#

#

#  Percent Identity  Matrix - created by Clustal2.1

#

#

 

     1: AIT76105.1              100.00   94.46   94.46   94.72   94.46   93.93   94.46   94.46   94.72   93.40   93.67   94.46   93.67   93.93   94.20   94.46   93.93   94.20   93.93

     2: tr|W1I7B7|W1I7B7_PROMI   94.46  100.00   96.83   97.63   97.36   96.57   97.10   97.10   97.36   96.31   96.57   97.36   96.57   96.83   96.83   97.36   96.83   97.10   96.83

     3: AIT76094.1               94.46   96.83  100.00   99.21   98.94   97.36   98.42   97.89   98.15   98.15   98.15   98.42   98.15   98.42   98.42   98.42   98.42   98.68   98.42

     4: AIT76108.1               94.72   97.63   99.21  100.00   99.74   98.15   99.21   98.68   98.94   98.68   98.94   99.21   98.94   99.21   99.21   99.21   99.21   99.47   99.21

     5: AIT76102.1               94.46   97.36   98.94   99.74  100.00   97.89   98.94   98.42   98.68   98.42   98.68   98.94   98.68   98.94   98.94   98.94   98.94   99.21   98.94

     6: AAG36927.1               93.93   96.57   97.36   98.15   97.89  100.00   98.68   98.68   98.94   97.36   97.63   98.42   97.63   97.89   97.89   98.42   97.89   98.15   97.89

     7: AIT76101.1               94.46   97.10   98.42   99.21   98.94   98.68  100.00   99.47   99.74   98.42   98.68   98.94   98.68   98.94   98.94   98.94   98.94   99.21   98.94

     8: AJO16043.1               94.46   97.10   97.89   98.68   98.42   98.68   99.47  100.00   99.74   97.89   98.15   98.94   98.15   98.42   98.42   98.94   98.42   98.68   98.42

     9: AIT76100.1               94.72   97.36   98.15   98.94   98.68   98.94   99.74   99.74  100.00   98.15   98.42   99.21   98.42   98.68   98.68   99.21   98.68   98.94   98.68

    10: AHL39320.1               93.40   96.31   98.15   98.68   98.42   97.36   98.42   97.89   98.15  100.00   98.68   98.42   98.68   98.94   98.94   98.94   98.94   99.21   98.94

    11: AIT76109.1               93.67   96.57   98.15   98.94   98.68   97.63   98.68   98.15   98.42   98.68  100.00   98.68   98.94   99.21   99.21   99.21   99.21   99.47   99.21

    12: AEL22919.1               94.46   97.36   98.42   99.21   98.94   98.42   98.94   98.94   99.21   98.42   98.68  100.00   98.68   98.94   98.94   99.47   98.94   99.21   98.94

    13: AAR87489.1               93.67   96.57   98.15   98.94   98.68   97.63   98.68   98.15   98.42   98.68   98.94   98.68  100.00   99.21   99.21   99.21   99.21   99.47   99.21

    14: AIT76103.1               93.93   96.83   98.42   99.21   98.94   97.89   98.94   98.42   98.68   98.94   99.21   98.94   99.21  100.00   99.47   99.47   99.47   99.74   99.47

    15: AIT76106.1               94.20   96.83   98.42   99.21   98.94   97.89   98.94   98.42   98.68   98.94   99.21   98.94   99.21   99.47  100.00   99.47   99.47   99.74   99.47

    16: AIT76107.1               94.46   97.36   98.42   99.21   98.94   98.42   98.94   98.94   99.21   98.94   99.21   99.47   99.21   99.47   99.47  100.00   99.47   99.74   99.47

    17: ADQ00385.1               93.93   96.83   98.42   99.21   98.94   97.89   98.94   98.42   98.68   98.94   99.21   98.94   99.21   99.47   99.47   99.47  100.00   99.74   99.47

    18: O54216|O54216_SALEN      94.20   97.10   98.68   99.47   99.21   98.15   99.21   98.68   98.94   99.21   99.47   99.21   99.47   99.74   99.74   99.74   99.74  100.00   99.74

