   98.97   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31  100.00   99.31   99.31   99.31   99.31   99.66   99.66   84.88   85.17   84.83   82.13   81.79   81.79   81.79   81.44   82.47   82.13   81.79   82.13   82.41   83.16   79.04   78.69   78.69   79.04   79.04   79.73   79.04   79.04   79.38   79.04   79.04   79.04   79.38   79.73   79.38   79.38   79.38   78.35   79.04   78.35   78.69   78.35   78.69   78.69   78.82   79.04   78.69   78.69   79.04   79.04   79.04   79.09   79.09   79.38   79.38   79.04   79.04   79.04   79.38   79.38   79.73   79.79   79.04   79.73   79.04   79.04   79.38   79.38   79.38   79.04   79.38   79.73   79.38   79.38   79.38   79.38   79.38   79.73   79.73   79.73   87.63   82.47   84.88

    68: AEM44653.1   79.73   80.41   80.41   79.73   79.38   79.73   79.38   79.38   79.38   79.04   79.73   79.38   79.38   79.73   79.38   79.38   79.73   79.38   80.07   79.73   79.73   78.69   78.35   77.66   93.47   97.94   98.97   98.97   98.97   98.97   99.31   99.31   99.31   98.63   98.97   99.31   98.97   98.97   99.31   98.97   98.63   98.63   99.31   99.31   98.97   98.97   99.31   98.97   98.63   98.97   98.97   98.97   98.97   98.97   98.97   99.31   98.97   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31  100.00   99.31   99.31   99.31   99.66   99.66   84.88   85.17   84.83   81.79   81.79   81.79   81.79   81.44   82.47   82.13   81.79   82.13   82.41   83.16   79.38   79.04   79.04   79.38   79.38   80.07   79.38   79.38   79.38   79.38   79.38   79.38   79.73   80.07   79.73   79.73   79.73   78.69   79.38   78.69   79.04   78.69   79.04   79.04   79.17   79.38   79.04   79.04   79.38   79.38   79.38   79.44   79.44   79.73   79.73   79.38   79.38   79.38   79.73   79.73   80.07   80.14   79.38   80.07   79.38   79.38   79.73   79.73   79.73   79.38   79.73   80.07   79.73   79.73   79.73   79.73   79.73   80.07   80.07   80.07   87.63   82.82   85.22

    69: BAL72196.1   79.73   80.41   80.41   79.73   79.38   79.73   79.38   79.38   79.38   79.04   79.73   79.38   79.38   79.73   79.73   79.38   79.73   79.38   80.07   79.73   79.73   78.69   78.35   77.66   93.47   97.94   98.97   99.31   98.97   98.97   99.31   99.31   99.31   98.63   98.97   99.66   98.97   99.31   99.31   99.31   98.63   98.63   99.31   99.31   98.97   98.97   99.31   98.97   98.63   98.97   98.97   98.97   98.97   98.97   98.97   99.31   98.97   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31  100.00   99.31   99.31   99.66   99.66   84.88   85.17   84.83   81.79   81.79   81.79   81.79   81.44   82.47   82.13   81.79   82.13   82.41   83.16   79.04   78.69   78.69   79.04   79.04   79.73   79.04   79.04   79.04   79.04   79.04   79.04   79.38   79.73   79.38   79.38   79.38   78.35   79.04   78.69   78.69   78.35   78.69   78.69   78.82   79.04   78.69   78.69   79.04   79.04   79.04   79.09   79.09   79.38   79.38   79.04   79.04   79.04   79.38   79.38   79.73   79.79   79.04   79.73   79.38   79.38   79.38   79.38   79.38   79.04   79.38   79.73   79.73   79.73   79.38   79.73   79.38   79.73   79.73   79.73   87.63   82.47   84.88

    70: AFX60298.1   79.73   80.41   80.41   79.73   79.38   79.73   79.38   79.38   79.38   79.38   79.73   79.38   79.38   79.73   79.38   79.38   79.73   79.73   80.07   79.73   79.73   78.69   78.35   77.66   93.81   97.94   98.97   98.97   98.97   98.97   99.31   99.31   99.31   98.63   98.97   99.31   98.97   98.97   99.31   98.97   98.63   98.63   99.31   99.31   98.97   98.97   99.31   99.31   98.97   99.31   98.97   99.31   99.31   99.31   99.31   99.66   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31  100.00   99.31   99.66   99.66   84.88   85.17   84.83   82.13   81.79   81.79   82.13   81.79   82.47   82.13   82.13   82.47   82.41   83.16   79.38   79.04   79.04   79.38   79.38   80.07   79.38   79.38   79.38   79.38   79.38   79.38   79.73   80.07   79.73   79.73   79.73   78.69   79.04   78.35   78.69   78.35   78.69   79.04   79.17   79.38   79.04   79.04   79.38   79.38   79.38   79.44   79.44   79.73   79.73   79.38   79.04   79.38   79.38   79.38   79.73   79.79   79.04   79.73   79.04   79.04   79.38   79.38   79.38   79.04   79.73   79.73   79.38   79.38   79.38   79.38   79.38   79.73   79.73   79.73   87.97   82.82   85.22

    71: AJU57235.1   80.07   80.76   80.76   80.07   79.73   80.07   79.73   79.73   79.73   79.38   80.07   79.73   79.73   80.07   79.73   79.73   80.07   79.73   80.41   80.07   80.07   79.04   78.69   78.01   93.47   97.94   98.97   98.97   98.97   98.97   99.31   99.31   99.31   98.63   98.97   99.31   98.97   98.97   99.31   98.97   98.63   98.63   99.31   99.31   98.97   98.97   99.31   98.97   98.63   98.97   98.97   98.97   98.97   98.97   98.97   99.31   98.97   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31  100.00   99.66   99.66   85.22   85.52   85.17   82.13   82.13   82.13   82.13   81.79   82.82   82.47   82.13   82.47   82.41   83.16   79.38   79.04   79.04   79.38   79.38   80.07   79.38   79.38   79.38   79.38   79.38   79.38   79.73   80.07   79.73   79.73   79.73   78.69   79.38   78.69   79.04   78.69   79.04   79.04   79.17   79.38   79.04   79.04   79.38   79.38   79.38   79.44   79.44   79.73   79.73   79.38   79.38   79.38   79.73   79.73   80.07   80.14   79.38   80.07   79.38   79.38   79.73   79.73   79.73   79.38   79.73   80.07   79.73   79.73   79.73   79.73   79.73   80.07   80.07   80.07   87.63   82.47   84.88

    72: AAF72530.1   80.07   80.76   80.76   80.07   79.73   80.07   79.73   79.73   79.73   79.38   80.07   79.73   79.73   80.07   79.73   79.73   80.07   79.73   80.41   80.07   80.07   79.04   78.69   78.01   93.81   98.28   99.31   99.31   99.31   99.31   99.66   99.66   99.66   98.97   99.31   99.66   99.31   99.31   99.66   99.31   98.97   98.97   99.66   99.66   99.31   99.31   99.66   99.31   98.97   99.31   99.31   99.31   99.31   99.31   99.31   99.66   99.31   99.66   99.66   99.66   99.66   99.66   99.66   99.66   99.66   99.66   99.66   99.66   99.66   99.66   99.66  100.00  100.00   85.22   85.52   85.17   82.13   82.13   82.13   82.13   81.79   82.82   82.47   82.13   82.47   82.76   83.51   79.38   79.04   79.04   79.38   79.38   80.07   79.38   79.38   79.38   79.38   79.38   79.38   79.73   80.07   79.73   79.73   79.73   78.69   79.38   78.69   79.04   78.69   79.04   79.04   79.17   79.38   79.04   79.04   79.38   79.38   79.38   79.44   79.44   79.73   79.73   79.38   79.38   79.38   79.73   79.73   80.07   80.14   79.38   80.07   79.38   79.38   79.73   79.73   79.73   79.38   79.73   80.07   79.73   79.73   79.73   79.73   79.73   80.07   80.07   80.07   87.97   82.82   85.22

    73: AAK55533.1   80.07   80.76   80.76   80.07   79.73   80.07   79.73   79.73   79.73   79.38   80.07   79.73   79.73   80.07   79.73   79.73   80.07   79.73   80.41   80.07   80.07   79.04   78.69   78.01   93.81   98.28   99.31   99.31   99.31   99.31   99.66   99.66   99.66   98.97   99.31   99.66   99.31   99.31   99.66   99.31   98.97   98.97   99.66   99.66   99.31   99.31   99.66   99.31   98.97   99.31   99.31   99.31   99.31   99.31   99.31   99.66   99.31   99.66   99.66   99.66   99.66   99.66   99.66   99.66   99.66   99.66   99.66   99.66   99.66   99.66   99.66  100.00  100.00   85.22   85.52   85.17   82.13   82.13   82.13   82.13   81.79   82.82   82.47   82.13   82.47   82.76   83.51   79.38   79.04   79.04   79.38   79.38   80.07   79.38   79.38   79.38   79.38   79.38   79.38   79.73   80.07   79.73   79.73   79.73   78.69   79.38   78.69   79.04   78.69   79.04   79.04   79.17   79.38   79.04   79.04   79.38   79.38   79.38   79.44   79.44   79.73   79.73   79.38   79.38   79.38   79.73   79.73   80.07   80.14   79.38   80.07   79.38   79.38   79.73   79.73   79.73   79.38   79.73   80.07   79.73   79.73   79.73   79.73   79.73   80.07   80.07   80.07   87.97   82.82   85.22

    74: AAF04388.1   83.85   83.51   83.16   83.85   83.51   83.85   83.51   83.51   83.51   83.16   83.85   83.51   83.51   83.85   83.51   84.19   83.85   83.51   83.51   83.85   83.85   82.82   82.13   81.44   85.91   84.19   84.83   84.54   84.54   84.54   84.88   84.88   84.88   84.19   84.54   84.88   84.54   84.54   84.88   84.54   84.19   84.19   84.88   85.57   84.54   85.22   84.88   84.54   84.19   84.54   84.88   84.54   85.22   84.54   84.54   84.88   84.54   84.88   84.88   85.22   84.88   84.88   84.88   84.88   84.88   84.88   84.88   84.88   84.88   84.88   85.22   85.22   85.22  100.00   98.62   98.28   89.69   90.38   90.38   89.69   90.03   90.38   90.72   90.38   90.72   91.03   91.75   80.76   80.41   80.41   80.76   80.76   80.76   80.76   80.76   80.76   80.76   80.76   80.76   80.76   80.76   81.10   81.10   81.10   79.73   80.41   79.73   80.41   79.73   80.07   80.41   80.56   80.41   80.41   80.41   80.76   80.76   80.76   80.84   80.84   80.76   80.07   80.41   80.76   80.76   81.10   81.10   81.44   80.50   80.76   81.10   80.76   80.41   81.10   80.76   81.10   81.10   81.10   81.44   81.10   81.10   81.10   81.10   81.10   81.44   81.44   81.44   83.85   82.82   82.82

    75: AAV28215.2   83.79   83.45   83.10   83.79   83.45   83.79   83.45   83.45   83.45   83.10   83.79   83.45   83.45   83.79   83.45   84.14   83.79   83.45   83.45   83.79   83.79   82.76   82.07   81.38   85.86   84.48   85.12   84.83   84.83   84.83   85.17   85.17   85.17   84.48   84.83   85.17   84.83   84.83   85.17   84.83   84.48   84.48   85.17   85.86   84.83   85.52   85.17   84.83   84.48   84.83   85.17   84.83   84.83   84.83   84.83   85.17   84.83   85.17   85.17   85.52   85.17   85.17   85.17   85.17   85.17   85.17   85.17   85.17   85.17   85.17   85.52   85.52   85.52   98.62  100.00   99.66   90.00   90.69   90.69   90.00   90.34   90.69   91.03   90.69   91.03   91.38   92.07   81.03   80.69   80.69   81.03   81.03   81.03   81.03   81.03   81.03   81.03   81.03   81.03   81.03   81.03   81.38   81.03   81.38   80.00   80.69   80.00   80.69   80.00   80.34   80.69   80.90   80.69   80.69   80.69   81.03   81.03   81.03   81.18   81.18   81.03   80.34   80.69   80.69   80.69   81.03   81.38   81.72   80.78   81.03   81.38   81.03   80.69   81.38   81.03   81.38   81.72   81.38   81.72   81.38   81.38   81.38   81.38   81.38   81.72   81.72   81.72   84.14   83.10   83.45

    76: BAD90119.1   83.45   83.10   82.76   83.45   83.10   83.45   83.10   83.10   83.10   83.10   83.45   83.79   83.45   83.45   83.10   83.79   83.45   83.10   83.10   83.45   83.45   82.41   81.72   81.03   85.52   84.14   84.78   84.83   84.83   84.83   85.17   85.52   85.17   84.48   84.83   84.83   84.48   84.48   84.83   84.48   84.14   84.14   84.83   85.52   84.48   85.17   84.83   84.48   84.14   84.48   84.83   84.48   84.48   84.48   84.48   84.83   84.48   84.83   84.83   85.17   84.83   84.83   84.83   84.83   84.83   84.83   84.83   84.83   84.83   84.83   85.17   85.17   85.17   98.28   99.66  100.00   89.66   90.34   90.34   89.66   90.00   90.34   90.69   90.34   90.69   91.03   91.72   80.69   80.34   80.34   80.69   80.69   80.69   80.69   80.69   80.69   80.69   80.69   80.69   80.69   80.69   81.03   80.69   81.03   79.66   80.34   79.66   80.34   79.66   80.00   80.34   80.56   80.34   80.34   80.34   80.69   80.69   80.69   80.84   80.84   80.69   80.00   80.34   80.34   80.34   80.69   81.03   81.38   80.43   80.69   81.03   80.69   80.34   81.03   80.69   81.03   81.38   81.03   81.38   81.03   81.03   81.03   81.03   81.03   81.38   81.38   81.38   83.79   82.76   83.10

    77: AAY43008.1   83.16   82.82   82.47   83.16   82.82   83.16   82.82   82.82   82.82   83.16   83.16   82.82   82.82   83.16   82.82   83.51   82.82   83.51   82.82   82.82   83.16   82.13   81.44   80.76   83.51   81.10   81.72   81.44   81.79   81.44   81.79   81.79   81.79   81.10   81.44   81.79   81.44   81.44   81.79   81.44   81.44   81.10   81.79   82.47   81.44   82.13   81.79   82.13   81.79   82.13   81.79   82.13   82.13   82.13   82.13   82.47   82.13   81.79   81.79   82.13   81.79   81.79   82.13   82.13   81.79   81.79   82.13   81.79   81.79   82.13   82.13   82.13   82.13   89.69   90.00   89.66  100.00   98.28   98.63   99.31   98.97   98.63   98.97   99.31   98.97   96.21   95.19   81.79   81.44   81.44   81.79   81.79   81.79   81.79   81.79   82.47   81.79   82.13   81.79   81.79   81.79   81.79   82.13   82.13   80.76   80.76   80.07   80.76   80.07   80.41   81.44   81.60   81.44   81.44   81.44   81.79   81.79   81.79   81.88   81.88   81.79   81.10   81.44   81.10   81.79   81.44   81.44   81.79   81.56   81.44   81.44   81.10   80.76   81.44   81.10   81.44   82.13   81.79   81.44   81.44   81.44   81.44   81.44   81.44   81.79   81.79   81.79   83.85   83.51   82.82

    78: ACX34099.1   82.82   82.47   82.13   82.82   82.47   82.82   82.47   82.47   82.47   82.13   82.82   82.47   82.47   82.82   82.47   83.16   82.47   82.47   82.47   82.47   82.82   81.79   81.10   80.41   82.82   81.10   81.72   81.44   81.79   81.44   81.79   81.79   81.79   81.79   82.13   81.79   82.13   82.13   82.47   82.13   81.44   81.10   81.79   82.47   81.44   82.13   81.79   82.13   81.79   81.44   81.79   81.44   81.44   81.44   81.44   81.79   81.44   81.79   81.79   82.13   81.79   81.79   82.13   82.13   81.79   81.79   81.79   81.79   81.79   81.79   82.13   82.13   82.13   90.38   90.69   90.34   98.28  100.00   99.66   98.97   99.31   98.97   99.31   98.97   98.63   96.55   95.88   81.10   80.76   80.76   81.10   81.10   81.10   81.10   81.10   81.10   81.10   81.44   81.10   81.10   81.10   81.10   81.44   81.44   80.76   80.76   80.76   81.44   80.76   81.10   81.44   80.90   80.76   81.44   81.44   81.79   81.79   81.79   81.18   81.18   81.10   81.10   81.44   81.79   81.10   81.44   81.44   81.79   81.56   81.44   81.44   81.79   81.44   82.13   81.79   81.44   82.13   81.10   81.44   81.44   81.44   81.44   81.44   81.44   81.79   81.79   81.79   83.16   82.82   82.13

    79: ACR56321.1   82.82   82.47   82.13   82.82   82.47   82.82   82.47   82.47   82.47   82.13   82.82   82.47   82.47   82.82   82.47   83.16   82.47   82.47   82.47   82.47   82.82   81.79   81.10   80.41   82.82   81.10   81.72   81.44   81.79   81.44   81.79   81.79   81.79   81.79   82.13   81.79   82.13   82.13   82.47   82.13   81.44   81.10   81.79   82.47   81.44   82.13   81.79   82.13   81.79   81.44   81.79   81.44   81.44   81.44   81.44   81.79   81.44   81.79   81.79   82.13   81.79   81.79   82.13   82.13   81.79   81.79   81.79   81.79   81.79   81.79   82.13   82.13   82.13   90.38   90.69   90.34   98.63   99.66  100.00   99.31   99.66   99.31   99.66   99.31   98.97   96.90   95.88   81.10   80.76   80.76   81.10   81.10   81.10   81.10   81.10   81.10   81.10   81.44   81.10   81.10   81.10   81.10   81.44   81.44   80.76   80.76   80.76   81.44   80.76   81.10   81.44   80.90   80.76   81.44   81.44   81.79   81.79   81.79   81.18   81.18   81.10   81.10   81.44   81.79   81.10   81.44   81.44   81.79   81.56   81.44   81.44   81.79   81.44   82.13   81.79   81.44   82.13   81.10   81.44   81.44   81.44   81.44   81.44   81.44   81.79   81.79   81.79   83.16   82.82   82.13

    80: AJO16046.1   82.82   82.47   82.13   82.82   82.47   82.82   82.47   82.47   82.47   82.82   82.82   82.47   82.47   82.82   82.47   83.16   82.47   83.16   82.47   82.47   82.82   81.79   81.10   80.41   83.51   81.10   81.72   81.44   81.79   81.44   81.79   81.79   81.79   81.79   82.13   81.79   82.13   82.13   82.47   82.13   81.44   81.10   81.79   82.47   81.44   82.13   81.79   82.82   82.47   82.13   81.79   82.13   82.13   82.13   82.13   82.47   82.13   81.79   81.79   82.13   81.79   81.79   82.13   82.13   81.79   81.79   81.79   81.79   81.79   82.13   82.13   82.13   82.13   89.69   90.00   89.66   99.31   98.97   99.31  100.00   99.66   98.63   98.97   99.31   98.97   96.21   95.19   81.79   81.44   81.44   81.79   81.79   81.79   81.79   81.79   81.79   81.79   82.13   81.79   81.79   81.79   81.79   82.13   82.13   81.44   80.76   80.76   81.44   80.76   81.10   82.13   81.60   81.44   82.13   82.13   82.47   82.47   82.47   81.88   81.88   81.79   81.79   82.13   81.79   81.79   81.44   81.44   81.79   81.56   81.44   81.44   81.79   81.44   82.13   81.79   81.44   82.13   81.79   81.44   81.44   81.44   81.44   81.44   81.44   81.79   81.79   81.79   83.85   83.51   82.82

