#

#

#  Percent Identity  Matrix - created by Clustal2.1

#

#

 

     1: AEK78851.1           100.00   95.81   95.81   95.55   93.98   94.24   95.55   95.29   94.72   94.24   94.50   95.03   95.55

     2: AAG12974.1            95.81  100.00  100.00   99.74   97.64   97.91   96.60   96.34   97.10   96.60   96.86   96.86   96.07

     3: AAK70221.1            95.81  100.00  100.00   99.74   97.64   97.91   96.60   96.34   97.10   96.60   96.86   96.86   96.07

     4: AGE45503.1            95.55   99.74   99.74  100.00   97.38   97.64   96.34   96.07   96.83   96.34   96.60   96.60   95.81

     5: WP_063860496.1        93.98   97.64   97.64   97.38  100.00   99.74   95.81   95.55   96.31   95.81   96.07   96.07   95.29

     6: WP_064511492.1        94.24   97.91   97.91   97.64   99.74  100.00   96.07   95.81   96.57   96.07   96.34   96.34   95.55

     7: P94856|P94856_KLEOX   95.55   96.60   96.60   96.34   95.81   96.07  100.00   99.74   95.51   95.03   95.29   96.34   96.86

     8: ADK73994.1            95.29   96.34   96.34   96.07   95.55   95.81   99.74  100.00   95.25   94.76   95.03   96.07   96.60

     9: CDP41984.1            94.72   97.10   97.10   96.83   96.31   96.57   95.51   95.25  100.00   99.47   99.74   97.36   95.78

    10: Q48437|Q48437_KLEPN   94.24   96.60   96.60   96.34   95.81   96.07   95.03   94.76   99.47  100.00   99.21   96.86   95.29

    11: Q53IN1|Q53IN1_KLEPN   94.50   96.86   96.86   96.60   96.07   96.34   95.29   95.03   99.74   99.21  100.00   97.12   96.07

    12: O52988|O52988_ECOLX   95.03   96.86   96.86   96.60   96.07   96.34   96.34   96.07   97.36   96.86   97.12  100.00   97.38

    13: Q9L387|Q9L387_ECOLX   95.55   96.07   96.07   95.81   95.29   95.55   96.86   96.60   95.78   95.29   96.07   97.38  100.00

 

CLUSTAL O(1.2.4) multiple sequence alignment

 

 

AEK78851.1               MQQRRAFALLTLGSLLLAPCTYASGEAPLTVTVDGIIQPMLKAYRIPGMAVAVLKDGKAH

AAG12974.1               MQQRRAFALLTLGSLLLAPCTYASGEAPLTAAVDGIIQPMLKAYRIPGMAVAVLKDGKAH

AAK70221.1               MQQRRAFALLTLGSLLLAPCTYASGEAPLTAAVDGIIQPMLKAYRIPGMAVAVLKDGKAH

AGE45503.1               MQQRRAFALLTLGSLLLAPCTYASGEAPLTAAVDGIIQPMLKAYRIPGMAVAVLKDGKAH

WP_063860496.1           MQQRRAFALLTLGSLLLAPCTYAGGEAPLTAAVDGIIQPMLKEYRIPGMAVAVLKDGKAH

WP_064511492.1           MQQRRAFALLTLGSLLLAPCTYAGGEAPLTAAVDGIIQPMLKEYRIPGMAVAVLKDGKAH

P94856|P94856_KLEOX      MQQRRAFALLTLGSLLLAPCTYASGEAPLTATVDGIIQPMLKEYRIPGIAVAVLKDGKAH

ADK73994.1               MQQRRAFALLTLGSLLLAPCTYASGEAPLTATVDGIIQPMLKEYRIPGIAVAVLKDGKAH

CDP41984.1               MQQRRAFALLTLGSLLLAPCTYARGEAPLTAAVDGIIQPMLKEYRIPGMAVAVLKDGKAH

Q48437|Q48437_KLEPN      MQQRRAFALLTLGSLLLAPCTYARGEAPLTAAVDGIIQPMLKEYRIPGMAVAVLKDGKAH

Q53IN1|Q53IN1_KLEPN      MQQRRAFALLTLGSLLLAPCTYARGEAPLTAAVDGIIQPMLKEYRIPGMAVAVLKDGKAH

O52988|O52988_ECOLX      MQQRRALALLTLGSLLLAPCTYASGEAPLTAAVDGIIQPMLKEYRIPGMAVAVLKDGKAH

Q9L387|Q9L387_ECOLX      MQQRRALALLMLGSLLLAPCTYASGEAPLTATVDGIIQPMLKAYRIPGMAVAVLKDGKAH

                         ******:*** ************ ******.:********** *****:***********

 