    19: ADT91161.1               93.93   96.83   98.42   99.21   98.94   97.89   98.94   98.42   98.68   98.94   99.21   98.94   99.21   99.47   99.47   99.47   99.47   99.74  100.00

 

CLUSTAL O(1.2.4) multiple sequence alignment

 

 

AIT76105.1                  MKKSLSATLVSALLAFSAPGFSAADNVAAVVDSTIKPLMAQQDIPGMAVAVSVKGKPYYF

tr|W1I7B7|W1I7B7_PROMI      MKKSLSATLISALLAFSAPGFSAADNVAAVVDSTIKPLMAQQDIPGMAVAVSVKGKPYYF

AIT76094.1                  MKKSLSATLISALLAFSAPGFSAADNVAAVVDSTIKPLMAQQDIPGMAVAVSVKGKPYYF

AIT76108.1                  MKKSLSATLISALLAFSAPGFSAADNVAAVVDSTIKPLMAQQDIPGMAVAVSVKGKPYYF

AIT76102.1                  MKKSLSATLISALLAFSAPGFSAADNVAAVVDSTIKPLMAQQDIPGMAVAVSVKGKPYYF

AAG36927.1                  MKKSLSATLISALLAFSAPGFSAADNVAAVVDSTIKPLMAQQDIPGMAVAVSVKGKPYYF

AIT76101.1                  MKKSLSATLISALLAFSAPGFSAADNVAAVVDSTIKPLMAQQDIPGMAVAVSVKGKPYYF

AJO16043.1                  MKKSLSATLISALLAFSAPGFSAADNVAAVVDSTIKPLMAQQDIPGMAVAVSVKGKPYYF

AIT76100.1                  MKKSLSATLISALLAFSAPGFSAADNVAAVVDSTIKPLMAQQDIPGMAVAVSVKGKPYYF

AHL39320.1                  MTKSVSATLISALLAFSAPGFSAADNVAAVVDSTIKPLMAQQDIPGMAVAVSVKGKPYYF

AIT76109.1                  MKKSLSATLISALLAFSAPGFSAADNVAAVVDSAIKPLMAQQDIPGMAVAVSVKGKPYYF

AEL22919.1                  MKKSLSATLISALLAFSAPGFSAADNVAAVVDSTIKPLMAQQDIPGMAVAVSVKGRPYYF

AAR87489.1                  MKKSLSATLISALLAFSAPGFSAADNVAAVVDSTIKPLMAQQDIPGMAVAVSVKGKPYYF

AIT76103.1                  MKKSLSATLISALLAFSAPGFSAADNVAVVVDSTIKPLMAQQDIPGMAVAVSVKGKPYYF

AIT76106.1                  MKKSLSATLISALLAFSAPGFSAADNVAAVVDSTIKPLMAQQDIPGMAVAVSVKGKPYYF

AIT76107.1                  MKKSLSATLISALLAFSAPGFSAADNVAAVVDSTIKPLMAQQDIPGMAVAVSVKGKPYYF

ADQ00385.1                  MKKSLSATLISALLAFSAPGFSAADNVAAVVDSTIKPLMAQQDIPGMAVAVSVKGKPYYF

O54216|O54216_SALEN         MKKSLSATLISALLAFSAPGFSAADNVAAVVDSTIKPLMAQQDIPGMAVAVSVKGKPYYF

ADT91161.1                  MKKSLSATLISALLAFSAPGFSAADNVAAVVDSTIKPLMAQQDIPGMAVAVSVKGKPYYF

                            *.**:****:******************.****:*********************:****

 