    81: AAM70498.1   82.47   82.13   81.79   82.47   82.13   82.47   82.13   82.13   82.13   82.47   82.47   82.13   82.13   82.47   82.13   82.82   82.13   82.82   82.13   82.13   82.47   81.44   80.76   80.07   83.16   80.76   81.38   81.10   81.44   81.10   81.44   81.44   81.44   81.44   81.79   81.44   81.79   81.79   82.13   81.79   81.10   80.76   81.44   82.13   81.10   81.79   81.44   82.47   82.13   81.79   81.44   81.79   81.79   81.79   81.79   82.13   81.79   81.44   81.44   81.79   81.44   81.44   81.79   81.79   81.44   81.44   81.44   81.44   81.44   81.79   81.79   81.79   81.79   90.03   90.34   90.00   98.97   99.31   99.66   99.66  100.00   98.97   99.31   99.66   99.31   96.55   95.53   81.44   81.10   81.10   81.44   81.44   81.44   81.44   81.44   81.44   81.44   81.79   81.44   81.44   81.44   81.44   81.79   81.79   81.10   80.41   80.41   81.10   80.41   80.76   81.79   81.25   81.10   81.79   81.79   82.13   82.13   82.13   81.53   81.53   81.44   81.44   81.79   81.44   81.44   81.10   81.10   81.44   81.21   81.10   81.10   81.44   81.10   81.79   81.44   81.10   81.79   81.44   81.10   81.10   81.10   81.10   81.10   81.10   81.44   81.44   81.44   83.51   83.16   82.47

    82: AAN75444.1   82.82   83.16   82.82   82.82   83.16   83.51   83.16   83.16   83.16   82.82   83.51   83.16   83.16   83.51   83.16   83.85   83.16   83.16   83.16   83.16   83.51   82.47   81.79   81.10   82.82   81.79   82.41   82.13   82.47   82.13   82.47   82.47   82.47   81.79   82.13   82.47   82.13   82.13   82.47   82.13   82.13   81.79   82.47   83.16   82.13   82.82   82.47   82.13   81.79   82.13   82.47   82.13   82.13   82.13   82.13   82.47   82.13   82.47   82.47   82.82   82.47   82.47   82.82   82.82   82.47   82.47   82.47   82.47   82.47   82.47   82.82   82.82   82.82   90.38   90.69   90.34   98.63   98.97   99.31   98.63   98.97  100.00   99.66   99.31   98.97   96.90   95.88   81.10   80.76   80.76   81.10   81.10   81.10   81.10   81.10   81.10   81.10   81.44   81.10   81.10   81.10   81.10   81.44   81.44   80.07   80.76   80.07   80.76   80.07   80.41   80.76   80.90   80.76   80.76   80.76   81.10   81.10   81.10   81.18   81.18   81.10   80.41   80.76   81.10   81.10   81.44   81.44   81.79   81.56   81.44   81.44   81.10   80.76   81.44   81.10   81.44   82.13   81.10   81.44   81.44   81.44   81.44   81.44   81.44   81.79   81.79   81.79   83.85   82.82   82.82

    83: AAX54694.1   83.16   82.82   82.47   83.16   82.82   83.16   82.82   82.82   82.82   82.47   83.16   82.82   82.82   83.16   82.82   83.51   82.82   82.82   82.82   82.82   83.16   82.13   81.44   80.76   83.16   81.44   82.07   81.79   82.13   81.79   82.13   82.13   82.13   81.44   81.79   82.13   81.79   81.79   82.13   81.79   81.79   81.44   82.13   82.82   81.79   82.47   82.13   81.79   81.44   81.79   82.13   81.79   81.79   81.79   81.79   82.13   81.79   82.13   82.13   82.47   82.13   82.13   82.47   82.47   82.13   82.13   82.13   82.13   82.13   82.13   82.47   82.47   82.47   90.72   91.03   90.69   98.97   99.31   99.66   98.97   99.31   99.66  100.00   99.66   99.31   97.24   96.22   81.44   81.10   81.10   81.44   81.44   81.44   81.44   81.44   81.44   81.44   81.79   81.44   81.44   81.44   81.44   81.79   81.79   80.41   81.10   80.41   81.10   80.41   80.76   81.10   81.25   81.10   81.10   81.10   81.44   81.44   81.44   81.53   81.53   81.44   80.76   81.10   81.44   81.44   81.79   81.79   82.13   81.91   81.79   81.79   81.44   81.10   81.79   81.44   81.79   82.47   81.44   81.79   81.79   81.79   81.79   81.79   81.79   82.13   82.13   82.13   83.51   83.16   82.47

    84: CBW46935.1   82.82   82.47   82.13   82.82   82.47   82.82   82.47   82.47   82.47   82.82   82.82   82.47   82.47   82.82   82.47   83.16   82.47   83.16   82.47   82.47   82.82   81.79   81.10   80.41   83.51   81.10   81.72   81.44   81.79   81.44   81.79   81.79   81.79   81.10   81.44   81.79   81.44   81.44   81.79   81.44   81.44   81.10   81.79   82.47   81.44   82.13   81.79   82.13   81.79   82.13   81.79   82.13   82.13   82.13   82.13   82.47   82.13   81.79   81.79   82.13   81.79   81.79   82.13   82.13   81.79   81.79   81.79   81.79   81.79   82.13   82.13   82.13   82.13   90.38   90.69   90.34   99.31   98.97   99.31   99.31   99.66   99.31   99.66  100.00   99.66   96.90   95.88   81.79   81.44   81.44   81.79   81.79   81.79   81.79   81.79   81.79   81.79   82.13   81.79   81.79   81.79   81.79   82.13   82.13   80.76   80.76   80.07   80.76   80.07   80.41   81.44   81.60   81.44   81.44   81.44   81.79   81.79   81.79   81.88   81.88   81.79   81.10   81.44   81.10   81.79   81.44   81.44   81.79   81.56   81.44   81.44   81.10   80.76   81.44   81.10   81.44   82.13   81.79   81.44   81.44   81.44   81.44   81.44   81.44   81.79   81.79   81.79   83.85   83.51   82.82

    85: ADK11041.1   83.16   82.82   82.47   83.16   82.82   83.16   82.82   82.82   82.82   83.16   83.16   82.82   82.82   83.16   82.82   83.51   82.82   83.51   82.82   82.82   83.16   82.13   81.44   80.76   83.85   81.44   82.07   81.79   82.13   81.79   82.13   82.13   82.13   81.44   81.79   82.13   81.79   81.79   82.13   81.79   81.79   81.44   82.13   82.82   81.79   82.47   82.13   82.47   82.13   82.47   82.13   82.47   82.47   82.47   82.47   82.82   82.47   82.13   82.13   82.47   82.13   82.13   82.47   82.13   82.13   82.13   82.13   82.13   82.13   82.47   82.47   82.47   82.47   90.72   91.03   90.69   98.97   98.63   98.97   98.97   99.31   98.97   99.31   99.66  100.00   97.24   96.22   82.13   81.79   81.79   82.13   82.13   82.13   82.13   82.13   82.13   82.13   82.47   82.13   82.13   82.13   82.13   82.47   82.47   81.10   81.10   80.41   81.10   80.41   80.76   81.79   81.94   81.79   81.79   81.79   82.13   82.13   82.13   82.23   82.23   82.13   81.44   81.79   81.44   82.13   81.79   81.79   82.13   81.56   81.79   81.79   81.44   81.10   81.79   81.44   81.79   82.47   82.13   81.79   81.79   81.79   81.79   81.79   81.79   82.13   82.13   82.13   84.19   83.85   83.16

    86: AHY20039.1   82.41   82.07   81.72   82.41   82.07   82.41   82.07   82.07   82.07   81.72   82.41   82.07   82.07   82.41   82.07   82.76   82.07   82.07   82.07   82.07   82.41   81.38   80.69   80.00   83.45   81.72   82.35   82.07   82.07   82.07   82.41   82.41   82.41   81.72   82.07   82.41   82.07   82.07   82.41   82.07   81.72   81.72   82.41   83.10   82.07   82.76   82.41   82.07   81.72   82.07   82.41   82.07   82.07   82.07   82.07   82.41   82.07   82.41   82.41   82.76   82.41   82.41   82.76   82.41   82.41   82.41   82.41   82.41   82.41   82.41   82.41   82.76   82.76   91.03   91.38   91.03   96.21   96.55   96.90   96.21   96.55   96.90   97.24   96.90   97.24  100.00   97.93   81.72   81.38   81.38   81.72   81.72   81.72   81.72   81.72   81.72   81.72   81.72   81.72   81.72   81.72   81.72   82.07   82.07   80.69   81.38   80.69   81.38   80.69   81.03   81.38   81.60   81.38   81.38   81.38   81.72   81.72   81.72   81.88   81.88   81.72   81.03   81.38   81.72   81.72   82.07   82.07   82.41   81.85   81.72   82.07   81.72   81.38   82.07   81.72   82.07   82.41   81.72   82.07   82.07   82.07   82.07   82.07   82.07   82.41   82.41   82.41   84.14   84.14   83.45

    87: CAQ42481.2   83.51   83.16   82.82   83.51   83.16   83.51   83.16   83.16   83.16   82.82   83.51   83.16   83.16   83.51   83.16   83.85   83.16   83.16   83.16   83.16   83.51   82.47   81.79   81.10   84.19   82.82   83.10   82.82   83.16   82.82   83.16   83.16   83.16   82.47   82.82   83.16   82.82   82.82   83.16   82.82   82.82   82.47   83.16   83.85   82.82   83.51   83.16   82.82   82.47   82.82   83.16   82.82   82.82   82.82   82.82   83.16   82.82   83.16   83.16   83.51   83.16   83.16   83.16   83.16   83.16   83.16   83.16   83.16   83.16   83.16   83.16   83.51   83.51   91.75   92.07   91.72   95.19   95.88   95.88   95.19   95.53   95.88   96.22   95.88   96.22   97.93  100.00   82.82   82.47   82.47   82.82   82.82   82.82   82.82   82.82   82.82   82.82   82.82   82.82   82.82   82.82   82.82   83.16   83.16   81.79   82.47   81.79   82.47   81.79   82.13   82.47   82.64   82.47   82.47   82.47   82.82   82.82   82.82   82.93   82.93   82.82   82.13   82.47   82.82   82.82   83.16   83.16   83.51   82.98   82.82   83.16   82.82   82.47   83.16   82.82   83.16   83.51   82.82   83.16   83.16   83.16   83.16   83.16   83.16   83.51   83.51   83.51   84.88   84.88   84.19

    88: AIS67613.1   80.76   80.41   80.41   80.76   79.73   80.07   79.73   79.73   79.73   80.07   80.07   79.73   79.73   80.07   79.73   80.07   79.73   80.41   80.07   79.73   80.07   78.69   78.01   77.32   85.57   78.35   78.62   78.69   79.04   78.69   79.04   79.04   79.04   78.35   78.69   79.04   78.69   78.69   79.04   78.69   79.04   78.35   79.04   79.38   78.69   79.04   79.04   79.38   79.04   79.38   78.69   79.38   79.38   79.38   79.38   79.73   79.38   79.04   79.04   79.38   79.04   79.04   79.04   79.04   79.04   79.04   79.04   79.38   79.04   79.38   79.38   79.38   79.38   80.76   81.03   80.69   81.79   81.10   81.10   81.79   81.44   81.10   81.44   81.79   82.13   81.72   82.82  100.00   99.66   98.97   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.66   98.28   98.28   97.59   98.28   97.59   97.94   98.28   98.96   98.63   98.97   98.97   98.97   99.31   99.31   99.30   99.30   99.31   98.63   98.97   97.94   98.63   98.28   98.28   98.63   98.23   98.28   98.97   98.63   98.28   98.97   98.63   98.63   98.28   99.31   98.97   98.97   98.97   98.97   98.97   98.97   98.97   99.31   99.31   91.41   96.56   94.16

    89: AIS67611.1   80.41   80.07   80.07   80.41   79.38   79.73   79.38   79.38   79.38   79.73   79.73   79.38   79.38   79.73   79.38   79.73   79.38   80.07   79.73   79.38   79.73   78.35   77.66   76.98   85.22   78.01   78.28   78.35   78.69   78.35   78.69   78.69   78.69   78.01   78.35   78.69   78.35   78.35   78.69   78.35   78.69   78.01   78.69   79.04   78.35   78.69   78.69   79.04   78.69   79.04   78.35   79.04   79.04   79.04   79.04   79.38   79.04   78.69   78.69   79.04   78.69   78.69   78.69   78.69   78.69   78.69   78.69   79.04   78.69   79.04   79.04   79.04   79.04   80.41   80.69   80.34   81.44   80.76   80.76   81.44   81.10   80.76   81.10   81.44   81.79   81.38   82.47   99.66  100.00   98.63   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   99.31   97.94   97.94   97.25   97.94   97.25   97.59   97.94   98.61   98.28   98.63   98.63   98.63   98.97   98.97   98.95   98.95   98.97   98.28   98.63   97.59   98.28   97.94   97.94   98.28   98.23   97.94   98.63   98.28   97.94   98.63   98.28   98.28   97.94   98.97   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.97   98.97   91.07   96.22   93.81

    90: AHF20911.1   80.41   80.07   80.07   80.41   79.38   79.73   79.38   79.38   79.38   79.73   79.73   79.38   79.38   79.73   79.38   79.73   79.38   80.07   79.73   79.38   79.73   78.35   77.66   76.98   85.22   78.01   78.28   78.35   78.69   78.35   78.69   78.69   78.69   78.01   78.35   78.69   78.35   78.35   78.69   78.35   78.69   78.01   78.69   79.04   78.35   78.69   78.69   79.04   78.69   79.04   78.35   79.04   79.04   79.04   79.04   79.38   79.04   78.69   78.69   79.04   78.69   78.69   78.69   78.69   78.69   78.69   78.69   79.04   78.69   79.04   79.04   79.04   79.04   80.41   80.69   80.34   81.44   80.76   80.76   81.44   81.10   80.76   81.10   81.44   81.79   81.38   82.47   98.97   98.63  100.00   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   99.31   97.94   97.94   97.25   97.94   97.25   97.59   97.94   98.61   98.28   98.63   98.63   98.63   98.97   98.97   98.95   98.95   98.97   98.28   98.63   97.59   98.28   97.94   97.94   98.28   97.87   97.94   98.63   98.28   97.94   98.63   98.28   98.28   97.94   98.97   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.97   98.97   91.07   96.22   93.81

    91: AAO88912.1   80.76   80.41   80.41   80.76   79.73   80.07   79.73   79.73   79.73   80.07   80.07   79.73   79.73   80.07   79.73   80.07   79.73   80.41   80.07   79.73   80.07   78.69   78.01   77.32   85.57   78.35   78.62   78.69   79.04   78.69   79.04   79.04   79.04   78.35   78.69   79.04   78.69   78.69   79.04   78.69   79.04   78.35   79.04   79.38   78.69   79.04   79.04   79.38   79.04   79.38   78.69   79.38   79.38   79.38   79.38   79.73   79.38   79.04   79.04   79.38   79.73   79.04   79.04   79.04   79.04   79.04   79.04   79.38   79.04   79.38   79.38   79.38   79.38   80.76   81.03   80.69   81.79   81.10   81.10   81.79   81.44   81.10   81.44   81.79   82.13   81.72   82.82   99.31   98.97   98.97  100.00   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.66   98.28   98.28   97.59   98.28   97.59   97.94   98.28   98.96   98.63   98.97   98.97   98.97   99.31   99.31   99.30   99.30   99.31   98.63   98.97   97.94   98.63   98.28   98.28   98.63   98.23   98.28   98.97   98.63   98.28   98.97   98.63   98.63   98.28   99.31   98.97   98.97   98.97   98.97   98.97   98.97   98.97   99.31   99.31   91.41   96.56   94.16

    92: AKS25179.1   80.76   80.41   80.41   80.76   79.73   80.07   79.73   79.73   79.73   80.07   80.07   79.73   79.73   80.07   79.73   80.07   79.73   80.41   80.07   79.73   80.07   78.69   78.01   77.32   85.57   78.35   78.62   78.69   79.04   78.69   79.04   79.04   79.04   78.35   78.69   79.04   78.69   78.69   79.04   78.69   79.04   78.35   79.04   79.38   78.69   79.04   79.04   79.38   79.04   79.38   78.69   79.38   79.38   79.38   79.38   79.73   79.38   79.04   79.04   79.38   79.04   79.04   79.04   79.04   79.04   79.04   79.04   79.38   79.04   79.38   79.38   79.38   79.38   80.76   81.03   80.69   81.79   81.10   81.10   81.79   81.44   81.10   81.44   81.79   82.13   81.72   82.82   99.31   98.97   98.97   99.31  100.00   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.66   98.28   98.28   97.59   98.28   97.59   97.94   98.28   98.96   98.63   98.97   98.97   98.97   99.31   99.31   99.30   99.30   99.31   98.63   98.97   97.94   98.63   98.28   98.28   98.63   98.23   98.28   98.97   98.63   98.28   98.97   98.63   98.63   98.28   99.31   98.97   98.97   98.97   98.97   98.97   98.97   98.97   99.31   99.31   91.41   96.56   94.16

    93: ABB59946.1   80.76   80.41   80.41   80.76   79.73   80.07   79.73   79.73   79.73   80.07   80.07   79.73   79.73   80.07   79.73   80.07   79.73   80.41   80.07   79.73   80.07   78.69   78.01   77.32   86.25   79.04   79.31   79.38   79.73   79.38   79.73   79.73   79.73   79.04   79.38   79.73   79.38   79.38   79.73   79.38   79.73   79.04   79.73   80.07   79.38   79.73   79.73   80.07   79.73   80.07   79.38   80.07   80.07   80.07   80.07   80.41   80.07   79.73   79.73   80.07   79.73   79.73   79.73   79.73   79.73   79.73   79.73   80.07   79.73   80.07   80.07   80.07   80.07   80.76   81.03   80.69   81.79   81.10   81.10   81.79   81.44   81.10   81.44   81.79   82.13   81.72   82.82   99.31   98.97   98.97   99.31   99.31  100.00   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.66   98.28   98.28   97.59   98.28   97.59   97.94   98.28   98.96   98.63   98.97   98.97   98.97   99.31   99.31   99.30   99.30   99.31   98.63   98.97   97.94   98.63   98.28   98.28   98.63   98.23   98.28   98.97   98.63   98.28   98.97   98.63   98.63   98.28   99.31   98.97   98.97   98.97   98.97   98.97   98.97   98.97   99.31   99.31   92.10   96.56   94.16

    94: ACP18863.1   80.76   80.41   80.41   80.76   79.73   80.07   79.73   79.73   79.73   80.07   80.07   79.73   79.73   80.07   79.73   80.07   79.73   80.41   80.07   79.73   80.07   78.69   78.01   77.32   85.57   78.35   79.31   78.69   79.04   79.38   79.04   79.04   79.04   78.35   78.69   79.04   78.69   78.69   79.04   78.69   79.04   78.35   79.04   79.38   78.69   79.04   79.04   79.38   79.04   79.38   78.69   79.38   79.38   79.38   79.38   79.73   79.38   79.04   79.04   79.38   79.04   79.04   79.04   79.04   79.04   79.04   79.04   79.38   79.04   79.38   79.38   79.38   79.38   80.76   81.03   80.69   81.79   81.10   81.10   81.79   81.44   81.10   81.44   81.79   82.13   81.72   82.82   99.31   98.97   98.97   99.31   99.31   99.31  100.00   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.66   98.28   98.28   97.59   98.28   97.59   97.94   98.28   98.96   98.63   98.97   98.97   98.97   99.31   99.31   99.30   99.30   99.31   98.63   98.97   97.94   98.63   98.28   98.28   98.63   98.23   98.28   98.97   98.63   98.28   98.97   98.63   98.63   98.28   99.31   98.97   98.97   98.97   98.97   98.97   98.97   98.97   99.31   99.31   91.41   96.56   94.16