AEK78851.1               YFNYGVANRESGQRVSEQTLFEIGSVSKTLTATLGAYAAVKGGFELDDKVSQHAPWLKGS

AAG12974.1               YFNYGVANRESGQRVSEQTLFEIGSVSKTLTATLGAYAAVKGGFELDDKVSQHAPWLKGS

AAK70221.1               YFNYGVANRESGQRVSEQTLFEIGSVSKTLTATLGAYAAVKGGFELDDKVSQHAPWLKGS

AGE45503.1               YFNYGVANRESGQRVSEQTLFEIGSVSKTLTATLGAYAAVKGGFELDDKVSQHAPWLKGS

WP_063860496.1           YFNYGVANRESGQRVNEQTLFEIGSVSKTLTATLGAYAAVKGGFELDDKVSQHGPWLKGS

WP_064511492.1           YFNYGVANRESGQRVNEQTLFEIGSVSKTLTATLGAYAAVKGGFELDDKVSQHGPWLKGS

P94856|P94856_KLEOX      YFNYGVANRESGQRVSEQTLFEIGSVSKTLTATLGAYAAVKGGFVLDDKVSQHAPWLKGS

ADK73994.1               YFNYGVANRESGQRVSEQTLFEIGSVSKTLTATLGAYAAVKGGFVLDDKVSQHAPWLKGS

CDP41984.1               YFNYGVANRESGQRVSEQTLFEIGSVSKTLTATLGAYAAVKGGFELDDKVSQHAPWLKGS

Q48437|Q48437_KLEPN      YFNYGVANRESGQRVSEQTLFEIGSVSKTLTATLGAYAAVKGGFELDDKVSQHAPWLKGS

Q53IN1|Q53IN1_KLEPN      YFNYGVANRESGQRVSEQTLFEIGSVSKTLTATLGAYAAVKGGFELDDKVSQHAPWLKGS

O52988|O52988_ECOLX      YFNYGVANRESGQRVSEQTLFEIGSVSKTLTATLGAYAAVKGGFELDDKVSHHAPWLKGS

Q9L387|Q9L387_ECOLX      YFNYGVANRESGQRVSEQTLFEIGSVSKTLTATLGAYAAVKGGFELDDKVSQHAPWLKGS

                         ***************.**************************** ******:*.******

 