AIT76105.1                  NYGFADVQAKQPVTENTLFELGSVSKTFTGVLGAVSVAKKETSLNDPAVKYQPELTQPQW

tr|W1I7B7|W1I7B7_PROMI      NYGFADVEAKQPVTENTLFELGSVSKTFTGVLGAVSVAKKEMSLNDPAAKYRPELTQPQW

AIT76094.1                  NYGFADVQAKQPVTENTLFELGSVSKTFTGVLGAVSVAKKETALNDPAAKYQPELALPQW

AIT76108.1                  NYGFADVQAKQPVTENTLFELGSVSKTFTGVLGAVSVAKKEMALNDPAAKYQPELALPQW

AIT76102.1                  NYGFADVQAKQPVTENTLFELGSVSKTFTGVLGAVSVAKKEMALNDPAAKYQPELALPQW

AAG36927.1                  NYGFADVQAKQPVTENTLFELGSVSKTFTGVLGAVSVAKKEMMLNDPAEKYQPELALPQW

AIT76101.1                  NYGFADVQAKQPVTENTLFELGSVSKTFTGVLGAVSVAKKEMTLNDPAEKYQPELALPQW

AJO16043.1                  NYGFADVQAKQPVTENTLFELGSVSKTFTGVLGAVSVAKKEMTLNDPAEKYQPELALPQW

AIT76100.1                  NYGFADVQAKQPVTENTLFELGSVSKTFTGVLGAVSVAKKEMTLNDPAEKYQPELALPQW

AHL39320.1                  NYGFADIQAKQPVTENTLFELGSVSKTFTGVLGAVSVAKKEMALNDPAAKYQPELALPQW

AIT76109.1                  NYGFADIQAKQPVTENTLFELGSVSKTFTGVLGAVSVAKKEMALNDLAAKYQPELALPQW

AEL22919.1                  NYGFADVQAKQPVTENTLFELGSVSKTFTGVLGAVSVAKKEMALNDPAAKYQPELALPQW

AAR87489.1                  NYGFADIQAKQPVTENTLFELGSVSKTFTGVLGAVSVAKKEMALNDPAAKYQPELALPQW

AIT76103.1                  NYGFADIQAKQPVTENTLFELGSVSKTFTGVLGAVSVAKKEMALNDPAAKYQPELALPQW

AIT76106.1                  NYGFADIQAKQPVTENTLFELGSVSKTFTGVLGAVSVAKKEMALNDPAAKYQPELALPQW

AIT76107.1                  NYGFADIQAKQPVTENTLFELGSVSKTFTGVLGAVSVAKKEMALNDPAAKYQPELALPQW

ADQ00385.1                  NYGFADIQAKQPVTENTLFELGSVSKTFTGVLGAVSVAKKEMALNDPAAKYQPELALPQW

O54216|O54216_SALEN         NYGFADIQAKQPVTENTLFELGSVSKTFTGVLGAVSVAKKEMALNDPAAKYQPELALPQW

ADT91161.1                  NYGFADIQAKQPVTENTLFELGSVSKTFTGVLGAVSVAKKEMALNDPAAKYQPELALPQW

                            ******::*********************************  *** * **:***: ***

 