    95: ACV92002.1   80.76   80.41   80.41   80.76   79.73   80.07   79.73   79.73   79.73   80.07   80.07   79.73   79.73   80.07   79.73   80.07   79.73   80.41   80.07   79.73   80.07   78.69   78.01   77.32   85.57   78.35   78.62   78.69   79.04   78.69   79.04   79.04   79.04   78.35   78.69   79.04   78.69   78.69   79.04   78.69   79.04   78.35   79.04   79.38   78.69   79.04   79.04   79.38   79.04   79.38   78.69   79.38   79.38   79.38   79.38   79.73   79.38   79.04   79.04   79.38   79.04   79.04   79.04   79.04   79.04   79.04   79.04   79.38   79.04   79.38   79.38   79.38   79.38   80.76   81.03   80.69   81.79   81.10   81.10   81.79   81.44   81.10   81.44   81.79   82.13   81.72   82.82   99.31   98.97   98.97   99.31   99.31   99.31   99.31  100.00   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.66   98.28   98.28   97.59   98.28   97.59   97.94   98.28   98.96   98.63   98.97   98.97   98.97   99.31   99.31   99.30   99.30   99.31   98.63   98.97   97.94   98.63   98.28   98.97   98.63   98.23   98.28   98.97   98.63   98.28   98.97   98.63   98.63   98.28   99.31   98.97   98.97   98.97   98.97   98.97   98.97   98.97   99.31   99.31   91.41   96.56   94.16

    96: ADY02545.1   81.10   80.76   80.76   81.10   80.07   80.41   80.07   80.07   80.07   80.41   80.41   80.07   80.07   80.41   80.07   80.41   80.07   80.76   80.41   80.07   80.41   79.04   78.35   77.66   85.57   78.35   78.62   78.69   79.04   78.69   79.04   79.04   79.04   78.35   78.69   79.04   78.69   78.69   79.04   78.69   79.04   78.35   79.04   79.38   78.69   79.04   79.04   79.38   79.04   79.38   78.69   79.38   79.38   79.38   79.38   79.73   79.38   79.04   79.04   79.38   79.04   79.04   79.04   79.04   79.04   79.04   79.38   79.38   79.04   79.38   79.38   79.38   79.38   80.76   81.03   80.69   82.47   81.10   81.10   81.79   81.44   81.10   81.44   81.79   82.13   81.72   82.82   99.31   98.97   98.97   99.31   99.31   99.31   99.31   99.31  100.00   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.66   98.28   98.28   97.59   98.28   97.59   97.94   98.28   98.96   98.63   98.97   98.97   98.97   99.31   99.31   99.30   99.30   99.31   98.63   98.97   97.94   98.63   98.28   98.28   98.63   98.23   98.28   98.97   98.63   98.28   98.97   98.63   98.63   98.28   99.31   98.97   98.97   98.97   98.97   98.97   98.97   98.97   99.31   99.31   91.41   96.56   94.16

    97: AET99223.1   80.76   80.41   80.41   80.76   79.73   80.07   79.73   79.73   79.73   80.07   80.07   79.73   79.73   80.07   79.73   80.07   79.73   80.41   80.07   79.73   80.07   78.69   78.01   77.32   85.57   78.35   78.62   78.69   79.04   78.69   79.04   79.04   79.04   78.35   78.69   79.04   78.69   78.69   79.04   78.69   79.04   78.35   79.04   79.38   78.69   79.04   79.04   79.38   79.04   79.38   78.69   79.38   79.38   79.38   79.38   79.73   79.38   79.04   79.04   79.38   79.04   79.04   79.04   79.04   79.04   79.04   79.04   79.38   79.04   79.38   79.38   79.38   79.38   80.76   81.03   80.69   81.79   81.10   81.10   81.79   81.44   81.10   81.44   81.79   82.13   81.72   82.82   99.31   98.97   98.97   99.31   99.31   99.31   99.31   99.31   99.31  100.00   99.31   99.31   99.31   99.31   99.31   99.31   99.66   98.28   98.28   97.59   98.28   97.59   97.94   98.28   98.96   98.63   98.97   98.97   98.97   99.31   99.31   99.30   99.30   99.31   98.63   98.97   97.94   98.63   98.28   98.28   98.63   98.23   98.28   98.97   98.63   98.28   98.97   98.63   98.63   98.28   99.31   98.97   98.97   98.97   98.97   98.97   98.97   98.97   99.31   99.31   91.41   96.56   94.16

    98: AFY98865.1   81.10   80.76   80.76   81.10   80.07   80.41   80.07   80.07   80.07   80.41   80.41   80.07   80.07   80.41   80.07   80.41   80.07   80.76   80.41   80.07   80.41   79.04   78.35   77.66   85.57   78.35   78.62   78.69   79.04   78.69   79.04   79.04   79.04   78.35   78.69   79.04   78.69   78.69   79.04   78.69   79.04   78.35   79.04   79.38   78.69   79.04   79.04   79.38   79.04   79.38   78.69   79.38   79.38   79.38   79.38   79.73   79.38   79.04   79.04   79.38   79.04   79.04   79.04   79.04   79.04   79.04   79.04   79.38   79.04   79.38   79.38   79.38   79.38   80.76   81.03   80.69   82.13   81.44   81.44   82.13   81.79   81.44   81.79   82.13   82.47   81.72   82.82   99.31   98.97   98.97   99.31   99.31   99.31   99.31   99.31   99.31   99.31  100.00   99.31   99.31   99.31   99.31   99.31   99.66   98.28   98.28   97.59   98.28   97.59   97.94   98.28   98.96   98.63   98.97   98.97   98.97   99.31   99.31   99.30   99.30   99.31   98.63   98.97   97.94   98.63   98.28   98.28   98.63   98.23   98.63   98.97   98.63   98.28   98.97   98.63   98.63   98.63   99.31   98.97   98.97   98.97   98.97   98.97   98.97   98.97   99.31   99.31   91.41   96.56   94.16

    99: CDG50843.1   80.76   80.41   80.41   80.76   79.73   80.07   79.73   79.73   79.73   80.07   80.07   79.73   79.73   80.07   79.73   80.07   79.73   80.41   80.07   79.73   80.07   78.69   78.01   77.32   85.57   78.35   78.62   78.69   79.04   78.69   79.04   79.04   79.04   78.35   78.69   79.04   78.69   78.69   79.04   78.69   79.04   78.35   79.04   79.38   78.69   79.04   79.04   79.38   79.04   79.38   78.69   79.38   79.38   79.38   79.38   79.73   79.38   79.04   79.04   79.38   79.04   79.04   79.04   79.04   79.04   79.04   79.04   79.38   79.04   79.38   79.38   79.38   79.38   80.76   81.03   80.69   81.79   81.10   81.10   81.79   81.44   81.10   81.44   81.79   82.13   81.72   82.82   99.31   98.97   98.97   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31  100.00   99.31   99.31   99.31   99.31   99.66   98.28   98.28   97.59   98.28   97.59   97.94   98.28   98.96   98.63   98.97   98.97   98.97   99.31   99.31   99.30   99.30   99.31   98.63   98.97   97.94   98.63   98.28   98.28   98.63   98.23   98.28   98.97   98.63   98.28   98.97   98.63   98.63   98.28   99.31   98.97   98.97   98.97   98.97   98.97   98.97   98.97   99.31   99.31   91.41   96.56   94.16

   100: AGW25368.1   81.10   80.76   80.76   81.10   80.07   80.41   80.07   80.07   80.07   80.41   80.41   80.07   80.07   80.41   80.07   80.41   80.07   80.76   80.41   80.07   80.41   79.04   78.35   77.66   85.91   78.69   78.97   79.04   79.38   79.04   79.38   79.38   79.38   78.69   79.04   79.38   79.04   79.04   79.38   79.04   79.38   78.69   79.38   79.73   79.04   79.38   79.38   79.73   79.38   79.73   79.04   79.73   79.73   79.73   79.73   80.07   79.73   79.38   79.38   79.73   79.38   79.38   79.38   79.38   79.38   79.38   79.38   79.73   79.38   79.73   79.73   79.73   79.73   80.76   81.03   80.69   81.79   81.10   81.10   81.79   81.44   81.10   81.44   81.79   82.13   81.72   82.82   99.31   98.97   98.97   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31  100.00   99.31   99.31   99.31   99.66   98.28   98.28   97.59   98.28   97.59   97.94   98.28   98.96   98.63   98.97   98.97   98.97   99.31   99.31   99.30   99.30   99.31   98.63   98.97   97.94   98.63   98.28   98.28   98.63   98.23   98.28   98.97   98.63   98.28   98.97   98.63   98.63   98.28   99.31   98.97   98.97   98.97   98.97   98.97   98.97   98.97   99.31   99.31   91.41   96.56   94.16

   101: AIS67612.1   80.76   80.41   80.41   80.76   79.73   80.07   79.73   79.73   79.73   80.07   80.07   79.73   79.73   80.07   79.73   80.07   79.73   80.41   80.07   79.73   80.07   78.69   78.01   77.32   85.57   79.04   79.31   79.38   79.73   79.38   79.73   79.73   79.73   79.04   79.38   79.73   79.38   79.38   79.73   79.38   79.73   79.04   79.73   80.07   79.38   79.73   79.73   80.07   79.73   80.07   79.38   80.07   80.07   80.07   80.07   80.41   80.07   79.73   79.73   80.07   79.73   79.73   79.73   79.73   79.73   79.73   79.73   80.07   79.73   80.07   80.07   80.07   80.07   80.76   81.03   80.69   81.79   81.10   81.10   81.79   81.44   81.10   81.44   81.79   82.13   81.72   82.82   99.31   98.97   98.97   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31  100.00   99.31   99.31   99.66   98.28   98.28   97.59   98.28   97.59   97.94   98.28   98.96   98.63   98.97   98.97   98.97   99.31   99.31   99.30   99.30   99.31   99.31   98.97   97.94   98.63   98.28   98.28   98.63   98.23   98.28   98.97   98.63   98.28   98.97   98.63   98.63   98.28   99.31   98.97   98.97   98.97   98.97   98.97   98.97   98.97   99.31   99.31   91.41   96.56   94.16

   102: ALK03059.1   81.10   80.76   80.76   81.10   80.07   80.41   80.07   80.07   80.07   80.41   80.41   80.07   80.07   80.41   80.07   80.41   80.07   80.76   80.41   80.07   80.41   79.04   78.35   77.66   85.57   78.69   78.97   79.04   79.38   79.04   79.38   79.38   79.38   78.69   79.04   79.38   79.04   79.04   79.38   79.04   79.38   78.69   79.38   79.73   79.04   79.38   79.38   79.73   79.38   79.73   79.04   79.73   79.73   79.73   79.73   80.07   79.73   79.38   79.38   79.73   79.38   79.38   79.38   79.38   79.38   79.38   79.38   79.73   79.38   79.73   79.73   79.73   79.73   81.10   81.38   81.03   81.79   81.10   81.10   81.79   81.44   81.10   81.44   81.79   82.13   81.72   82.82   99.31   98.97   98.97   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31  100.00   99.31   99.66   98.28   98.28   97.59   98.28   97.59   97.94   98.28   98.96   98.63   98.97   98.97   98.97   99.31   99.31   99.30   99.30   99.31   98.63   98.97   97.94   98.63   98.28   98.28   98.63   98.23   98.28   98.97   98.63   98.28   98.97   98.63   98.63   98.28   99.31   98.97   98.97   98.97   98.97   98.97   98.97   98.97   99.31   99.31   91.75   96.56   94.50

   103: ALL29307.1   81.10   80.76   80.76   81.10   80.07   80.41   80.07   80.07   80.07   80.41   80.41   80.07   80.07   80.41   80.07   80.41   80.07   80.76   80.41   80.07   80.41   79.04   78.35   77.66   85.91   78.69   78.97   79.04   79.38   79.04   79.38   79.38   79.38   78.69   79.04   79.38   79.04   79.04   79.38   79.04   79.38   78.69   79.38   79.73   79.04   79.38   79.38   79.73   79.38   79.73   79.04   79.73   79.73   79.73   79.73   80.07   79.73   79.38   79.38   79.73   79.38   79.38   79.38   79.38   79.38   79.38   79.38   79.73   79.38   79.73   79.73   79.73   79.73   81.10   81.03   80.69   82.13   81.44   81.44   82.13   81.79   81.44   81.79   82.13   82.47   82.07   83.16   99.31   98.97   98.97   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31  100.00   99.66   98.28   98.28   97.59   98.28   97.59   97.94   98.28   98.96   98.63   98.97   98.97   98.97   99.31   99.31   99.30   99.30   99.31   98.63   98.97   98.63   99.31   98.97   98.28   98.63   98.23   98.28   98.97   98.63   98.28   98.97   98.63   98.63   98.28   99.31   98.97   98.97   98.97   98.97   98.97   98.97   98.97   99.31   99.31   91.75   96.56   94.16

   104: AAL02127.1   81.10   80.76   80.76   81.10   80.07   80.41   80.07   80.07   80.07   80.41   80.41   80.07   80.07   80.41   80.07   80.41   80.07   80.76   80.41   80.07   80.41   79.04   78.35   77.66   85.91   78.69   78.97   79.04   79.38   79.04   79.38   79.38   79.38   78.69   79.04   79.38   79.04   79.04   79.38   79.04   79.38   78.69   79.38   79.73   79.04   79.38   79.38   79.73   79.38   79.73   79.04   79.73   79.73   79.73   79.73   80.07   79.73   79.38   79.38   79.73   79.38   79.38   79.38   79.38   79.38   79.38   79.38   79.73   79.38   79.73   79.73   79.73   79.73   81.10   81.38   81.03   82.13   81.44   81.44   82.13   81.79   81.44   81.79   82.13   82.47   82.07   83.16   99.66   99.31   99.31   99.66   99.66   99.66   99.66   99.66   99.66   99.66   99.66   99.66   99.66   99.66   99.66   99.66  100.00   98.63   98.63   97.94   98.63   97.94   98.28   98.63   99.31   98.97   99.31   99.31   99.31   99.66   99.66   99.65   99.65   99.66   98.97   99.31   98.28   98.97   98.63   98.63   98.97   98.58   98.63   99.31   98.97   98.63   99.31   98.97   98.97   98.63   99.66   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.66   99.66   91.75   96.91   94.50

   105: CAD89606.1   80.07   79.73   79.73   80.07   79.04   79.38   79.04   79.04   79.04   79.38   79.38   79.04   79.04   79.38   79.04   79.38   79.04   79.73   79.38   79.04   79.38   78.01   77.32   76.63   84.54   77.66   77.93   78.01   78.35   78.01   78.35   78.35   78.35   78.35   78.69   78.35   78.69   78.69   79.04   78.69   78.35   77.66   78.35   78.69   78.01   78.35   78.35   79.38   79.04   78.69   78.01   78.69   78.69   78.69   78.69   79.04   78.69   78.35   78.35   78.69   78.35   78.35   78.35   78.35   78.35   78.35   78.35   78.69   78.35   78.69   78.69   78.69   78.69   79.73   80.00   79.66   80.76   80.76   80.76   81.44   81.10   80.07   80.41   80.76   81.10   80.69   81.79   98.28   97.94   97.94   98.28   98.28   98.28   98.28   98.28   98.28   98.28   98.28   98.28   98.28   98.28   98.28   98.28   98.63  100.00   99.31   99.31   99.31   99.31   99.66   97.94   98.26   98.97   98.63   98.63   98.63   98.97   98.97   98.61   98.61   98.97   98.97   99.31   97.59   97.59   97.25   97.25   97.59   97.52   97.94   98.63   98.28   98.63   98.63   98.97   98.28   97.25   98.28   97.94   97.94   97.94   97.94   97.94   97.94   97.94   98.28   98.28   90.38   95.53   93.13

   106: BAD16611.1   80.76   80.41   80.41   80.76   79.73   80.07   79.73   79.73   79.73   79.38   80.07   79.73   79.73   80.07   79.73   80.07   79.73   79.73   80.07   79.73   80.07   78.69   78.01   77.32   84.54   78.35   78.62   78.69   79.04   78.69   79.04   79.04   79.04   78.35   78.69   79.04   78.69   78.69   79.04   78.69   79.04   78.35   79.04   79.38   78.69   79.04   79.04   78.69   78.35   78.69   78.69   78.69   78.69   78.69   78.69   79.04   78.69   79.04   79.04   79.38   79.04   79.04   79.04   79.04   79.04   79.04   79.04   79.38   79.04   79.04   79.38   79.38   79.38   80.41   80.69   80.34   80.76   80.76   80.76   80.76   80.41   80.76   81.10   80.76   81.10   81.38   82.47   98.28   97.94   97.94   98.28   98.28   98.28   98.28   98.28   98.28   98.28   98.28   98.28   98.28   98.28   98.28   98.28   98.63   99.31  100.00   99.31   99.31   99.31   99.66   97.25   98.26   98.97   97.94   97.94   97.94   98.28   98.28   98.61   98.61   98.97   98.28   98.63   97.59   97.59   97.94   97.94   98.28   98.23   98.63   99.31   98.28   98.63   98.63   98.97   98.97   97.94   98.28   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.97   98.97   90.38   95.53   93.13

   107: ABM97538.1   80.07   79.73   79.73   80.07   79.04   79.38   79.04   79.04   79.04   78.69   79.38   79.04   79.04   79.38   79.73   79.38   79.04   79.04   79.38   79.04   79.38   78.01   77.32   76.63   83.85   77.66   77.93   78.35   78.35   78.01   78.35   78.35   78.35   78.35   78.69   78.69   78.69   79.04   79.04   79.04   78.35   77.66   78.35   78.69   78.01   78.35   78.35   78.69   78.35   78.01   78.01   78.01   78.01   78.01   78.01   78.35   78.01   78.35   78.35   78.69   78.35   78.35   78.35   78.35   78.35   78.35   78.35   78.69   78.69   78.35   78.69   78.69   78.69   79.73   80.00   79.66   80.07   80.76   80.76   80.76   80.41   80.07   80.41   80.07   80.41   80.69   81.79   97.59   97.25   97.25   97.59   97.59   97.59   97.59   97.59   97.59   97.59   97.59   97.59   97.59   97.59   97.59   97.59   97.94   99.31   99.31  100.00   99.31   99.31   99.66   97.25   97.57   98.28   97.94   97.94   97.94   98.28   98.28   97.91   97.91   98.28   98.28   98.63   97.59   96.91   97.25   97.25   97.59   97.52   97.94   98.63   98.63   99.31   98.63   98.97   98.28   97.25   97.59   97.94   98.63   98.28   97.94   98.28   97.94   97.94   98.28   98.28   89.69   94.85   92.44

   108: ABN09669.1   80.41   80.07   80.07   80.41   79.38   79.73   79.38   79.38   79.38   79.04   79.73   79.38   79.38   79.73   79.38   79.73   79.38   79.38   79.73   79.38   79.73   78.35   77.66   76.98   84.54   78.01   78.28   78.35   78.69   78.35   78.69   78.69   78.69   78.69   79.04   78.69   79.04   79.04   79.38   79.04   78.69   78.01   78.69   79.04   78.35   78.69   78.69   79.04   78.69   78.35   78.35   78.35   78.35   78.35   78.35   78.69   78.35   78.69   78.69   79.04   78.69   78.69   78.69   78.69   78.69   78.69   78.69   79.04   78.69   78.69   79.04   79.04   79.04   80.41   80.69   80.34   80.76   81.44   81.44   81.44   81.10   80.76   81.10   80.76   81.10   81.38   82.47   98.28   97.94   97.94   98.28   98.28   98.28   98.28   98.28   98.28   98.28   98.28   98.28   98.28   98.28   98.28   98.28   98.63   99.31   99.31   99.31  100.00   99.31   99.66   97.94   97.92   98.28   98.63   98.63   98.63   98.97   98.97   98.26   98.26   98.28   98.28   98.63   98.28   97.59   97.94   97.94   98.28   97.87   98.63   98.63   98.97   98.63   99.31   98.97   98.97   97.94   98.28   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.97   98.97   90.38   95.53   93.13

   109: AIT97310.1   80.07   79.73   79.73   80.07   79.04   79.38   79.04   79.04   79.04   78.69   79.38   79.04   79.04   79.38   79.04   79.38   79.04   79.04   79.38   79.04   79.38   78.01   77.32   76.63   83.85   77.66   77.93   78.01   78.35   78.01   78.35   78.35   78.35   78.35   78.69   78.35   78.69   78.69   79.04   78.69   78.35   77.66   78.35   78.69   78.01   78.35   78.35   78.69   78.35   78.01   78.01   78.01   78.01   78.01   78.01   78.35   78.01   78.35   78.35   78.69   78.35   78.35   78.35   78.35   78.35   78.35   78.35   78.69   78.35   78.35   78.69   78.69   78.69   79.73   80.00   79.66   80.07   80.76   80.76   80.76   80.41   80.07   80.41   80.07   80.41   80.69   81.79   97.59   97.25   97.25   97.59   97.59   97.59   97.59   97.59   97.59   97.59   97.59   97.59   97.59   97.59   97.59   97.59   97.94   99.31   99.31   99.31   99.31  100.00   99.66   97.25   97.57   98.28   97.94   97.94   97.94   98.28   98.28   97.91   97.91   98.28   98.28   98.63   97.59   96.91   97.25   97.25   97.59   97.52   97.94   98.63   98.28   98.63   98.63   98.97   98.28   97.25   97.59   97.94   97.94   97.94   97.94   97.94   97.94   97.94   98.28   98.28   89.69   94.85   92.44

   110: CAA63262.1   80.41   80.07   80.07   80.41   79.38   79.73   79.38   79.38   79.38   79.04   79.73   79.38   79.38   79.73   79.38   79.73   79.38   79.38   79.73   79.38   79.73   78.35   77.66   76.98   84.19   78.01   78.28   78.35   78.69   78.35   78.69   78.69   78.69   78.69   79.04   78.69   79.04   79.04   79.38   79.04   78.69   78.01   78.69   79.04   78.35   78.69   78.69   79.04   78.69   78.35   78.35   78.35   78.35   78.35   78.35   78.69   78.35   78.69   78.69   79.04   78.69   78.69   78.69   78.69   78.69   78.69   78.69   79.04   78.69   78.69   79.04   79.04   79.04   80.07   80.34   80.00   80.41   81.10   81.10   81.10   80.76   80.41   80.76   80.41   80.76   81.03   82.13   97.94   97.59   97.59   97.94   97.94   97.94   97.94   97.94   97.94   97.94   97.94   97.94   97.94   97.94   97.94   97.94   98.28   99.66   99.66   99.66   99.66   99.66  100.00   97.59   97.92   98.63   98.28   98.28   98.28   98.63   98.63   98.26   98.26   98.63   98.63   98.97   97.94   97.25   97.59   97.59   97.94   97.87   98.28   98.97   98.63   98.97   98.97   99.31   98.63   97.59   97.94   98.28   98.28   98.28   98.28   98.28   98.28   98.28   98.63   98.63   90.03   95.19   92.78

   111: ABB72225.1   80.41   80.07   80.07   80.41   79.38   79.73   79.38   79.38   79.38   79.73   79.73   79.38   79.38   79.73   79.38   79.73   79.38   80.07   79.73   79.38   79.73   78.35   77.66   76.98   85.22   78.01   78.28   78.35   78.69   78.35   78.69   78.69   78.69   78.69   79.04   78.69   79.04   79.04   79.38   79.04   78.69   78.01   78.69   79.04   78.35   78.69   78.69   79.73   79.38   79.04   78.35   79.04   79.04   79.04   79.04   79.38   79.04   78.69   78.69   79.04   78.69   78.69   78.69   78.69   78.69   78.69   78.69   79.04   78.69   79.04   79.04   79.04   79.04   80.41   80.69   80.34   81.44   81.44   81.44   82.13   81.79   80.76   81.10   81.44   81.79   81.38   82.47   98.28   97.94   97.94   98.28   98.28   98.28   98.28   98.28   98.28   98.28   98.28   98.28   98.28   98.28   98.28   98.28   98.63   97.94   97.25   97.25   97.94   97.25   97.59  100.00   97.92   97.59   98.63   98.63   98.63   98.97   98.97   98.26   98.26   98.28   98.28   98.63   97.59   97.59   97.25   98.63   98.97   97.16   97.94   97.94   98.28   97.94   98.63   98.28   97.59   97.94   98.28   97.94   97.94   97.94   97.94   97.94   97.94   98.63   98.28   98.28   90.38   95.53   93.13

   112: AEM44654.1   80.90   80.56   80.56   80.90   80.21   80.21   79.86   79.86   79.86   80.21   80.21   79.86   79.86   80.21   79.86   80.21   79.86   80.56   80.21   79.86   80.21   78.82   78.12   77.43   85.07   78.12   78.47   78.47   78.82   78.47   78.82   78.82   78.82   78.12   78.47   78.82   78.47   78.47   78.82   78.47   78.82   78.12   78.82   79.17   78.47   78.82   78.82   79.17   78.82   79.17   78.82   79.17   79.17   79.17   79.17   79.51   79.17   78.82   78.82   79.51   78.82   79.17   78.82   78.82   78.82   78.82   78.82   79.17   78.82   79.17   79.17   79.17   79.17   80.56   80.90   80.56   81.60   80.90   80.90   81.60   81.25   80.90   81.25   81.60   81.94   81.60   82.64   98.96   98.61   98.61   98.96   98.96   98.96   98.96   98.96   98.96   98.96   98.96   98.96   98.96   98.96   98.96   98.96   99.31   98.26   98.26   97.57   97.92   97.57   97.92   97.92  100.00   98.61   98.61   98.61   98.61   98.96   98.96   99.30   99.30   99.31   98.61   98.96   97.57   98.26   97.92   97.92   98.26   98.22   97.92   98.96   98.26   98.26   98.61   98.61   98.26   97.92   98.96   98.61   98.61   98.61   98.61   98.61   98.61   98.61   98.96   98.96   90.97   96.18   93.75

   113: AAP22736.1   80.41   80.07   80.07   80.41   79.38   79.73   79.38   79.38   79.38   79.73   79.73   79.38   79.38   79.73   79.38   79.73   79.38   80.07   79.73   79.38   79.73   78.35   77.66   76.98   85.22   78.35   78.62   78.69   79.04   78.69   79.04   79.04   79.04   78.35   78.69   79.04   78.69   78.69   79.04   78.69   79.04   78.35   79.04   79.38   78.69   79.04   79.04   79.38   79.04   79.38   78.69   79.38   79.38   79.38   79.38   79.73   79.38   79.04   79.04   79.38   79.04   79.04   79.04   79.04   79.04   79.04   79.04   79.38   79.04   79.38   79.38   79.38   79.38   80.41   80.69   80.34   81.44   80.76   80.76   81.44   81.10   80.76   81.10   81.44   81.79   81.38   82.47   98.63   98.28   98.28   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.97   98.97   98.97   98.28   98.28   98.28   98.63   97.59   98.61  100.00   98.28   98.28   98.28   98.63   98.63   98.95   98.95   99.31   98.63   98.97   97.94   98.63   98.28   97.59   97.94   97.87   98.28   98.97   97.94   98.28   98.28   98.63   99.31   97.59   98.63   98.28   98.28   98.28   98.28   98.28   98.28   98.28   98.63   98.63   90.72   95.88   93.47

   114: ACU00153.1   80.41   80.07   80.07   80.41   79.38   79.73   79.38   79.38   79.38   79.73   79.73   79.38   79.38   79.73   79.38   79.73   79.38   80.07   79.73   79.38   79.73   78.35   77.66   76.98   85.22   78.01   78.28   78.35   78.69   78.35   78.69   78.69   78.69   78.69   79.04   78.69   79.04   79.04   79.38   79.04   78.69   78.01   78.69   79.04   78.35   78.69   78.69   79.73   79.38   79.04   78.35   79.04   79.04   79.04   79.04   79.38   79.04   78.69   78.69   79.04   78.69   78.69   78.69   78.69   78.69   78.69   78.69   79.04   78.69   79.04   79.04   79.04   79.04   80.41   80.69   80.34   81.44   81.44   81.44   82.13   81.79   80.76   81.10   81.44   81.79   81.38   82.47   98.97   98.63   98.63   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   99.31   98.63   97.94   97.94   98.63   97.94   98.28   98.63   98.61   98.28  100.00   99.31   99.31   99.66   99.66   98.95   98.95   98.97   98.97   99.31   98.28   98.28   97.94   97.94   98.28   97.87   97.94   98.63   98.97   98.63   99.31   98.97   98.28   97.94   98.97   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.97   98.97   91.07   96.22   93.81

   115: AHX39588.1   80.41   80.07   80.07   80.41   79.38   79.73   79.38   79.38   79.38   79.73   79.73   79.38   79.38   79.73   79.38   79.73   79.38   80.07   79.73   79.38   79.73   78.35   77.66   76.98   85.22   78.01   78.28   78.35   78.69   78.35   78.69   78.69   78.69   78.69   79.04   78.69   79.04   79.04   79.38   79.04   78.69   78.01   78.69   79.04   78.35   78.69   78.69   79.73   79.38   79.04   78.35   79.04   79.04   79.04   79.04   79.38   79.04   78.69   78.69   79.04   78.69   78.69   78.69   78.69   78.69   78.69   78.69   79.04   78.69   79.04   79.04   79.04   79.04   80.41   80.69   80.34   81.44   81.44   81.44   82.13   81.79   80.76   81.10   81.44   81.79   81.38   82.47   98.97   98.63   98.63   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   99.31   98.63   97.94   97.94   98.63   97.94   98.28   98.63   98.61   98.28   99.31  100.00   99.31   99.66   99.66   98.95   98.95   98.97   98.97   99.31   98.28   98.28   97.94   97.94   98.28   97.87   97.94   98.63   98.97   98.63   99.31   98.97   98.28   97.94   98.97   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.97   98.97   91.07   96.22   93.81

   116: AKR53959.1   80.76   80.41   80.41   80.76   79.73   80.07   79.73   79.73   79.73   80.07   80.07   79.73   79.73   80.07   79.73   80.07   79.73   80.41   80.07   79.73   80.07   78.69   78.01   77.32   85.57   78.35   78.62   78.69   79.04   78.69   79.04   79.04   79.04   79.04   79.38   79.04   79.38   79.38   79.73   79.38   79.04   78.35   79.04   79.38   78.69   79.04   79.04   80.07   79.73   79.38   78.69   79.38   79.38   79.38   79.38   79.73   79.38   79.04   79.04   79.38   79.04   79.04   79.04   79.04   79.04   79.04   79.04   79.38   79.04   79.38   79.38   79.38   79.38   80.76   81.03   80.69   81.79   81.79   81.79   82.47   82.13   81.10   81.44   81.79   82.13   81.72   82.82   98.97   98.63   98.63   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   99.31   98.63   97.94   97.94   98.63   97.94   98.28   98.63   98.61   98.28   99.31   99.31  100.00   99.66   99.66   98.95   98.95   98.97   98.97   99.31   98.28   98.28   97.94   97.94   98.28   97.87   97.94   98.63   98.97   98.63   99.31   98.97   98.28   97.94   98.97   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.97   98.97   91.07   96.22   93.81

   117: ABI34705.1   80.76   80.41   80.41   80.76   79.73   80.07   79.73   79.73   79.73   80.07   80.07   79.73   79.73   80.07   79.73   80.07   79.73   80.41   80.07   79.73   80.07   78.69   78.01   77.32   85.57   78.35   78.62   78.69   79.04   78.69   79.04   79.04   79.04   79.04   79.38   79.04   79.38   79.38   79.73   79.38   79.04   78.35   79.04   79.38   78.69   79.04   79.04   80.07   79.73   79.38   78.69   79.38   79.38   79.38   79.38   79.73   79.38   79.04   79.04   79.38   79.04   79.04   79.04   79.04   79.04   79.04   79.04   79.38   79.04   79.38   79.38   79.38   79.38   80.76   81.03   80.69   81.79   81.79   81.79   82.47   82.13   81.10   81.44   81.79   82.13   81.72   82.82   99.31   98.97   98.97   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.66   98.97   98.28   98.28   98.97   98.28   98.63   98.97   98.96   98.63   99.66   99.66   99.66  100.00  100.00   99.30   99.30   99.31   99.31   99.66   98.63   98.63   98.28   98.28   98.63   98.23   98.28   98.97   99.31   98.97   99.66   99.31   98.63   98.28   99.31   98.97   98.97   98.97   98.97   98.97   98.97   98.97   99.31   99.31   91.41   96.56   94.16

   118: ABG80523.1   80.76   80.41   80.41   80.76   79.73   80.07   79.73   79.73   79.73   80.07   80.07   79.73   79.73   80.07   79.73   80.07   79.73   80.41   80.07   79.73   80.07   78.69   78.01   77.32   85.57   78.35   78.62   78.69   79.04   78.69   79.04   79.04   79.04   79.04   79.38   79.04   79.38   79.38   79.73   79.38   79.04   78.35   79.04   79.38   78.69   79.04   79.04   80.07   79.73   79.38   78.69   79.38   79.38   79.38   79.38   79.73   79.38   79.04   79.04   79.38   79.04   79.04   79.04   79.04   79.04   79.04   79.04   79.38   79.04   79.38   79.38   79.38   79.38   80.76   81.03   80.69   81.79   81.79   81.79   82.47   82.13   81.10   81.44   81.79   82.13   81.72   82.82   99.31   98.97   98.97   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.66   98.97   98.28   98.28   98.97   98.28   98.63   98.97   98.96   98.63   99.66   99.66   99.66  100.00  100.00   99.30   99.30   99.31   99.31   99.66   98.63   98.63   98.28   98.28   98.63   98.23   98.28   98.97   99.31   98.97   99.66   99.31   98.63   98.28   99.31   98.97   98.97   98.97   98.97   98.97   98.97   98.97   99.31   99.31   91.41   96.56   94.16

   119: AEM44650.1   81.18   80.84   80.84   81.18   80.49   80.49   80.14   80.14   80.14   80.49   80.49   80.14   80.14   80.49   80.14   80.49   80.14   80.84   80.49   80.14   80.49   79.09   78.40   77.70   85.37   78.40   79.44   78.75   79.09   78.75   79.09   79.09   79.09   78.40   78.75   79.09   78.75   78.75   79.09   78.75   79.09   78.40   79.09   79.44   78.75   79.09   79.09   79.44   79.09   79.44   79.09   79.44   79.44   79.44   79.44   79.79   79.44   79.09   79.09   79.44   79.09   79.09   79.09   79.09   79.09   79.09   79.09   79.44   79.09   79.44   79.44   79.44   79.44   80.84   81.18   80.84   81.88   81.18   81.18   81.88   81.53   81.18   81.53   81.88   82.23   81.88   82.93   99.30   98.95   98.95   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.65   98.61   98.61   97.91   98.26   97.91   98.26   98.26   99.30   98.95   98.95   98.95   98.95   99.30   99.30  100.00   99.30   99.65   98.95   99.30   97.91   98.61   98.26   98.26   98.61   98.22   98.26   99.30   98.61   98.61   98.95   98.95   98.61   98.26   99.30   98.95   98.95   98.95   98.95   98.95   98.95   98.95   99.30   99.30   91.29   96.52   94.08

   120: AEM44651.1   81.18   80.84   80.84   81.18   80.49   80.49   80.14   80.14   80.14   80.49   80.49   80.14   80.14   80.49   80.14   80.49   80.14   80.84   80.49   80.14   80.49   79.09   78.40   77.70   85.37   78.40   78.75   78.75   79.09   78.75   79.09   79.09   79.09   78.40   78.75   79.09   78.75   78.75   79.09   78.75   79.09   78.40   79.09   79.44   78.75   79.09   79.09   79.44   79.09   79.44   79.09   79.44   79.44   79.44   79.44   79.79   79.44   79.09   79.09   79.44   79.09   79.09   79.09   79.09   79.09   79.09   79.09   79.44   79.09   79.44   79.44   79.44   79.44   80.84   81.18   80.84   81.88   81.18   81.18   81.88   81.53   81.18   81.53   81.88   82.23   81.88   82.93   99.30   98.95   98.95   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.65   98.61   98.61   97.91   98.26   97.91   98.26   98.26   99.30   98.95   98.95   98.95   98.95   99.30   99.30   99.30  100.00   99.65   98.95   99.30   97.91   98.61   98.26   98.26   98.61   98.22   98.26   99.30   98.61   98.61   98.95   98.95   98.61   98.26   99.30   98.95   98.95   98.95   98.95   98.95   98.95   98.95   99.30   99.30   91.29   96.52   94.08

   121: CAD70280.1   81.10   80.76   80.76   81.10   80.07   80.41   80.07   80.07   80.07   80.41   80.41   80.07   80.07   80.41   80.07   80.41   80.07   80.76   80.41   80.07   80.41   79.04   78.35   77.66   85.57   78.69   78.97   79.04   79.38   79.04   79.38   79.38   79.38   78.69   79.04   79.38   79.04   79.04   79.38   79.04   79.38   78.69   79.38   79.73   79.04   79.38   79.38   79.73   79.38   79.73   79.04   79.73   79.73   79.73   79.73   80.07   79.73   79.38   79.38   79.73   79.38   79.38   79.38   79.38   79.38   79.38   79.38   79.73   79.38   79.73   79.73   79.73   79.73   80.76   81.03   80.69   81.79   81.10   81.10   81.79   81.44   81.10   81.44   81.79   82.13   81.72   82.82   99.31   98.97   98.97   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.66   98.97   98.97   98.28   98.28   98.28   98.63   98.28   99.31   99.31   98.97   98.97   98.97   99.31   99.31   99.65   99.65  100.00   99.31   99.66   97.94   98.63   98.28   98.28   98.63   98.58   98.28   99.66   98.63   98.97   98.97   99.31   98.63   98.28   99.31   98.97   98.97   98.97   98.97   98.97   98.97   98.97   99.31   99.31   91.41   96.56   94.16

   122: ABY91281.1   80.41   80.07   80.07   80.41   79.38   79.73   79.38   79.38   79.38   79.73   79.73   79.38   79.38   79.73   79.38   79.73   79.38   80.07   79.73   79.38   79.73   78.35   77.66   76.98   84.88   78.69   78.97   79.04   79.38   79.04   79.38   79.38   79.38   79.38   79.73   79.38   79.73   79.73   80.07   79.73   79.38   78.69   79.38   79.73   79.04   79.38   79.38   80.41   80.07   79.73   79.04   79.73   79.73   79.73   79.73   80.07   79.73   79.38   79.38   79.73   79.38   79.38   79.38   79.38   79.38   79.38   79.38   79.73   79.38   79.73   79.73   79.73   79.73   80.07   80.34   80.00   81.10   81.10   81.10   81.79   81.44   80.41   80.76   81.10   81.44   81.03   82.13   98.63   98.28   98.28   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   99.31   98.63   98.63   98.97   98.97   98.28   98.28   98.28   98.28   98.63   98.28   98.61   98.63   98.97   98.97   98.97   99.31   99.31   98.95   98.95   99.31  100.00   99.66   97.94   97.94   97.59   97.59   97.94   97.87   97.59   98.97   98.63   98.97   98.97   99.31   97.94   97.59   98.63   98.28   98.28   98.28   98.28   98.28   98.28   98.28   98.63   98.63   90.72   95.88   93.47