AIT76105.1                  KGITLLDLATYTAGGLPLQVPEAVKSSEDLLHFYQQWQPSWQPGKMRLYANSSIGLFGAL

tr|W1I7B7|W1I7B7_PROMI      KGITLLDLATYTAGGLPLQVPDAVKSRADLLHFYQQWQPSWKPGDMRLYANSSIGLFGAL

AIT76094.1                  KGITLLDLATYTAGGLPLQVPDAVKSRADLLNFYQQWQPSWKPGDMRLYANSSIGLFGAL

AIT76108.1                  KGITLLDLATYTAGGLPLQVPDAVKSRADLLNFYQQWQPSWKPGDMRLYANSSIGLFGAL

AIT76102.1                  KGITLLDLATYTAGGLPLQVPDAVKSRADLLNFYQQWQPSWKPGDMRLYANSSIGLFGAL

AAG36927.1                  KGITLLDLATYTTGGLPLQVPDAVKNRAELLHFYQQWQPSRKPGDMRLYANSSIGLFGAL

AIT76101.1                  KGITLLDLATYTAGGLPLQVPDAVKSRADLLNFYQQWQPSRKPGDMRLYANSSIGLFGAL

AJO16043.1                  KGITLLDLATYTAGGLPLQVPDEVKSRADLLHFYQQWQPSRKPGDMRLYANSSIGLFGAL

AIT76100.1                  KGITLLDLATYTAGGLPLQVPDAVKSRADLLHFYQQWQPSRKPGDMRLYANSSIGLFGAL

AHL39320.1                  KGITLLDLATYTAGGLPLQVPDAVKSRADLLNFYQQWQPSRKPGDMRLYANSSIGLFGAL

AIT76109.1                  KGITLLDLATYTAGGLPLQVPDAVKSRADLLNFYQQWQPSRKPGDMRLYANSSIGLFGAL

AEL22919.1                  KGITLLDLATYTAGGLPLQVPDAVKSRADLLHFYQQWQPSRKPGDMRLYANSSIGLFGAL

AAR87489.1                  KGITLLDLATYTAGGLPLQVPDAVKSRADLLNFYQQWQPSRKPGDMRLYANSSIGLFGAL

AIT76103.1                  KGITLLDLATYTAGGLPLQVPDAVKSRADLLNFYQQWQPSRKPGDMRLYANSSIGLFGAL

AIT76106.1                  KGITLLDLATYTAGGLPLQVPDAVKSRADLLNFYQQWQPSRKPGYMRLYANSSIGLFGAL

AIT76107.1                  KGITLLDLATYTAGGLPLQVPDAVKSRADLLHFYQQWQPSRKPGDMRLYANSSIGLFGAL

ADQ00385.1                  KGITLLDLATYTAGGLPLQVPDAVKSRADLLNFYQQWQPSRKPGDMRLYANSSIGLFGAL

O54216|O54216_SALEN         KGITLLDLATYTAGGLPLQVPDAVKSRADLLNFYQQWQPSRKPGDMRLYANSSIGLFGAL

ADT91161.1                  KGITLLDLATYTAGGLPLQVPDAVKSRADLLNFYQQWQPSRKPGDMRLYANSSIGLFGAL

                            ************:********: **.  :**:******** :** ***************

 

AIT76105.1                  TATAAGMPYEQLLTARILAPLGLSHTFITVPESAQSQYAYGYKNNQPVRVTGGPLDAESY

tr|W1I7B7|W1I7B7_PROMI      TANAAGMPYEQLLTTRILSPLGLSHTFITVPESAQSQYAYGYKNKKPVRVSPGQLDAESY

AIT76094.1                  TANAAGMPYEQLLTARILAPLGLSHTFITVPESVQSRYAYGYKNKKPVRVSPGQLDAESY

AIT76108.1                  TANAAGMPYEQLLTARILAPLGLSHTFITVPESAQSQYAYGYKNKKPVRVSPGQLDAESY

AIT76102.1                  TANAAGMPYEQLLTARILAPLGLSHTFITVPESAQSQYAYGYKNKKPVRVSPEQLDAESY

AAG36927.1                  TANAAGMPYEQLLTARILAPLGLSHTFITVPESAQSQYAYGYKNKKPVRVSPGQLDAESY

AIT76101.1                  TANAAGMPYEQLLTARILAPLGLSHTFITVPESAQSQYAYGYKNKKPVRVSPGQLDAESY

AJO16043.1                  TANAAGMPYEQLLTARILAPLGLSHTFITVPESAQSQYAYGYKNKKPVRVSPGQLDAESY

AIT76100.1                  TANAAGMPYEQLLTARILAPLGLSHTFITVPESAQSQYAYGYKNKKPVRVSPGQLDAESY

AHL39320.1                  TANAAGMPYEQLLTARILAPLGLSHTFITVPESAQSHYAYGYKNKKPVRVSPGQLDAESY

AIT76109.1                  TANAAGMPYEQLLTARILAPLGLSHTFITVPESAQSQYAYGYKNKKPVRVSPGQLDAESY

AEL22919.1                  TANAAGMPYEQLLTARILAPLGLSHTFITVPESAQSQYAYGYKNKKPVRVSPGQLDAESY

AAR87489.1                  TANAAGMPYEQLLTARILAPLGLSHTFITVPDSAQSQYAYGYKNKKPVRVSPGQLDAESY

AIT76103.1                  TANAAGMPYEQLLTARILAPLGLSHTFITVPESAQSQYAYGYKNKKPVRVSPGQLDAESY

AIT76106.1                  TANAAGMPYEQLLTARILAPLGLSHTFITVPESAQSQYAYGYKNKKPVRVSPGQLDAESY

AIT76107.1                  TANAAGMPYEQLLTARILAPLGLSHTFITVPESAQSQYAYGYKNKKPVRVSPGQLDAESY

ADQ00385.1                  TANAAGMPYEQLLTARILAPLGLSHTFITVPESAQSQYAYGYKNKKPVRVSPGQLDAESY

O54216|O54216_SALEN         TANAAGMPYEQLLTARILAPLGLSHTFITVPESAQSQYAYGYKNKKPVRVSPGQLDAESY

ADT91161.1                  TANAAGMPYEQLLTARILAPLGLSHTFITVPESAQSQYAYGYKNKKPVRVSPGQLDAESY

                            **.***********:***:************:*.**:*******::****:   ******

 