   123: ABO09821.1   80.76   80.41   80.41   80.76   79.73   80.07   79.73   79.73   79.73   80.07   80.07   79.73   79.73   80.07   79.73   80.07   79.73   80.41   80.07   79.73   80.07   78.69   78.01   77.32   85.22   78.35   78.62   78.69   79.04   78.69   79.04   79.04   79.04   79.04   79.38   79.04   79.38   79.38   79.73   79.38   79.04   78.35   79.04   79.38   78.69   79.04   79.04   80.07   79.73   79.38   78.69   79.38   79.38   79.38   79.38   79.73   79.38   79.04   79.04   79.38   79.04   79.04   79.04   79.04   79.04   79.04   79.04   79.38   79.04   79.38   79.38   79.38   79.38   80.41   80.69   80.34   81.44   81.44   81.44   82.13   81.79   80.76   81.10   81.44   81.79   81.38   82.47   98.97   98.63   98.63   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   99.31   99.31   98.63   98.63   98.63   98.63   98.97   98.63   98.96   98.97   99.31   99.31   99.31   99.66   99.66   99.30   99.30   99.66   99.66  100.00   98.28   98.28   97.94   97.94   98.28   98.23   97.94   99.31   98.97   99.31   99.31   99.66   98.28   97.94   98.97   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.97   98.97   91.07   96.22   93.81

   124: CAL80726.1   80.41   80.07   80.07   80.41   79.38   79.73   80.07   80.07   80.07   79.73   80.41   80.07   80.07   80.07   80.07   80.41   80.07   80.07   80.41   80.07   80.41   78.35   77.66   77.66   84.88   78.35   78.62   78.69   79.04   78.69   79.04   79.04   79.04   79.04   79.38   79.04   79.38   79.38   79.73   79.38   79.04   78.35   79.04   79.38   78.69   79.04   79.04   79.38   79.04   78.69   78.69   78.69   78.69   78.69   78.69   79.04   78.69   79.04   79.04   79.38   79.04   79.04   79.04   79.04   79.04   79.04   79.04   79.38   79.04   79.04   79.38   79.38   79.38   80.76   80.69   80.34   81.10   81.79   81.79   81.79   81.44   81.10   81.44   81.10   81.44   81.72   82.82   97.94   97.59   97.59   97.94   97.94   97.94   97.94   97.94   97.94   97.94   97.94   97.94   97.94   97.94   97.94   98.63   98.28   97.59   97.59   97.59   98.28   97.59   97.94   97.59   97.57   97.94   98.28   98.28   98.28   98.63   98.63   97.91   97.91   97.94   97.94   98.28  100.00   99.31   99.66   97.59   97.94   97.52   97.59   98.28   98.63   98.28   98.97   98.63   98.63   97.59   97.94   98.28   98.28   98.28   98.28   98.28   98.28   98.28   98.63   98.63   90.38   95.19   92.78

   125: CAG28417.1   80.41   80.07   80.07   80.41   79.38   79.73   80.07   80.07   80.07   80.41   80.41   80.07   80.07   80.07   80.07   80.41   80.07   80.76   80.41   80.07   80.41   78.35   77.66   77.66   85.57   78.35   78.62   78.69   79.04   78.69   79.04   79.04   79.04   78.35   78.69   79.04   78.69   78.69   79.04   78.69   79.04   78.35   79.04   79.38   78.69   79.04   79.04   79.38   79.04   79.38   78.69   79.38   79.38   79.38   79.38   79.73   79.38   79.04   79.04   79.38   79.04   79.04   79.04   79.04   79.04   79.04   79.04   79.38   79.04   79.38   79.38   79.38   79.38   80.76   80.69   80.34   81.79   81.10   81.10   81.79   81.44   81.10   81.44   81.79   82.13   81.72   82.82   98.63   98.28   98.28   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   99.31   98.97   97.59   97.59   96.91   97.59   96.91   97.25   97.59   98.26   98.63   98.28   98.28   98.28   98.63   98.63   98.61   98.61   98.63   97.94   98.28   99.31  100.00   99.66   97.59   97.94   97.52   97.59   98.28   97.94   97.59   98.28   97.94   98.63   97.59   98.63   98.28   98.28   98.28   98.28   98.28   98.28   98.28   98.63   98.63   91.07   95.88   93.47

   126: AAG34108.1   80.76   80.41   80.41   80.76   79.73   80.07   80.41   80.41   80.41   80.07   80.76   80.41   80.41   80.41   80.41   80.76   80.41   80.41   80.76   80.41   80.76   78.69   78.01   78.01   85.22   78.69   78.97   79.04   79.38   79.04   79.38   79.38   79.38   78.69   79.04   79.38   79.04   79.04   79.38   79.04   79.38   78.69   79.38   79.73   79.04   79.38   79.38   79.04   78.69   79.04   79.04   79.04   79.04   79.04   79.04   79.38   79.04   79.38   79.38   79.73   79.38   79.38   79.38   79.38   79.38   79.38   79.38   79.73   79.38   79.38   79.73   79.73   79.73   81.10   81.03   80.69   81.44   81.44   81.44   81.44   81.10   81.44   81.79   81.44   81.79   82.07   83.16   98.28   97.94   97.94   98.28   98.28   98.28   98.28   98.28   98.28   98.28   98.28   98.28   98.28   98.28   98.28   98.97   98.63   97.25   97.94   97.25   97.94   97.25   97.59   97.25   97.92   98.28   97.94   97.94   97.94   98.28   98.28   98.26   98.26   98.28   97.59   97.94   99.66   99.66  100.00   97.94   98.28   97.87   97.94   98.63   98.28   97.94   98.63   98.28   98.97   97.94   98.28   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.97   98.97   90.72   95.53   93.13

   127: AAR99493.1   81.10   80.76   80.76   81.10   80.07   80.41   80.07   80.07   80.07   79.73   80.41   80.07   80.07   80.41   80.07   80.41   80.07   80.07   80.41   80.07   80.41   79.04   78.35   77.66   85.22   78.69   78.97   79.04   79.38   79.04   79.38   79.38   79.38   78.69   79.04   79.38   79.04   79.04   79.38   79.04   79.38   78.69   79.38   79.73   79.04   79.38   79.38   79.04   78.69   79.04   79.04   79.04   79.04   79.04   79.04   79.38   79.04   79.38   79.38   79.73   79.38   79.38   79.38   79.38   79.38   79.38   79.38   79.73   79.38   79.38   79.73   79.73   79.73   81.10   81.38   81.03   81.44   81.44   81.44   81.44   81.10   81.44   81.79   81.44   81.79   82.07   83.16   98.28   97.94   97.94   98.28   98.28   98.28   98.28   98.97   98.28   98.28   98.28   98.28   98.28   98.28   98.28   98.28   98.63   97.25   97.94   97.25   97.94   97.25   97.59   98.63   97.92   97.59   97.94   97.94   97.94   98.28   98.28   98.26   98.26   98.28   97.59   97.94   97.59   97.59   97.94  100.00   99.66   97.87   98.63   98.63   98.28   97.94   98.63   98.28   98.28   98.63   98.28   98.63   98.63   98.63   98.63   98.63   98.63   99.31   98.97   98.97   90.38   95.53   93.13

   128: AAF65843.1   81.44   81.10   81.10   81.44   80.41   80.76   80.41   80.41   80.41   80.07   80.76   80.41   80.41   80.76   80.41   80.76   80.41   80.41   80.76   80.41   80.76   79.38   78.69   78.01   85.57   79.04   79.31   79.38   79.73   79.38   79.73   79.73   79.73   79.04   79.38   79.73   79.38   79.38   79.73   79.38   79.73   79.04   79.73   80.07   79.38   79.73   79.73   79.38   79.04   79.38   79.38   79.38   79.38   79.38   79.38   79.73   79.38   79.73   79.73   80.07   79.73   79.73   79.73   79.73   79.73   79.73   79.73   80.07   79.73   79.73   80.07   80.07   80.07   81.44   81.72   81.38   81.79   81.79   81.79   81.79   81.44   81.79   82.13   81.79   82.13   82.41   83.51   98.63   98.28   98.28   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.97   97.59   98.28   97.59   98.28   97.59   97.94   98.97   98.26   97.94   98.28   98.28   98.28   98.63   98.63   98.61   98.61   98.63   97.94   98.28   97.94   97.94   98.28   99.66  100.00   98.23   98.97   98.97   98.63   98.28   98.97   98.63   98.63   98.97   98.63   98.97   98.97   98.97   98.97   98.97   98.97   99.66   99.31   99.31   90.72   95.88   93.47

   129: AAF93177.1   80.85   80.50   80.50   80.85   80.14   80.14   79.79   79.79   79.79   79.43   80.14   79.79   79.79   80.14   79.79   80.14   79.79   79.79   80.14   79.79   80.14   78.72   78.01   77.30   84.40   79.08   79.43   79.43   79.79   79.43   79.79   79.79   79.79   79.08   79.43   79.79   79.43   79.43   79.79   79.43   79.79   79.08   79.79   80.14   79.43   79.79   79.79   79.43   79.08   79.43   79.79   79.43   79.43   79.43   79.43   79.79   79.43   79.79   79.79   80.14   79.79   79.79   79.79   80.50   79.79   79.79   79.79   80.14   79.79   79.79   80.14   80.14   80.14   80.50   80.78   80.43   81.56   81.56   81.56   81.56   81.21   81.56   81.91   81.56   81.56   81.85   82.98   98.23   98.23   97.87   98.23   98.23   98.23   98.23   98.23   98.23   98.23   98.23   98.23   98.23   98.23   98.23   98.23   98.58   97.52   98.23   97.52   97.87   97.52   97.87   97.16   98.22   97.87   97.87   97.87   97.87   98.23   98.23   98.22   98.22   98.58   97.87   98.23   97.52   97.52   97.87   97.87   98.23  100.00   97.87   98.94   98.23   98.23   98.58   98.58   98.23   97.87   98.23   98.58   98.58   98.58   98.58   98.58   98.58   98.58   98.94   98.94   90.07   95.39   92.91

   130: AAT70415.1   81.44   81.10   81.10   81.44   80.41   80.76   80.41   80.41   80.41   80.07   80.76   80.41   80.41   80.76   80.41   80.76   80.41   80.41   80.76   80.41   80.76   79.38   78.69   78.01   84.88   78.35   78.62   78.69   79.04   78.69   79.04   79.04   79.04   78.35   78.69   79.04   78.69   78.69   79.04   78.69   79.04   78.35   79.04   79.38   78.69   79.04   79.04   78.69   78.35   78.69   78.69   78.69   78.69   78.69   78.69   79.04   78.69   79.04   79.04   79.38   79.04   79.04   79.04   79.04   79.04   79.04   79.04   79.38   79.04   79.04   79.38   79.38   79.38   80.76   81.03   80.69   81.44   81.44   81.44   81.44   81.10   81.44   81.79   81.44   81.79   81.72   82.82   98.28   97.94   97.94   98.28   98.28   98.28   98.28   98.28   98.28   98.28   98.63   98.28   98.28   98.28   98.28   98.28   98.63   97.94   98.63   97.94   98.63   97.94   98.28   97.94   97.92   98.28   97.94   97.94   97.94   98.28   98.28   98.26   98.26   98.28   97.59   97.94   97.59   97.59   97.94   98.63   98.97   97.87  100.00   98.63   98.28   97.94   98.63   98.28   98.97   98.63   98.28   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.97   98.97   90.38   95.53   93.13

   131: AAL86924.1   81.44   81.10   81.10   81.44   80.41   80.76   80.41   80.41   80.41   80.07   80.76   80.41   80.41   80.76   80.41   80.76   80.41   80.41   80.76   80.41   80.76   79.38   78.69   78.01   85.22   79.04   79.31   79.38   79.73   79.38   79.73   79.73   79.73   79.04   79.38   79.73   79.38   79.38   79.73   79.38   79.73   79.04   79.73   80.07   79.38   79.73   79.73   79.38   79.04   79.38   79.38   79.38   79.38   79.38   79.38   79.73   79.38   79.73   79.73   80.07   79.73   79.73   79.73   79.73   79.73   79.73   79.73   80.07   79.73   79.73   80.07   80.07   80.07   81.10   81.38   81.03   81.44   81.44   81.44   81.44   81.10   81.44   81.79   81.44   81.79   82.07   83.16   98.97   98.63   98.63   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   99.31   98.63   99.31   98.63   98.63   98.63   98.97   97.94   98.96   98.97   98.63   98.63   98.63   98.97   98.97   99.30   99.30   99.66   98.97   99.31   98.28   98.28   98.63   98.63   98.97   98.94   98.63  100.00   98.97   99.31   99.31   99.66   98.97   98.63   98.97   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.66   99.66   91.07   96.22   93.81

   132: ABB17185.1   80.76   80.41   80.41   80.76   79.73   80.07   79.73   79.73   79.73   79.38   80.07   79.73   79.73   80.07   80.07   80.07   79.73   79.73   80.07   79.73   80.07   78.69   78.01   77.32   84.88   78.35   78.62   79.38   79.04   78.69   79.04   79.04   79.04   79.04   79.38   79.73   79.38   80.07   79.73   79.73   79.04   78.35   79.04   79.38   78.69   79.04   79.04   79.38   79.04   78.69   78.69   78.69   78.69   78.69   78.69   79.04   78.69   79.04   79.04   79.38   79.04   79.04   79.04   79.04   79.04   79.04   79.04   79.38   79.38   79.04   79.38   79.38   79.38   80.76   81.03   80.69   81.10   81.79   81.79   81.79   81.44   81.10   81.44   81.10   81.44   81.72   82.82   98.63   98.28   98.28   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.97   98.28   98.28   98.63   98.97   98.28   98.63   98.28   98.26   97.94   98.97   98.97   98.97   99.31   99.31   98.61   98.61   98.63   98.63   98.97   98.63   97.94   98.28   98.28   98.63   98.23   98.28   98.97  100.00   99.31   99.66   99.31   98.63   98.28   98.63   98.97   99.31   99.66   98.97   99.31   98.97   98.97   99.31   99.31   90.72   95.88   93.47

   133: AAL99990.1   80.76   80.41   80.41   80.76   79.73   80.07   79.73   79.73   79.73   79.38   80.07   79.73   79.73   80.07   80.41   80.07   79.73   79.73   80.07   79.73   80.07   78.69   78.01   77.32   84.54   78.35   78.62   79.04   79.04   78.69   79.04   79.04   79.04   79.04   79.38   79.38   79.38   79.73   79.73   79.73   79.04   78.35   79.04   79.38   78.69   79.04   79.04   79.38   79.04   78.69   78.69   78.69   78.69   78.69   78.69   79.04   78.69   79.04   79.04   79.38   79.04   79.04   79.04   79.04   79.04   79.04   79.04   79.38   79.38   79.04   79.38   79.38   79.38   80.41   80.69   80.34   80.76   81.44   81.44   81.44   81.10   80.76   81.10   80.76   81.10   81.38   82.47   98.28   97.94   97.94   98.28   98.28   98.28   98.28   98.28   98.28   98.28   98.28   98.28   98.28   98.28   98.28   98.28   98.63   98.63   98.63   99.31   98.63   98.63   98.97   97.94   98.26   98.28   98.63   98.63   98.63   98.97   98.97   98.61   98.61   98.97   98.97   99.31   98.28   97.59   97.94   97.94   98.28   98.23   97.94   99.31   99.31  100.00   99.31   99.66   98.28   97.94   98.28   98.63   99.31   98.97   98.63   98.97   98.63   98.63   98.97   98.97   90.38   95.53   93.13

   134: AGG08693.1   81.10   80.76   80.76   81.10   80.07   80.41   80.07   80.07   80.07   79.73   80.41   80.07   80.07   80.41   80.07   80.41   80.07   80.07   80.41   80.07   80.41   79.04   78.35   77.66   85.22   78.69   78.97   79.04   79.38   79.04   79.38   79.38   79.38   79.38   79.73   79.38   79.73   79.73   80.07   79.73   79.38   78.69   79.38   79.73   79.04   79.38   79.38   79.73   79.38   79.04   79.04   79.04   79.04   79.04   79.04   79.38   79.04   79.38   79.38   79.73   79.38   79.38   79.38   79.38   79.38   79.38   79.38   79.73   79.38   79.38   79.73   79.73   79.73   81.10   81.38   81.03   81.44   82.13   82.13   82.13   81.79   81.44   81.79   81.44   81.79   82.07   83.16   98.97   98.63   98.63   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   99.31   98.63   98.63   98.63   99.31   98.63   98.97   98.63   98.61   98.28   99.31   99.31   99.31   99.66   99.66   98.95   98.95   98.97   98.97   99.31   98.97   98.28   98.63   98.63   98.97   98.58   98.63   99.31   99.66   99.31  100.00   99.66   98.97   98.63   98.97   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.66   99.66   91.07   96.22   93.81

   135: AEI70324.1   81.10   80.76   80.76   81.10   80.07   80.41   80.07   80.07   80.07   79.73   80.41   80.07   80.07   80.41   80.07   80.41   80.07   80.07   80.41   80.07   80.41   79.04   78.35   77.66   84.88   78.69   78.97   79.04   79.38   79.04   79.38   79.38   79.38   79.38   79.73   79.38   79.73   79.73   80.07   79.73   79.38   78.69   79.38   79.73   79.04   79.38   79.38   79.73   79.38   79.04   79.04   79.04   79.04   79.04   79.04   79.38   79.04   79.38   79.38   79.73   79.38   79.38   79.38   79.38   79.38   79.38   79.38   79.73   79.38   79.38   79.73   79.73   79.73   80.76   81.03   80.69   81.10   81.79   81.79   81.79   81.44   81.10   81.44   81.10   81.44   81.72   82.82   98.63   98.28   98.28   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.97   98.97   98.97   98.97   98.97   98.97   99.31   98.28   98.61   98.63   98.97   98.97   98.97   99.31   99.31   98.95   98.95   99.31   99.31   99.66   98.63   97.94   98.28   98.28   98.63   98.58   98.28   99.66   99.31   99.66   99.66  100.00   98.63   98.28   98.63   98.97   98.97   98.97   98.97   98.97   98.97   98.97   99.31   99.31   90.72   95.88   93.47

   136: AAP43508.1   80.76   80.41   80.41   80.76   79.73   80.07   79.73   79.73   79.73   79.38   80.07   79.73   79.73   80.07   79.73   80.07   79.73   79.73   80.07   79.73   80.07   78.69   78.01   77.32   85.22   78.69   78.97   79.04   79.38   79.04   79.38   79.38   79.38   78.69   79.04   79.38   79.04   79.04   79.38   79.04   79.38   78.69   79.38   79.73   79.04   79.38   79.38   79.04   78.69   79.04   79.04   79.04   79.04   79.04   79.04   79.38   79.04   79.38   79.38   79.73   79.38   79.38   79.38   79.38   79.38   79.38   79.38   79.73   79.38   79.38   79.73   79.73   79.73   81.10   81.38   81.03   81.44   81.44   81.44   81.44   81.10   81.44   81.79   81.44   81.79   82.07   83.16   98.63   98.28   98.28   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.63   98.97   98.28   98.97   98.28   98.97   98.28   98.63   97.59   98.26   99.31   98.28   98.28   98.28   98.63   98.63   98.61   98.61   98.63   97.94   98.28   98.63   98.63   98.97   98.28   98.63   98.23   98.97   98.97   98.63   98.28   98.97   98.63  100.00   98.28   98.63   98.97   98.97   98.97   98.97   98.97   98.97   98.97   99.31   99.31   90.72   95.88   93.47