AIT76105.1                  GVKSASKDMLRWAEINMSPSRAGNADLEMAMYLAQTRYYKTAAINQGLGWEMYDWPQQKD

tr|W1I7B7|W1I7B7_PROMI      GVKSASKDMLRWAEMNMEPSRAGNADLEMAMYLAQTRYYKTAAINQGLGWEMYDWPQQKD

AIT76094.1                  GVKSASKDMLRWAEMNMEPSRAGNADLEMAMYLAQTRYYKTAAINQGLGWEMYDWPQQKD

AIT76108.1                  GVKSASKDMLRWAEMNMEPSRAGNADLEMAMYLAQTRYYKTAAINQGLGWEMYDWPQQKD

AIT76102.1                  GVKSASKDMLRWAEMNMEPSRAGNADLEMAMYLAQTRYYKTAAINQGLGWEMYDWPQQKD

AAG36927.1                  GVKSASKDMLRWAEMNMEPSRAGNADLEMAMYLAQTRYYKTAAINQGLGWEMYDWPQQKD

AIT76101.1                  GVKSASKDMLRWAEMNMEPSRAGNADLEMAMYLAQTRYYKTAAINQGLGWEMYDWPQQKD

AJO16043.1                  GVKSASKDMLRWAEMNMEPSRAGNADLEMAMYLAQTRYYKTAAINQGLGWEMYDWPQQKD

AIT76100.1                  GVKSASKDMLRWAEMNMEPSRAGNADLEMAMYLAQTRYYKTAAINQGLGWEMYDWPQQKD

AHL39320.1                  GVKSASKDMLRWAEMNMEPSRAGNADLEMAMYLAQTRYYKTAAINQGLGWEMYDWPQQKD

AIT76109.1                  GVKSASKDMLRWAEMNMEPSRAGNADLEMAMYLAQTRYYKTAAINQGLGWEMYDWPQQKD

AEL22919.1                  GVKSASKDMLRWAEMNMEPSRAGNADLEMAMYLAQTRYYKTAAINQGLGWEMYDWPQQKD

AAR87489.1                  GVKSASKDMLRWAEMNIEPSRAGNADLEMAMYLAQTRYYKTAAINQGLGWEMYDWPQQKD

AIT76103.1                  GVKSASKDMLRWAEMNMEPSRAGNADLEMAMYLAQTRYYKTAAINQGLGWEMYDWPQQKD

AIT76106.1                  GVKSASKDMLRWAEMNMEPSRAGNADLEMAMYLAQTRYYKTAAINQGLGWEMYDWPQQKD

AIT76107.1                  GVKSASKDMLRWAEMNMEPSRAGNADLEMAMYLAQTRYYKTAAINQGLGWEMYDWPQQKD

ADQ00385.1                  GVKSASKDMLRWAEMNMEPSRAGNADLEMAMYLAQTRYYKTAAINQGLGWEMYDWPQQKD

O54216|O54216_SALEN         GVKSASKDMLRWAEMNMEPSRAGNADLEMAMYLAQTRYYKTAAINQGLGWEMYDWPQQKD

ADT91161.1                  GVKSTSKDMLRWAEMNMEPSRAGNADLEMAMYLAQTRYYKTAAINQGLGWEMYDWPQQKD

                            ****:*********:*:.******************************************

 