   137: ABV81082.1   81.44   81.10   81.10   81.44   80.41   80.76   80.41   80.41   80.41   80.07   80.76   80.41   80.41   80.76   80.41   80.76   80.41   80.41   80.76   80.41   80.76   79.38   78.69   78.01   84.88   78.35   78.62   78.69   79.04   78.69   79.04   79.04   79.04   78.35   78.69   79.04   78.69   78.69   79.04   78.69   79.04   78.35   79.04   79.38   78.69   79.04   79.04   78.69   78.35   78.69   78.69   78.69   78.69   78.69   78.69   79.04   78.69   79.04   79.04   79.38   79.04   79.04   79.04   79.04   79.04   79.04   79.04   79.38   79.04   79.04   79.38   79.38   79.38   81.10   81.72   81.38   82.13   82.13   82.13   82.13   81.79   82.13   82.47   82.13   82.47   82.41   83.51   98.28   97.94   97.94   98.28   98.28   98.28   98.28   98.28   98.28   98.28   98.63   98.28   98.28   98.28   98.28   98.28   98.63   97.25   97.94   97.25   97.94   97.25   97.59   97.94   97.92   97.59   97.94   97.94   97.94   98.28   98.28   98.26   98.26   98.28   97.59   97.94   97.59   97.59   97.94   98.63   98.97   97.87   98.63   98.63   98.28   97.94   98.63   98.28   98.28  100.00   98.28   98.63   98.63   98.63   98.63   98.63   98.63   99.31   98.97   98.97   90.38   95.53   93.13

   138: AKO63214.1   80.76   80.41   80.41   80.76   79.73   80.07   79.73   79.73   79.73   80.07   80.07   79.73   79.73   80.07   79.73   80.07   80.07   80.41   80.07   79.73   80.07   78.69   78.01   77.32   85.91   78.69   78.97   79.04   79.38   79.04   79.38   79.38   79.38   78.69   79.04   79.38   79.04   79.04   79.38   79.04   79.38   78.69   79.38   79.73   79.04   79.38   79.38   79.73   79.38   79.73   79.04   79.73   79.73   79.73   79.73   80.07   79.73   79.38   79.38   79.73   79.38   79.38   79.38   79.38   79.38   79.38   79.38   79.73   79.38   79.73   79.73   79.73   79.73   81.10   81.38   81.03   81.79   81.10   81.10   81.79   81.44   81.10   81.44   81.79   82.13   81.72   82.82   99.31   98.97   98.97   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.66   98.28   98.28   97.59   98.28   97.59   97.94   98.28   98.96   98.63   98.97   98.97   98.97   99.31   99.31   99.30   99.30   99.31   98.63   98.97   97.94   98.63   98.28   98.28   98.63   98.23   98.28   98.97   98.63   98.28   98.97   98.63   98.63   98.28  100.00   99.66   98.97   98.97   98.97   98.97   98.97   98.97   99.31   99.31   91.41   96.56   94.16

   139: AKO63213.1   81.10   80.76   80.76   81.10   80.07   80.41   80.07   80.07   80.07   79.73   80.41   80.07   80.07   80.41   80.07   80.41   80.41   80.07   80.41   80.07   80.41   79.04   78.35   77.66   85.57   79.04   79.31   79.38   79.73   79.38   79.73   79.73   79.73   79.04   79.38   79.73   79.38   79.38   79.73   79.38   79.73   79.04   79.73   80.07   79.38   79.73   79.73   79.38   79.04   79.38   79.38   79.38   79.38   79.38   79.38   79.73   79.38   79.73   79.73   80.07   79.73   79.73   79.73   79.73   79.73   79.73   79.73   80.07   79.73   79.73   80.07   80.07   80.07   81.44   81.72   81.38   81.44   81.44   81.44   81.44   81.10   81.44   81.79   81.44   81.79   82.07   83.16   98.97   98.63   98.63   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   99.31   97.94   98.63   97.94   98.63   97.94   98.28   97.94   98.61   98.28   98.63   98.63   98.63   98.97   98.97   98.95   98.95   98.97   98.28   98.63   98.28   98.28   98.63   98.63   98.97   98.58   98.63   99.31   98.97   98.63   99.31   98.97   98.97   98.63   99.66  100.00   99.31   99.31   99.31   99.31   99.31   99.31   99.66   99.66   91.07   96.22   93.81

   140: AAY84742.1   81.10   80.76   80.76   81.10   80.07   80.41   80.07   80.07   80.07   79.73   80.41   80.07   80.07   80.41   80.76   80.41   80.07   80.07   80.41   80.07   80.41   79.04   78.35   77.66   85.22   78.69   78.97   79.38   79.38   79.04   79.38   79.38   79.38   78.69   79.04   79.73   79.04   79.38   79.38   79.38   79.38   78.69   79.38   79.73   79.04   79.38   79.38   79.04   78.69   79.04   79.04   79.04   79.04   79.04   79.04   79.38   79.04   79.38   79.38   79.73   79.38   79.38   79.38   79.38   79.38   79.38   79.38   79.73   79.73   79.38   79.73   79.73   79.73   81.10   81.38   81.03   81.44   81.44   81.44   81.44   81.10   81.44   81.79   81.44   81.79   82.07   83.16   98.97   98.63   98.63   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   99.31   97.94   98.63   98.63   98.63   97.94   98.28   97.94   98.61   98.28   98.63   98.63   98.63   98.97   98.97   98.95   98.95   98.97   98.28   98.63   98.28   98.28   98.63   98.63   98.97   98.58   98.63   99.31   99.31   99.31   99.31   98.97   98.97   98.63   98.97   99.31  100.00   99.66   99.31   99.66   99.31   99.31   99.66   99.66   91.07   96.22   93.81

   141: ABP04245.1   81.10   80.76   80.76   81.10   80.07   80.41   80.07   80.07   80.07   79.73   80.41   80.07   80.07   80.41   80.41   80.41   80.07   80.07   80.41   80.07   80.41   79.04   78.35   77.66   85.22   78.69   78.97   79.73   79.38   79.04   79.38   79.38   79.38   78.69   79.04   80.07   79.04   79.73   79.38   79.38   79.38   78.69   79.38   79.73   79.04   79.38   79.38   79.04   78.69   79.04   79.04   79.04   79.04   79.04   79.04   79.38   79.04   79.38   79.38   79.73   79.38   79.38   79.38   79.38   79.38   79.38   79.38   79.73   79.73   79.38   79.73   79.73   79.73   81.10   81.38   81.03   81.44   81.44   81.44   81.44   81.10   81.44   81.79   81.44   81.79   82.07   83.16   98.97   98.63   98.63   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   99.31   97.94   98.63   98.28   98.63   97.94   98.28   97.94   98.61   98.28   98.63   98.63   98.63   98.97   98.97   98.95   98.95   98.97   98.28   98.63   98.28   98.28   98.63   98.63   98.97   98.58   98.63   99.31   99.66   98.97   99.31   98.97   98.97   98.63   98.97   99.31   99.66  100.00   99.31   99.66   99.31   99.31   99.66   99.66   91.07   96.22   93.81

   142: AAV97957.1   81.10   80.76   80.76   81.10   80.07   80.41   80.07   80.07   80.07   79.73   80.41   80.07   80.07   80.41   80.07   80.41   80.07   80.07   80.41   80.07   80.41   79.04   78.35   77.66   85.22   78.69   78.97   79.04   79.38   79.04   79.38   79.38   79.38   78.69   79.04   79.38   79.04   79.04   79.38   79.04   79.38   78.69   79.38   79.73   79.04   79.38   79.38   79.04   78.69   79.04   79.04   79.04   79.04   79.04   79.04   79.38   79.04   79.38   79.38   79.73   79.38   79.38   79.38   79.38   79.38   79.38   79.38   79.73   79.38   79.38   79.73   79.73   79.73   81.10   81.38   81.03   81.44   81.44   81.44   81.44   81.10   81.44   81.79   81.44   81.79   82.07   83.16   98.97   98.63   98.63   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   99.31   97.94   98.63   97.94   98.63   97.94   98.28   97.94   98.61   98.28   98.63   98.63   98.63   98.97   98.97   98.95   98.95   98.97   98.28   98.63   98.28   98.28   98.63   98.63   98.97   98.58   98.63   99.31   98.97   98.63   99.31   98.97   98.97   98.63   98.97   99.31   99.31   99.31  100.00   99.31   99.31   99.31   99.66   99.66   91.07   96.22   93.81

   143: ABC18328.3   81.10   80.76   80.76   81.10   80.07   80.41   80.07   80.07   80.07   79.73   80.41   80.07   80.07   80.41   80.41   80.41   80.07   80.07   80.41   80.07   80.41   79.04   78.35   77.66   85.22   78.69   78.97   79.38   79.38   79.04   79.38   79.38   79.38   78.69   79.04   79.73   79.04   79.38   79.38   79.38   79.38   78.69   79.38   79.73   79.04   79.38   79.38   79.04   78.69   79.04   79.04   79.04   79.04   79.04   79.04   79.38   79.04   79.38   79.38   79.73   79.38   79.38   79.38   79.38   79.38   79.38   79.38   79.73   79.73   79.38   79.73   79.73   79.73   81.10   81.38   81.03   81.44   81.44   81.44   81.44   81.10   81.44   81.79   81.44   81.79   82.07   83.16   98.97   98.63   98.63   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   99.31   97.94   98.63   98.28   98.63   97.94   98.28   97.94   98.61   98.28   98.63   98.63   98.63   98.97   98.97   98.95   98.95   98.97   98.28   98.63   98.28   98.28   98.63   98.63   98.97   98.58   98.63   99.31   99.31   98.97   99.31   98.97   98.97   98.63   98.97   99.31   99.66   99.66   99.31  100.00   99.31   99.31   99.66   99.66   91.07   96.22   93.81

   144: ABQ45409.1   81.10   80.76   80.76   81.10   80.07   80.41   80.07   80.07   80.07   79.73   80.41   80.07   80.07   80.41   80.07   80.41   80.07   80.07   80.41   80.07   80.41   79.04   78.35   77.66   85.22   78.69   78.97   79.04   79.38   79.04   79.38   79.38   79.38   78.69   79.04   79.38   79.04   79.04   79.38   79.04   79.38   78.69   79.38   79.73   79.04   79.38   79.38   79.04   78.69   79.04   79.04   79.04   79.04   79.04   79.04   79.38   79.04   79.38   79.38   79.73   79.38   79.38   79.38   79.38   79.38   79.38   79.38   79.73   79.38   79.38   79.73   79.73   79.73   81.10   81.38   81.03   81.44   81.44   81.44   81.44   81.10   81.44   81.79   81.44   81.79   82.07   83.16   98.97   98.63   98.63   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   99.31   97.94   98.63   97.94   98.63   97.94   98.28   97.94   98.61   98.28   98.63   98.63   98.63   98.97   98.97   98.95   98.95   98.97   98.28   98.63   98.28   98.28   98.63   98.63   98.97   98.58   98.63   99.31   98.97   98.63   99.31   98.97   98.97   98.63   98.97   99.31   99.31   99.31   99.31   99.31  100.00   99.31   99.66   99.66   91.07   96.22   93.81

   145: ABW86620.2   81.44   81.10   81.10   81.44   80.41   80.76   80.41   80.41   80.41   80.07   80.76   80.41   80.41   80.76   80.41   80.76   80.41   80.41   80.76   80.41   80.76   79.38   78.69   78.01   85.57   79.04   79.31   79.38   79.73   79.38   79.73   79.73   79.73   79.04   79.38   79.73   79.38   79.38   79.73   79.38   79.73   79.04   79.73   80.07   79.38   79.73   79.73   79.38   79.04   79.38   79.38   79.38   79.38   79.38   79.38   79.73   79.38   79.73   79.73   80.07   79.73   79.73   79.73   79.73   79.73   79.73   79.73   80.07   79.73   79.73   80.07   80.07   80.07   81.44   81.72   81.38   81.79   81.79   81.79   81.79   81.44   81.79   82.13   81.79   82.13   82.41   83.51   98.97   98.63   98.63   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   98.97   99.31   97.94   98.63   97.94   98.63   97.94   98.28   98.63   98.61   98.28   98.63   98.63   98.63   98.97   98.97   98.95   98.95   98.97   98.28   98.63   98.28   98.28   98.63   99.31   99.66   98.58   98.63   99.31   98.97   98.63   99.31   98.97   98.97   99.31   98.97   99.31   99.31   99.31   99.31   99.31   99.31  100.00   99.66   99.66   91.07   96.22   93.81

   146: BAD34467.1   81.44   81.10   81.10   81.44   80.41   80.76   80.41   80.41   80.41   80.07   80.76   80.41   80.41   80.76   80.41   80.76   80.41   80.41   80.76   80.41   80.76   79.38   78.69   78.01   85.57   79.04   79.31   79.38   79.73   79.38   79.73   79.73   79.73   79.04   79.38   79.73   79.38   79.38   79.73   79.38   79.73   79.04   79.73   80.07   79.38   79.73   79.73   79.38   79.04   79.38   79.38   79.38   79.38   79.38   79.38   79.73   79.38   79.73   79.73   80.07   79.73   79.73   79.73   79.73   79.73   79.73   79.73   80.07   79.73   79.73   80.07   80.07   80.07   81.44   81.72   81.38   81.79   81.79   81.79   81.79   81.44   81.79   82.13   81.79   82.13   82.41   83.51   99.31   98.97   98.97   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.66   98.28   98.97   98.28   98.97   98.28   98.63   98.28   98.96   98.63   98.97   98.97   98.97   99.31   99.31   99.30   99.30   99.31   98.63   98.97   98.63   98.63   98.97   98.97   99.31   98.94   98.97   99.66   99.31   98.97   99.66   99.31   99.31   98.97   99.31   99.66   99.66   99.66   99.66   99.66   99.66   99.66  100.00  100.00   91.41   96.56   94.16

   147: CAA71321.1   81.44   81.10   81.10   81.44   80.41   80.76   80.41   80.41   80.41   80.07   80.76   80.41   80.41   80.76   80.41   80.76   80.41   80.41   80.76   80.41   80.76   79.38   78.69   78.01   85.57   79.04   79.31   79.38   79.73   79.38   79.73   79.73   79.73   79.04   79.38   79.73   79.38   79.38   79.73   79.38   79.73   79.04   79.73   80.07   79.38   79.73   79.73   79.38   79.04   79.38   79.38   79.38   79.38   79.38   79.38   79.73   79.38   79.73   79.73   80.07   79.73   79.73   79.73   79.73   79.73   79.73   79.73   80.07   79.73   79.73   80.07   80.07   80.07   81.44   81.72   81.38   81.79   81.79   81.79   81.79   81.44   81.79   82.13   81.79   82.13   82.41   83.51   99.31   98.97   98.97   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.31   99.66   98.28   98.97   98.28   98.97   98.28   98.63   98.28   98.96   98.63   98.97   98.97   98.97   99.31   99.31   99.30   99.30   99.31   98.63   98.97   98.63   98.63   98.97   98.97   99.31   98.94   98.97   99.66   99.31   98.97   99.66   99.31   99.31   98.97   99.31   99.66   99.66   99.66   99.66   99.66   99.66   99.66  100.00  100.00   91.41   96.56   94.16

   148: BAF63422.1   80.76   81.10   81.10   80.76   80.41   80.76   80.41   80.41   80.41   80.76   80.76   80.41   80.41   80.76   80.41   80.76   80.41   81.10   80.76   80.76   80.76   79.73   79.04   78.35   90.03   86.94   87.24   87.29   87.29   87.29   87.63   87.63   87.63   86.94   87.29   87.63   87.29   87.29   87.63   87.29   87.29   86.94   87.63   87.97   87.29   87.63   87.63   87.97   87.63   87.97   87.29   87.97   87.97   87.97   87.97   88.32   87.97   87.63   87.63   87.97   87.63   87.63   87.63   87.63   87.63   87.63   87.63   87.63   87.63   87.97   87.63   87.97   87.97   83.85   84.14   83.79   83.85   83.16   83.16   83.85   83.51   83.85   83.51   83.85   84.19   84.14   84.88   91.41   91.07   91.07   91.41   91.41   92.10   91.41   91.41   91.41   91.41   91.41   91.41   91.41   91.41   91.75   91.75   91.75   90.38   90.38   89.69   90.38   89.69   90.03   90.38   90.97   90.72   91.07   91.07   91.07   91.41   91.41   91.29   91.29   91.41   90.72   91.07   90.38   91.07   90.72   90.38   90.72   90.07   90.38   91.07   90.72   90.38   91.07   90.72   90.72   90.38   91.41   91.07   91.07   91.07   91.07   91.07   91.07   91.07   91.41   91.41  100.00   94.85   95.88

   149: AFQ94051.1   81.79   81.44   81.44   81.79   80.76   81.10   80.76   80.76   80.76   81.10   81.10   80.76   80.76   81.10   80.76   81.10   80.76   81.44   81.10   80.76   81.10   79.73   79.04   78.35   89.00   81.79   82.07   82.13   82.13   82.13   82.47   82.47   82.47   81.79   82.13   82.47   82.13   82.13   82.47   82.13   82.13   81.79   82.47   82.82   82.13   82.47   82.47   82.82   82.47   82.82   82.13   82.82   82.82   82.82   82.82   83.16   82.82   82.47   82.47   82.82   82.47   82.47   82.47   82.47   82.47   82.47   82.47   82.82   82.47   82.82   82.47   82.82   82.82   82.82   83.10   82.76   83.51   82.82   82.82   83.51   83.16   82.82   83.16   83.51   83.85   84.14   84.88   96.56   96.22   96.22   96.56   96.56   96.56   96.56   96.56   96.56   96.56   96.56   96.56   96.56   96.56   96.56   96.56   96.91   95.53   95.53   94.85   95.53   94.85   95.19   95.53   96.18   95.88   96.22   96.22   96.22   96.56   96.56   96.52   96.52   96.56   95.88   96.22   95.19   95.88   95.53   95.53   95.88   95.39   95.53   96.22   95.88   95.53   96.22   95.88   95.88   95.53   96.56   96.22   96.22   96.22   96.22   96.22   96.22   96.22   96.56   96.56   94.85  100.00   96.91

   150: AFA51701.1   81.10   81.79   81.79   81.10   80.76   81.10   80.76   80.76   80.76   81.10   81.10   80.76   80.76   81.10   80.76   81.10   80.76   81.44   81.10   80.76   81.10   79.73   79.38   78.69   85.91   84.19   84.48   84.54   84.54   84.54   84.88   84.88   84.88   84.19   84.54   84.88   84.54   84.54   84.88   84.54   84.54   84.19   84.88   85.22   84.54   84.88   84.88   85.22   84.88   85.22   84.54   85.22   85.22   85.22   85.22   85.57   85.22   84.88   84.88   85.22   84.88   84.88   84.88   84.88   84.88   84.88   84.88   85.22   84.88   85.22   84.88   85.22   85.22   82.82   83.45   83.10   82.82   82.13   82.13   82.82   82.47   82.82   82.47   82.82   83.16   83.45   84.19   94.16   93.81   93.81   94.16   94.16   94.16   94.16   94.16   94.16   94.16   94.16   94.16   94.16   94.16   94.50   94.16   94.50   93.13   93.13   92.44   93.13   92.44   92.78   93.13   93.75   93.47   93.81   93.81   93.81   94.16   94.16   94.08   94.08   94.16   93.47   93.81   92.78   93.47   93.13   93.13   93.47   92.91   93.13   93.81   93.47   93.13   93.81   93.47   93.47   93.13   94.16   93.81   93.81   93.81   93.81   93.81   93.81   93.81   94.16   94.16   95.88   96.91  100.00