AIT76105.1                  MIINGVTNEVALQPHPVTDNQVQPYNRASWVHKTGATTGFGAYVAFIPEKQVAIVILANK

tr|W1I7B7|W1I7B7_PROMI      MIVNGVTNEVALQPHPVTDNQVQPYNRASWVHKTGATTGFGAYVAFIPEKQVAIVILANK

AIT76094.1                  MIINGVTNEVALQPHPVTDNQVQPYNRASWVHKTGATTGFGAYVAFIPEKQVAIVILANK

AIT76108.1                  MIINGVTNEVALQPHPVTDNQVQPYNRASWVHKTGATTGFGAYVAFIPEKQVAIVILANK

AIT76102.1                  MIINGVTNEVALQPHPVTDNQVQPYNRASWVHKTGATTGFGAYVAFIPEKQVAIVILANK

AAG36927.1                  MIINGVTNEVALQPHPVTDNQVQPYNRASWVHKTGATTGFGAYVAFIPEKQVAIVILANK

AIT76101.1                  MIINGVTNEVALQPHPVTDNQVQPYNRASWVHKTGATTGFGAYVAFIPEKQVAIVILANK

AJO16043.1                  MIINGVTNEVALQPHPVTDNQVQPYNRASWVHKTGATTGFGAYVAFIPEKQVAIVILANK

AIT76100.1                  MIINGVTNEVALQPHPVTDNQVQPYNRASWVHKTGATTGFGAYVAFIPEKQVAIVILANK

AHL39320.1                  MIINGVTNEVALQPHPVTDNQVQPYNRASWVHKTGATTGFGAYVAFIPEKQVAIVILANK

AIT76109.1                  MIINGVTNEVALQPHPVTDNQVQPYNRASWVHKTGATTGFGAYVAFIPEKQVAIVILANK

AEL22919.1                  MIINGVTNEVALQPHPVTDNQVQPYNRASWVHKTGATTGFGAYVAFIPEKQVAIVILANK

AAR87489.1                  MIINGVTNEVALQPHPVTDNQVQPYNRASWVHKTGATTGFGAYVAFIPEKQVAIVILANK

AIT76103.1                  MIINGVTNEVALQPHPVTDNQVQPYNRASWVHKTGATTGFGAYVAFIPEKQVAIVILANK

AIT76106.1                  MIINGVTNEVALQPHPVTDNQVQPYNRASWVHKTGATTGFGAYVAFIPEKQVAIVILANK

AIT76107.1                  MIINGVTNEVALQPHPVTDNQVQPYNRASWVHKTGATTGFGAYVAFIPEKQVAIVILANK

ADQ00385.1                  MIINGVTNEVALQPHPVTDNQVQPYNRASWVHKTGATTGSGAYVAFIPEKQVAIVILANK

O54216|O54216_SALEN         MIINGVTNEVALQPHPVTDNQVQPYNRASWVHKTGATTGFGAYVAFIPEKQVAIVILANK

ADT91161.1                  MIINGVTNEVALQPHPVTDNQVQPYNRASWVHKTGATTGFGAYVAFIPEKQVAIVILANK

                            **:************************************ ********************

 

AIT76105.1                  NYPNTERVKAAQAILSALE

tr|W1I7B7|W1I7B7_PROMI      NYPNTERVKAAQAILSALE

AIT76094.1                  NYPNTERVKAAQAILSALE

AIT76108.1                  NYPNTERVKAAQAILSALE

AIT76102.1                  NYPNTERVKAAQAILSALE

AAG36927.1                  NYPNTERVKAAQAILSALE

AIT76101.1                  NYPNTERVKAAQAILSALE

AJO16043.1                  NYPNTERVKAAQAILSALE

AIT76100.1                  NYPNTERVKAAQAILSALE

AHL39320.1                  NYPNTERVKAAQAILSALE

AIT76109.1                  NYPNTERVKAAQAILSALE

AEL22919.1                  NYPNTERVKAAQAILSALE

AAR87489.1                  NYPNTERVKAAQAILSALE

AIT76103.1                  NYPNTERVKAAQAILSALE

AIT76106.1                  NYPNTERVKAAQAILSALE

AIT76107.1                  NYPNTERVKAAQAILSALE

ADQ00385.1                  NYPNTERVKAAQAILSALE

O54216|O54216_SALEN         NYPNTERVKAAQAILSALE

ADT91161.1                  NYPNTERVKAAQAILSALE

                            *******************