 

 

CLUSTAL O(1.2.4) multiple sequence alignment

 

 

CBL80615.1      MMTQSIRRSMLTVMATLPLLFSSATLHAQTNSVQQQLEALEKSSGGRLGVALINTADNSQ

CAQ42486.1      MMTQSIRRSMLTVMATLPLLFSSATLHAQTNSVQQQLEALEKSSGGRLGVALINTADNSQ

AAC32890.1      MMTQSIRRSMLTVMATLPLLFSSATLHAQTNSVQQQLEALEKSSGGRLGVALINTADNSQ

CAQ42480.1      MMTQSIRRSMLTVMATLPLLFSSATLHAQTNSVQQQLKALEKSSGGRLGVALINTADNSQ

AIL54055.1      MMTQSIRRSMLTVMATLPLLFSSATLHAQANSVQQQLEALEKSSGGRLGVALINTADNSQ

AFH88134.1      MMTQSIRRSMLTVMATLPLLFSSATLHAQANSVQQQLEALEKSSGGRLGVALINTADNSQ

AGN11769.1      MMTQSIRRSMLTVMATLPLLFSSATLHAQANSVQQQLEALEKSSGGRLGVALINTADNSQ

ACY74743.1      MMTQSIRRSMLTVMATLPLLFSSATLHAQANSVQQQLEALEKSSGGRLGVALINTADNSQ

CAD99181.1      MMTQSIRRSMLTVMATLPLLFSSATLHAQANSVQQQLEALEKSSGGRLGVALINTADNSQ

AAZ14955.1      MMTQSIRRSMLTVMATLPLLFSSATLHAQANSVQQQLEALEKSSGGRLGVALINTADNSQ

ABD73290.1      MMTQSIRRSMLTVMATLPLLFSSATLHAQANSVQQQLEALEKSSGGRLGVALINTADNSQ

ABN48311.1      MMTQSIRRSMLTVMATLPLLFSSATLHAQANSVQQQLEALEKSSGGRLGVALINTADNSQ

BAA07082.1      MMTQSIRRSMLTVMATLPLLFSSATLHAQANSVQQQLEALEKSSGGRLGVALINTADNSQ

CAC95175.1      MMTQSIRRSMLTVMATLPLLFSSATLHAQANSVQQQLEALEKSSGGRLGVALINTADNSQ

ACS32293.1      MMTQSIRRSMLTVMATLPLLFSSATLHAQANSVQQQLEALEKSSGGRLGVALINTADNSQ

ACS32294.1      MMTQSIRRSMLTVMATLSLLFSSATLHAQANSVQQQLEALEKSSGGRLGVALINTADNSQ

ADM08178.1      MMTQSIGRSMLTVMATLPLLFSSATLHAQANSVQQQLEALEKSSGGRLGVALINTADNSQ

AEW46676.3      MMTQSIRRSMLTVMATLPLLFSSATLHAQANSVQQQLEALEKSSGGRLGVALINTADNSQ

AKR53960.1      MMTQSIRRSMLTVMATLPLLFSSATLHAQASSVQQQLEALEKSSGGRLGVALINTADNSQ

ALR99814.1      MMTQSIRRSMLTVMATLPLLFSSATLHAQANSVQQQLEALEKSSGGRLGVALINTADNSQ

CAA63263.1      MMTQSIRRSMLTVMATLPLLFSSATLHAQANSVQQQLEALEKSSGGRLGVALINTADNSQ

CAA06311.1      MMTQSIRRSMLTVMATLPLLFSSATLHAQANSVQQQLEALEKSSGGRLGVALINTADNSQ

CAA06312.1      MMTQSIRRSMLTVMATLPLLFSSATLHAQANSVQQQLEALEKSSGGRLGVALINTADNSQ

CAA74573.1      MMTQSIRRSMLTVMATLPLLFSSATLHAQANSVQQQLEALEKSSGGRLGVAQINTADNSQ

BAO37256.1      MVTKRVQRMMFAAAACIPLLLGSAPLYAQTSAVQQKLAALEKSSGGRLGVALIDTADNTQ

CAD08929.1      MVTKRVQRMMFAGGAGIPLLLGSAPFYAQTSAGQQKLAALEKSSGGRLGVALIDTADNTQ

ADZ31262.1      MVTKRVQRMMFAAAACIPLLLGSAPLYAQTSAVQQKLAALEKSSGGRLGVALIDTADNTQ

ADL27532.1      MVTKRVQRMMFAAAACIPLLLGSAPLYAQTSAVQQKLAALEKSSGGRLGVALIDTADNTQ

AFA51700.1      MVTKRVQRMMFAAAACIPLLLGSAPLYAQTSAVQQKLAALEKSSGGRLGVALIDTADNTQ

AFJ59957.1      MVTKRVQRMMFAAAACIPLLLGSAPLYAQTSAVQQKLAALEKSSGGRLGVALIDTADNTQ

AFO69261.1      MVTKRVQRMMFAAAACIPLLLGSAPLYAQTSAVQQKLAALEKSSGGRLGVALIDTADNTQ

ADY02555.1      MVTKRVQRMMFAAAACIPLLLGSAPLYAQTSAVQQKLAALEKSSGGRLGVALIDTADNTQ

AAN38836.1      MVTKRVQRMMFAAAACIPLLLGSAPLYAQTSAVQQKLAALEKSSGGRLGVALIDTADNTQ

AHX39589.1      MVTKRVQRMMFAAAACIPLLLGSAPLYAQTSAVQQKLAALEKSSGGRLGVALIDTADNTQ

ABN69105.1      MVTKRVQRMMFAAAACIPLLLGSAPLYAQTSAVQQKLAALEKSSGGRLGVALIDTADNTQ

AAK55534.1      MVTKRVQRMMFAAAACIPLLLGSAPLYAQTSAVQQKLAALEKSSGGRLGVALIDTADNTQ

ABA62022.1      MVTKRVQRMMFAAAACIPLLLGSAPLYAQTSAVQQKLAALEKSSGGRLGVALIDTADNTQ

AHA80961.1      MVTKRVQRMMFAAAACIPLLLGSAPLYAQTSAVQQKLAALEKSSGGRLGVALIDTADNTQ

ACQ99521.1      MVTKRVQRMMFAAAACIPLLLGSAPLYAQTSAVQQKLAALEKSSGGRLGVALIDTADNTQ

ACB41777.1      MVTKRVQRMMFAAAACIPLLLGSAPLYAQTSAVQQKLAALEKSSGGRLGVALIDTADNTQ

AAF72531.1      MVTKRMQRMMFAAAACIPLLLGSAPLYAQTSAVQQKLAALEKSSGGRLGVALIDTKDNTQ

ABV57756.3      MVTKRVQRMMFAAAACIPLLLGSAPLYAQTSAVQQKLAALEKSSGGRLGVALIDTADNTQ

AAV97952.1      MVTKRVQRMMFAAAACIPLLLGSAPLYAQTSAVQQKLAALEKSSGRRLGVALIDTADNTQ

AAV97953.1      MVTKRVQRMMFAAAACIPLLLGSAPLYAQTNAVQQKLAALEKSSGGRLGVALIDTADNTQ

AAV97954.1      MVTKRVQRMMFAAAACIPLLLGSAPLYAQTSAVQQKLAALEKSSGRRLGVPLIDTADNTQ

AAV97956.1      MVTKRVQRMMFAAAACIPLLLGSAPLYAQTNAVQQKLAALEKSSGGRLGVPLIDTADNTQ

AAV97955.1      MVTKRVQRMMFAAAACIPLLLGSAPLYAQTSAVQQKLAALEKSSGGRLGVPLIDTADNTQ

ADO17948.1      MVTKRVQRMMFAAAACIPLLLGSAPLYAQTSAVQQKLAALEKSSGGRLGVALIDTADNTQ

ADY02554.1      MVTKRVQRMMFAAAACIPLLLGSAPLYAQTSAVQQKLAALEKSSGGRLGVALIDTADNTQ

ADY02546.1      MVTKRVQRMMFAAAACIPLLLGSAPLYAQTSAVQQKLAALEKSSGGRLGVALIDTADNTQ

AEM44648.1      MVTKRVQRMMFAAAACIPLLLGSAPLYAQTSAVQQKLAALEKSSGGRLGVALIDTADNTQ

ADN26580.1      MVTKRVQRMMFAAAACIPLLLGSAPLYAQTSAVQQKLAALEKSSGGRLGVALIDTADNTQ

AFA51699.1      MVTKRVQRMMFAAAACIPLLLGSAPLYAQTSAVQQKLAALEKSSGGRLGVALIDTADNTQ

AFJ59956.1      MVTKRVQRMMFAAAACIPLLLGSAPLYAQTSAVQQKLAALEKSSGGRLGVALIDTADNTQ

BAP18874.1      MVTKRVQRMMFAAAACIPLLLGSAPLYAQTSAVQQKLAALEKSSGGRLGVALIDTADNTQ

AAO61597.1      MVTKRVQRMMFAAAACIPLLLGSAPLYAQTSAVQQKLAALEKSSGGRLGVALIDTADNTQ

AAK32961.1      MVTKRVQRMMFAAAACIPLLLGSAPLYAQTSAVQQKLAALEKSSGGRLGVALIDTADNTQ

AAV70602.1      MVTKRVQRMMFAAAACIPLLLGSAPLYAQTSAVQQKLAALEKSSGGRLGVALIDTADNTQ

AAF05311.2      MVTKRVQRMMFAAAACIPLLLGSAPLYAQTSAVQQKLAALEKSSGGRLGVALIDTADNTQ

AAK71471.1      MVTKRVQRMMFAAAACIPLLLGSAPLYAQTSAVQQKLAALEKSSGGRLGVALIDTADNTQ

ABS90365.1      MVTKRVQRMMFAAAACIPLLLGSAPLYAQTSAVQQKLAALEKSSGGRLGVALIDTADNTQ

ACI29345.1      MVTKRVQRMMFAAAACIPLLLGSAPLYAQTSAVQQKLAALEKSSGGRLGVALIDTADNTH

ACI29346.1      MVTKRVQRMMFAAAACIPLLLGSAPLYAQTSAVQQKLAALEKSSGGRLGVALIDTADNTQ

ACI29347.1      MVTKRVQRMMFAAAACIPLLLGSAPLYAQTSAVQQKLAALEKSSGGRLGVALIDTADNTQ

ACI29348.1      MVTKRVQRMMFAAAACIPLLLGSAPLYAQTSAVQQKLAALEKSSGGRLGVALIDTADNTQ

AEM44649.1      MVTKRVQRMMFAAAACIPLLLGSAPLYAQTSAVQQKLAALEKSSGGRLGVALIDTADNTQ

AEM44652.1      MVTKRVQRMMFAAAACIPLLLGSAPLYAQTSAVQQKLAALEKSSGGRLGVALIDTADNTQ

AEM44653.1      MVTKRVQRMMFAAAACIPLLLGSAPLYAQTSAVQQKLAALEKSSGGRLGVALIDTADNTQ

BAL72196.1      MVTKRVQRMMFAAAACIPLLLGSAPLYAQTSAVQQKLAALEKSSGGRLGVALIDTADNTQ

AFX60298.1      MVTKRVQRMMFAAAACIPLLLGSAPLYAQTSAVQQKLAALEKSSGGRLGVALIDTADNTQ

AJU57235.1      MVTKRVQRMMFAAAACIPLLLGSAPLYAQTSAVQQKLAALEKSSGGRLGVALIDTADNTQ

AAF72530.1      MVTKRVQRMMFAAAACIPLLLGSAPLYAQTSAVQQKLAALEKSSGGRLGVALIDTADNTQ

AAK55533.1      MVTKRVQRMMFAAAACIPLLLGSAPLYAQTSAVQQKLAALEKSSGGRLGVALIDTADNTQ

AAF04388.1      MMRHRVKRMMLMTTACISLLLGSAPLYAQANDVQQKLAALEKSSGGRLGVALIDTADNAQ

AAV28215.2      -MRHRVKRMMLMTTACISLLLGSAPLYAQANDVQQKLAALEKSSGGRLGVALIDTADNAQ

BAD90119.1      -MRHRVKRMMLMTTACISLLLGSAPLYAQANDVQQKLAALEKSSGGRLGVALIDTADNAQ

AAY43008.1      MMRKSVRRAMLMTTACVSLLLASVPLCAQANDVQQKLAALEKSSGGRLGVALINTADNTQ

ACX34099.1      MMRKSVRRAMLMTTACVSLLLASVPLCAQANDVQQKLAALEKSSGGRLGVALINTADNTQ

ACR56321.1      MMRKSVRRAMLMTTACVSLLLASVPLCAQANDVQQKLAALEKSSGGRLGVALINTADNTQ

AJO16046.1      MMRKSVRRAMLMTTACVSLLLASVPLCAQANDVQQKLAALEKSSGGRLGVALINTADNTQ

AAM70498.1      MMRKSVRRAMLMTTACVSLLLASVPLCAQANDVQQKLAALEKSSGGRLGVALINTADNTQ

AAN75444.1      MMRKSVRRAMLMTTACVSLLLASVPLCAQANDVQQKLAALEKSSGGRLGVALINTADNTQ

AAX54694.1      MMRKSVRRAMLMTTACVSLLLASVPLCAQANDVQQKLAALEKSSGGRLGVALINTADNTQ

CBW46935.1      MMRKSVRRAMLMTTACVSLLLASVPLCAQANDVQQKLAALEKSSGGRLGVALINTADNTQ

ADK11041.1      MMRKSVRRAMLMTTACVSLLLASVPLCAQANDVQQKLAALEKSSGGRLGVALINTADNTQ

AHY20039.1      -MRKSVRRAILMTTACVSLLLASVPLYAHANDVQQKLAALEKSSGGRLGVALINTADNTQ

CAQ42481.2      MMRKSVRRAILMTTACVSLLLASVPLYAQANDIQQKLAALEKSSGGRLGVALINTADNTQ

AIS67613.1      MVKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQ

AIS67611.1      MVKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQ

AHF20911.1      MVKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQ

AAO88912.1      MVKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQ

AKS25179.1      MVKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQ

ABB59946.1      MVKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQ

ACP18863.1      MVKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQ

ACV92002.1      MVKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQ

ADY02545.1      MVKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQ

AET99223.1      MVKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQ

AFY98865.1      MVKKSLRQFTLMATATVTLLLGSVPLFAQTADVQQKLAELERQSGGRLGVALINTADNSQ

CDG50843.1      MVKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQ

AGW25368.1      MVKKSLRQFTLMATATVTLLLGSVPLYAQTANVQQKLAELERQSGGRLGVALINTADNSQ

AIS67612.1      MVKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQ

ALK03059.1      MVKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQ

ALL29307.1      MVKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQ

AAL02127.1      MVKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQ

CAD89606.1      MVKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQ

BAD16611.1      MVKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQ

ABM97538.1      MVKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQ

ABN09669.1      MVKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQ

AIT97310.1      MVKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQ

CAA63262.1      MVKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQ

ABB72225.1      MVKKSLRQFTLMATATVTLLLGSVPLYAQTVDVQQKLAELEQQSGGRLGVALINTADNSQ

AEM44654.1      -VKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSR

AAP22736.1      MVKKSLRQFTLMATAAVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQ

ACU00153.1      MVKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQ

AHX39588.1      MVKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQ

AKR53959.1      MVKKSLRKFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQ

ABI34705.1      MVKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQ

ABG80523.1      MVKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQ

AEM44650.1      -VKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQ

AEM44651.1      -VKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQ

CAD70280.1      MVKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQ

ABY91281.1      MVKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQ

ABO09821.1      MVKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQ

CAL80726.1      MVKKSLRQFTLMATAAVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQ

CAG28417.1      MVKKSLRQFTLMATAAVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQ

AAG34108.1      MVKKSLRQFTLMATAAVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQ

AAR99493.1      MVKKSLRQFTLMATATVTLLLGSVPLYAQTVDVQQKLAELEQQSGGRLGVALINTADNSQ

AAF65843.1      MVKKSLRQFTLMATATVTLLLGSVPLYAQTVDVQQKLAELEQQSGGRLGVALINTADNSQ

AAF93177.1      MVKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAGLERQSGGRLGVALINTADNSQ

AAT70415.1      MVKKSLRQFTLMATATVTLLLGSVPLHAQTADVQQKLAELEQQSGGRLGVALINTADNSQ

AAL86924.1      MVKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQ

ABB17185.1      MVKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQ

AAL99990.1      MVKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQ

AGG08693.1      MVKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQ

AEI70324.1      MVKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQ

AAP43508.1      MVKKSLRQFTLMATAAVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQ

ABV81082.1      MVKKSLRQFTLMATATVTLLLGSVPLHAQTVDVQQKLAELERQSGGRLGVALINTADNSQ

AKO63214.1      MVKKSLSQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQ

AKO63213.1      MVKKSLSQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQ

AAY84742.1      MVKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQ

ABP04245.1      MVKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQ

AAV97957.1      MVKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQ

ABC18328.3      MVKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQ

ABQ45409.1      MVKKSLRQFTLMATATVTLLLGNVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQ

ABW86620.2      MVKKSLRQFTLMATATVTLLLGSVPLYAQTVDVQQKLAELERQSGGRLGVALINTADNSQ

BAD34467.1      MVKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQ

CAA71321.1      MVKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQ

BAF63422.1      MVKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQ

AFQ94051.1      MVKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQ

AFA51701.1      MVKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQ

                 : : : :  :   * : **:... : *::   **:*  **:.** ****  *:* **::

 

CBL80615.1      ILYRADERFAMCSTSKVMAAAALLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTM

CAQ42486.1      ILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTM

AAC32890.1      ILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTM

CAQ42480.1      ILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTM

AIL54055.1      ILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTM

AFH88134.1      ILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTM

AGN11769.1      ILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTM

ACY74743.1      ILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTM

CAD99181.1      ILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTM

AAZ14955.1      ILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTM

ABD73290.1      ILYRADERFAMCSTSKVMAAAAVLKQSESDKLLLNQRVEIKKSDLVNYNPIAEKHVNGTM

ABN48311.1      ILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTM

BAA07082.1      ILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTM

CAC95175.1      ILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTM

ACS32293.1      ILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTM

ACS32294.1      ILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTM

ADM08178.1      ILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTM

AEW46676.3      ILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTM

AKR53960.1      ILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTM

ALR99814.1      ILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQSVEIKKSDLVNYNPIAEKHVNGTM

CAA63263.1      ILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTM

CAA06311.1      ILYLADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKASDLVNYNPIAEKHVNGTM

CAA06312.1      ILYVADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIRASDLVNYNPIAEKHVNGTM

CAA74573.1      ILYVADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIRASDLVNYNPIAEKHVNGTM

BAO37256.1      VLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTM

CAD08929.1      VLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTM

ADZ31262.1      VLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTM

ADL27532.1      VLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTM

AFA51700.1      VLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTM

AFJ59957.1      VLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTM

AFO69261.1      VLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTM

ADY02555.1      VLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTM

AAN38836.1      VLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTM

AHX39589.1      VLYRGDERFPMCSTSKVIAVAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTM

ABN69105.1      VLYRGDERFPMCSTSKVMAVAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTM

AAK55534.1      VLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTM

ABA62022.1      VLYRGDERFPMCSTSKVMAVAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTM

AHA80961.1      VLYRGDERFPMCSTSKVMAVAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTM

ACQ99521.1      VLYRGDERFPMCSTSKVMAVAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTM

ACB41777.1      VLYRGDERFPMCSTSKVMAVAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTM

AAF72531.1      VLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTM

ABV57756.3      VLYRGDERFPMCSTSKVMAAAAVLEQSETQKQLLNQPVEIQPADLVNYNPIAEKHVNGTM

AAV97952.1      VLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTM

AAV97953.1      VLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTM

AAV97954.1      VLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTM

AAV97956.1      VLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTM

AAV97955.1      VLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTM

ADO17948.1      VLYRGDERFPMCSTSKVMAVAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTM

ADY02554.1      VLYRGDERFPMCSTSKVMAVAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTM

ADY02546.1      VLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTM

AEM44648.1      VLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEEHVNGTM

ADN26580.1      VLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTM

AFA51699.1      VLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPITEKHVNGTM

AFJ59956.1      VLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTM

BAP18874.1      VLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTM

AAO61597.1      VLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTM

AAK32961.1      VLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTM

AAV70602.1      VLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTM

AAF05311.2      VLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTM

AAK71471.1      VLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTM

ABS90365.1      VLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYSPIAEKHVNGTM

ACI29345.1      VLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTM

ACI29346.1      VLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTM

ACI29347.1      VLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTM

ACI29348.1      VLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPFAEKHVNGTM

AEM44649.1      VLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTM

AEM44652.1      VLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTM

AEM44653.1      VLYRGDERFPMCSTSKVMAAAAVLKRSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTM

BAL72196.1      VLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTM

AFX60298.1      VLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTM

AJU57235.1      VLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTM

AAF72530.1      VLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTM

AAK55533.1      VLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTM

AAF04388.1      TLYRADERFAMCSTSKVMAAAAVLKQSETQKKVLSQKVEIKSSDLINYNPITEKHVNGTM

AAV28215.2      TLYRADERFAMCSTSKVMAAAAVLKQSETQKNVLSQKVEIKSSDLINYNPIAEKHVNGTM

BAD90119.1      TLYRADERFAMCSTSKVMAAAAVLKQSETQKNVLSQKVEIKSSDLINYNPIAEKHVNGTM

AAY43008.1      TLYRADERFAMCSTSKVMAAAAVLKQSETQKGLLSQRVEIKPSDLVNYNPIAEKHVNGTM

ACX34099.1      TLYRADERFAMCSTSKVMAVAAVLKQSETQKGLLSQRVEIKPSDLINYNPIAEKHVNGTM

ACR56321.1      TLYRADERFAMCSTSKVMAVAAVLKQSETQKGLLSQRVEIKPSDLINYNPIAEKHVNGTM

AJO16046.1      TLYRADERFAMCSTSKVMAVAAVLKQSETQKGLLSQRVEIKPSDLVNYNPIAEKHVNGTM

AAM70498.1      TLYRADERFAMCSTSKVMAVAAVLKQSETQKGLLSQRVEIKPSDLINYNPIAEKHVNGTM

AAN75444.1      TLYRADERFAMCSTSKVMAAAAVLKQSETQKGLLSQRVEIKPSDLINYNPIAEKHVNGTM

AAX54694.1      TLYRADERFAMCSTSKVMAAAAVLKQSETQKGLLSQRVEIKPSDLINYNPIAEKHVNGTM

CBW46935.1      TLYRADERFAMCSTSKVMAAAAVLKQSETQKGLLSQRVEIKPSDLINYNPIAEKHVNGTM

ADK11041.1      TLYRADERFAMCSTSKVMAAAAVLKQSETQKGLLSQRVEIKPSDLINYNPIAEKHVNGTM

AHY20039.1      TLYRADERFAMCSTSKVMAAAAVLKQSETQKDLLSQRVEIKSSDLINYNPIAEKHVNGTM

CAQ42481.2      TLYRADERFAMCSTSKVMAAAAVLKQSETQKDLLSQRVEIKSSDLINYNPIAEKHVNGTM

AIS67613.1      ILYRADERFAMCSTSKVMAAAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVNGTM

AIS67611.1      ILYRADERFAMCSTSKVMAAAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVNGTM

AHF20911.1      ILYRADERFAMCSTSKVMAAAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVNGTM

AAO88912.1      ILYRADERFAMCSTSKVMAAAAVLKKSESEPNLLNQRVEIKKSDLVNYSPIAEKHVNGTM

AKS25179.1      ILYRADERFAMCSTSKVMAAAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVNGTM

ABB59946.1      ILYRADERFPMCSTSKVMAAAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVNGTM

ACP18863.1      ILYRADERFAMCSTSKVMAAAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVNGTM

ACV92002.1      ILYRADERFAMCSTSKVMAAAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVNGTM

ADY02545.1      ILYRADERFAMCSTSKVMAAAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVNGTM

AET99223.1      ILYRADERFAMCSTSKVMAAAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVNGTM

AFY98865.1      ILYRADERFAMCSTSKVMAAAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVNGTM

CDG50843.1      ILYRADERFAMCSTSKVMAAAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVNGTM

AGW25368.1      ILYRADERFAMCSTSKVMAAAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVNGTM

AIS67612.1      ILYRADERFAMCSTSKVMAAAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVNGTM

ALK03059.1      ILYRADERFAMCSTSKVMAAAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVNGTM

ALL29307.1      ILYRADERFAMCSTSKVMAAAAVLKKSESEPSLLNQRVEIKKSDLVNYNPIAEKHVNGTM

AAL02127.1      ILYRADERFAMCSTSKVMAAAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVNGTM

CAD89606.1      ILYRADERFAMCSTSKVMAVAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVDGTM

BAD16611.1      ILYRADERFAMCSTSKVMAAAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVDGTM

ABM97538.1      ILYRADERFAMCSTSKVMAVAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVDGTM

ABN09669.1      ILYRADERFAMCSTSKVMAVAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVDGTM

AIT97310.1      ILYRADERFAMCSTSKVMAVAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVDGTM

CAA63262.1      ILYRADERFAMCSTSKVMAVAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVDGTM

ABB72225.1      ILYRADERFAMCSTSKVMAVAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVNGTM

AEM44654.1      ILYRADERFAMCSTSKVMAAAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVNGTM

AAP22736.1      ILYRADERFAMCSTSKVMAAAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVDGTM

ACU00153.1      ILYRADERFAMCSTSKAMAVAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVNGTM

AHX39588.1      ILYRADERFAMCSTSKVMAVAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVNGTM

AKR53959.1      ILYRADERFAMCSTSKVMAVAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVNGTM

ABI34705.1      ILYRADERFAMCSTSKVMAVAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVNGTM

ABG80523.1      ILYRADERFAMCSTSKVMAVAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVNGTM

AEM44650.1      ILYRADERFAMCSTSKVMAAAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVNGTM

AEM44651.1      ILYRADERFAMCSTSKVMAAAAVLKKSESEPNLLNQRAEIKKSDLVNYNPIAEKHVNGTM

CAD70280.1      ILYRADERFAMCSTSKVMAAAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVNGTM

ABY91281.1      ILYRADERFAMCSTSKVMAVAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVNGTM

ABO09821.1      ILYRADERFAMCSTSKVMAVAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVNGTM

CAL80726.1      ILYRADERFAMCSTSKVMAVAAVLKKSESEPSLLNQRVEIKKSDLVNYNPIAEKHVNGTM

CAG28417.1      ILYRADERFAMCSTSKVMAAAAVLKKSESEPSLLNQRVEIKKSDLVNYNPIAEKHVNGTM

AAG34108.1      ILYRADERFAMCSTSKVMAAAAVLKKSESEPSLLNQRVEIKKSDLVNYNPIAEKHVNGTM

AAR99493.1      ILYRADERFAMCSTSKVMAAAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVNGTM

AAF65843.1      ILYRADERFAMCSTSKVMAAAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVNGTM

AAF93177.1      ILYRADERFAMCSTSKVMAAAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVNGTM

AAT70415.1      ILYRADERFAMCSTSKVMAAAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVDGTM

AAL86924.1      ILYRADERFAMCSTSKVMAAAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVNGTM

ABB17185.1      ILYRADERFAMCSTSKVMAVAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVNGTM

AAL99990.1      ILYRADERFAMCSTSKVMAVAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVNGTM

AGG08693.1      ILYRADERFAMCSTSKVMAVAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVNGTM

AEI70324.1      ILYRADERFAMCSTSKVMAVAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVNGTM

AAP43508.1      ILYRADERFAMCSTSKVMAAAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVDGTM

ABV81082.1      ILYRADERFAMCSTSKVMAAAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVNGTM

AKO63214.1      ILYRADERFAMCSTSKVMAAAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVNGTM

AKO63213.1      ILYRADERFAMCSTSKVMAAAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVNGTM

AAY84742.1      ILYRADERFAMCSTSKVMAAAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVNGTM

ABP04245.1      ILYRADERFAMCSTSKVMAAAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVNGTM

AAV97957.1      ILYRADERFAMCSTSKVMAAAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVNGTM

ABC18328.3      ILYRADERFAMCSTSKVMAAAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVNGTM

ABQ45409.1      ILYRADERFAMCSTSKVMAAAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVNGTM

ABW86620.2      ILYRADERFAMCSTSKVMAAAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVNGTM

BAD34467.1      ILYRADERFAMCSTSKVMAAAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVNGTM

CAA71321.1      ILYRADERFAMCSTSKVMAAAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVNGTM

BAF63422.1      ILYRADERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTM

AFQ94051.1      ILYRADERFAMCSTSKVMAAAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVNGTM

AFA51701.1      ILYRADERFAMCSTSKVMAAAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVNGTM

                 ** .**** ******.:*.**:*::**::  :*.* .**: :**:**.*::*:**:***

 

CBL80615.1      TLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTEPTLNTAIPGDP

CAQ42486.1      TLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTEPTLNTAIPGDP

AAC32890.1      TLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTEPTLNTAIPGDP

CAQ42480.1      TLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTEPTLNTAIPGDP

AIL54055.1      TLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTEPTLNTAIPGDP

AFH88134.1      TLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTEPTLNTAIPGDP

AGN11769.1      TLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTEPTLNTAIPGDP

ACY74743.1      TLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTEPTLNTAIPGDP

CAD99181.1      TLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDESFRLDRTEPTLNTAIPGDP

AAZ14955.1      TLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTEPTLNTAIPGDP

ABD73290.1      TLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTEPTLNTAIPGDP

ABN48311.1      TLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTEPTLNTAIPGDP

BAA07082.1      TLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTEPTLNTAIPGDP

CAC95175.1      TLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTEPTLNTAIPGDP

ACS32293.1      TLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTETTLNTAIPGDP

ACS32294.1      TLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTEPTLNTAIPGDP

ADM08178.1      TLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTEPTLNTAIPGDP

AEW46676.3      TLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTEPTLNTAIPGDP

AKR53960.1      TLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTEPTLNTAIPGDP

ALR99814.1      TLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTEPTLNTAIPGDP

CAA63263.1      TLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTEPTLNTAIPGDP

CAA06311.1      TLAELGAGALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTEPTLNSAIPGDP

CAA06312.1      TLAQLGAGALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTEPTLNSAIPGDP

CAA74573.1      TLAELGAGALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTEPTLNSAIPGDP

BAO37256.1      TLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDP

CAD08929.1      TLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDP

ADZ31262.1      TLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDP

ADL27532.1      TLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTESTLNTAIPGDP

AFA51700.1      TLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARSIGDETFRLDRTEPTLNTAIPGDP

AFJ59957.1      TLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDP

AFO69261.1      TLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDP

ADY02555.1      TLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDP

AAN38836.1      TLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDP

AHX39589.1      TLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDP

ABN69105.1      TLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDP

AAK55534.1      TLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTESTLNTAIPGDP

ABA62022.1      TLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDP

AHA80961.1      TLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTESTLNTAIPGDP

ACQ99521.1      TLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDP

ACB41777.1      TLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTELTLNTAIPGDP

AAF72531.1      TLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFAREIGDETFRLDRTEPTLNTAIPGDP

ABV57756.3      TLAELSAAALQYSDHTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDP

AAV97952.1      TLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDP

AAV97953.1      TLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDP

AAV97954.1      TLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDP

AAV97956.1      TLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDP

AAV97955.1      TLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDP

ADO17948.1      TLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDP

ADY02554.1      TLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDP

ADY02546.1      TLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDP

AEM44648.1      TLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDP

ADN26580.1      TLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTQNTAIPGDP

AFA51699.1      TLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDP

AFJ59956.1      TLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDP

BAP18874.1      TLAKLSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDP

AAO61597.1      TLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDP

AAK32961.1      TLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDP

AAV70602.1      TLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDP

AAF05311.2      TLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDP

AAK71471.1      TLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDP

ABS90365.1      TLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDP

ACI29345.1      TLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDP

ACI29346.1      TLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDP

ACI29347.1      TPAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDP

ACI29348.1      TLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDP

AEM44649.1      TLAELSAAALQYSDNTAMNKLIAQLGGQGGVTAFARAIGDETFRLDRTEPTLNTAIPGDP

AEM44652.1      TLAELGAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDP

AEM44653.1      TLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDP

BAL72196.1      TLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEATLNTAIPGDP

AFX60298.1      TLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDP

AJU57235.1      TLAELSAAALQYSDNTAMNKLIAQLGGPEGVTAFARAIGDETFRLDRTEPTLNTAIPGDP

AAF72530.1      TLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDP

AAK55533.1      TLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDP

AAF04388.1      TLAELSAAALQYSDNTAMNKLIAHLGGPDKVTAFARAIGDNTFRLDRTEPTLNTAIPGDP

AAV28215.2      TLAELSAAALQYSDNTAMNKLIAHLGGPDKVTAFARAIGDDTFRLDRTEPTLNTAIPGDP

BAD90119.1      TLAELSAAALQYSDNTAMNKLIAHLGGPDKVTAFARAIGDDTFRLDRTEPTLNTAIPGDP

AAY43008.1      TFGELIAAALQYSDNTAMNKLIAHLGGPDKVTAFARTIGDDTFRLDRTEPTLNTAIPGDP

ACX34099.1      TFGELSAAALQYSDNTAMNKLIAHLGGPDKVTAFARTIGDDTFRLDRTEPTLNTAIPGDP

ACR56321.1      TFGELSAAALQYSDNTAMNKLIAHLGGPDKVTAFARTIGDDTFRLDRTEPTLNTAIPGDP

AJO16046.1      TFGELSAAALQYSDNTAMNKLIAHLGGPDKVTAFARTIGDDTFRLDRTEPTLNTAIPGDP

AAM70498.1      TFGELSAAALQYSDNTAMNKLIAHLGGPDKVTAFARTIGDDTFRLDRTEPTLNTAIPGDP

AAN75444.1      TFGELSAAALQYSDNTAMNKLIAHLGGPDKVTAFARTIGDDTFRLDRTEPTLNTAIPGDP

AAX54694.1      TFGELSAAALQYSDNTAMNKLIAHLGGPDKVTAFARTIGDDTFRLDRTEPTLNTAIPGDP

CBW46935.1      TFGELSAAALQYSDNTAMNKLIAHLGGPDKVTAFARTIGDDTFRLDRTEPTLNTAIPGDP

ADK11041.1      TLGELSAAALQYSDNTAMNKLIAHLGGPDKVTAFARTIGDDTFRLDRTEPTLNTAIPGDP

AHY20039.1      TLGELSAAALQYSDNTAMNKLIAHLGGPGKVTAFARAIGDDTFRLDRTEPTLNTAIPGDP

CAQ42481.2      TLGELSAAALQYSDNTAMNKLIAHLGGPGKVTAFARVIGDDTFRLDRTEPTLNTAIPGDP

AIS67613.1      SLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTAPTLNTAIPGDP

AIS67611.1      SLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTAPTLNTAIPGDP

AHF20911.1      SLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDP

AAO88912.1      SLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDP

AKS25179.1      SLAELSAAALQYSDNVAMNKPIAHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDP

ABB59946.1      SLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDP

ACP18863.1      SLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDP

ACV92002.1      SLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDP

ADY02545.1      SLAELIAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDP

AET99223.1      SLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIQGDP

AFY98865.1      SLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDP

CDG50843.1      SLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDP

AGW25368.1      SLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDP

AIS67612.1      SLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDP

ALK03059.1      SLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDP

ALL29307.1      SLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDP

AAL02127.1      SLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDP

CAD89606.1      SLAELSAAALQYSDNVAMNKLISHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDP

BAD16611.1      SLAELSAAALQYSDNVAMNKLISHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDP

ABM97538.1      SLAELSAAALQYSDNVAMNKLISHVGGPASVTAFARQLGDETFRLDRTETTLNTAIPGDP

ABN09669.1      SLAELSAAALQYSDNVAMNKLISHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDP

AIT97310.1      SLAELSVAALQYSDNVAMNKLISHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDP

CAA63262.1      SLAELSAAALQYSDNVAMNKLISHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDP

ABB72225.1      SLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDP

AEM44654.1      SLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDP

AAP22736.1      SLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDP

ACU00153.1      SLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDP

AHX39588.1      SLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDL

AKR53959.1      SLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDP

ABI34705.1      SLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDP

ABG80523.1      SLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDP

AEM44650.1      SLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDP

AEM44651.1      SLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDP

CAD70280.1      SLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDP

ABY91281.1      SLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDP

ABO09821.1      SLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDP

CAL80726.1      SLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDP

CAG28417.1      SLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDP

AAG34108.1      SLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDP

AAR99493.1      SLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDP

AAF65843.1      SLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDP

AAF93177.1      SPAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDP

AAT70415.1      SLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDP

AAL86924.1      SLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDP

ABB17185.1      SLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTESTLNTAIPGDP

AAL99990.1      SLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTETTLNTAIPGDP

AGG08693.1      SLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDP

AEI70324.1      SLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDP

AAP43508.1      SLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDP

ABV81082.1      SLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDDTFRLDRTEPTLNTAIPGDP

AKO63214.1      SLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDP

AKO63213.1      SLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDP

AAY84742.1      SLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTETTLNTAIPGDP

ABP04245.1      SLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTESTLNTAIPGDP

AAV97957.1      SLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDGTEPTLNTAIPGDP

ABC18328.3      SLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTEQTLNTAIPGDP

ABQ45409.1      SLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDP

ABW86620.2      SLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDP

BAD34467.1      SLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDP

CAA71321.1      SLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDP

BAF63422.1      TLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDP

AFQ94051.1      TLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDP

AFA51701.1      SLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDP

                : .:* ..******:.**** *:::**   ****** :**::**** *  * *:** **

 

CBL80615.1      RDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIQAGLPKSWVVGDKTGS

CAQ42486.1      RDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWGVGDKTGS

AAC32890.1      RDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWGVGDKTGS

CAQ42480.1      RDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIQAGLPKSWVVGDKTGS

AIL54055.1      RDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGS

AFH88134.1      RDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGS

AGN11769.1      RDTTTPLAMAQTLKNLTLGKALAETQREQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGS

ACY74743.1      RDTTTPLAMAQTLKNLTLGKALAETQRTQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGS

CAD99181.1      RDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGS

AAZ14955.1      RDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGS

ABD73290.1      RDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGS

ABN48311.1      RDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGS

BAA07082.1      RDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGS

CAC95175.1      RDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGS

ACS32293.1      RDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGS

ACS32294.1      RDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGS

ADM08178.1      RDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGS

AEW46676.3      RDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGS

AKR53960.1      RDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGS

ALR99814.1      RDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGS

CAA63263.1      RDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGS

CAA06311.1      RDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKCWVVGDKTGS

CAA06312.1      RDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWGVGDKTGS

CAA74573.1      RDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGMPKSWGVGDKTGS

BAO37256.1      RDTTTPR<