AEK78851.1               AFDGVTMAELATYSAGGLPLQFPEEVDSNDKMRTYYRSWSPVYPAGTHRQYANTSIGLFG

AAG12974.1               ALDGVTMAELATYSAGGLPLQFPDEVDSNDKMRTYYRSWSPVYPAGTHRQYSNPSIGLFG

AAK70221.1               ALDGVTMAELATYSAGGLPLQFPDEVDSNDKMRTYYRSWSPVYPAGTHRQYSNPSIGLFG

AGE45503.1               ALDGVTMAELATYSAGGLPLQFPDEVDSNDKMRTYYRSWSPVYPAGTHRQYSNPSISLFG

WP_063860496.1           ALDGVTMAELATYSAGGLPLQFPDEVDSNDKMRTYYQSWSPVYPAGTHRQYSNPSIGLFG

WP_064511492.1           ALDGVTMAELATYSAGGLPLQFPDEVDSNDKMRTYYQSWSPVYPAGTHRQYSNPSIGLFG

P94856|P94856_KLEOX      ALDGVTMAELATYSAGGLPLQFPDKVDSNDKMQTYYRSWSPVYPAGTHRQYSNPSIGLFG

ADK73994.1               ALDGVTMAELATYSAGGLPLQFPDKVDSNDKMQTYYRSWSPVYPAGTHRQYSNPSIGLFG

CDP41984.1               AFDGVTMAELATYSAGGLPLQFPDEVDSNDKMRTYYRHWSPVYPAGTHRQYSNPSIGLFG

Q48437|Q48437_KLEPN      AFDGVTMAELATYSAGGLPLQFPDEVDSNDKMRTYYRHWSPVYPAGTHRQYSNPSIGLFG

Q53IN1|Q53IN1_KLEPN      AFDGVTMAELATYSAGGLPLQFPDEVDSNDKMRTYYRHWSPVYPAGTHRQYSNPSIGLFG

O52988|O52988_ECOLX      AFDGVTMAELATYSAGGLPLQFPDEVDSNDKMQTYYRSWSPVYPAGTHRQYSNPSIGLFG

Q9L387|Q9L387_ECOLX      AFDGVTMAELATYSAGGLPLQFPDEVDSNDKMQTYYRSWSPVYPAGTHRQYSNPSIGLFG

                         *:*********************::*******:***: *************:* **.***

 

AEK78851.1               YLAANSLGQSFEQLMSQTLLPKLGLHHTYIQVPESAMANYAYGYSKEEKPIRVTPGMLAA

AAG12974.1               HLAANSLGQPFEQLMSQTLLPKLGLHHTYIQVPESAMVNYAYGYSKEDKPVRVTPGVLAA

AAK70221.1               HLAANSLGQPFEQLMSQTLLPKLGLHHTYIQVPESAMVNYAYGYSKEDKPVRVTPGVLAA

AGE45503.1               HLAANSLGQPFEQLMSQTLLPKLGLHHTYIQVPESAMVNYAYGYSKEDKPVRVTPGVLAA

WP_063860496.1           HLAANSLGQPFEQLMSQTLLPKLGLHHTYIQVPESAMVNYAYGYSKEDKPVRVTPGVLAA

WP_064511492.1           HLAANSLGQPFEQLMSQTLLPKLGLHHTYIQVPESAMVNYAYGYSKEDKPVRVTPGVLAA

P94856|P94856_KLEOX      HLAANSLGQPFEQLMSQTLLPKLGLHHTYIQVPESAMANYAYGYSKEDKPIRVTPGVLAA

ADK73994.1               HLAANSLGQPFEQLMSQTLLPKLGLHHTYIQVPESAMANYAYGYSKEDKPIRVTPGVLAA

CDP41984.1               HLAANSLGQPFEQLMSQTLLPKLGLHHTYIQVPESAIANYAYGYSKEDKPVRVTPGVLAA

Q48437|Q48437_KLEPN      HLAANSLGQPFEQLMSQTLLPKLGLHHTYIQVPESAIANYAYGYSKEDKPVRVTPGVLAA

Q53IN1|Q53IN1_KLEPN      HLAANSLGQPFEQLMSQTLLPKLGLHHTYIQVPESAIANYAYGYSKEDKPVRATPGVLAA

O52988|O52988_ECOLX      HLAANSLGQPFEKLMSQTLLPKLGLHHTYIQVPESAMANYAYGYSKEDKPIRVTPGVLAA

Q9L387|Q9L387_ECOLX      HLAANSLGQPFEQLMSQTLLPKLGLHHTYIQVPESAMANYAYGYSKEDKPIRATPGVLAA

                         :******** **:***********************:.*********:**:*.***:***

 

AEK78851.1               EAYGIKTGSADLLKFAEANMGYQGDAAVKSAIALTHTGFYSVGDMTQGLGWESYDYPVTE

AAG12974.1               EAYGIKTGSADLLKFAEANMGYQGDAAVKSAIALTHTGFYSVGDMTQGLGWESYAYPVTE

AAK70221.1               EAYGIKTGSADLLKFAEANMGYQGDAAVKSAIALTHTGFYSVGDMTQGLGWESYAYPVTE

AGE45503.1               EAYGIKTGSADLLKFAEANMGYQGDAAVKSAIALTHTGFYSVGDMTQGLGWESYAYPVTE

WP_063860496.1           EAYGIKTGSADLLKFVEANMGYQGDAAVKSAIALTHTGFYSVGEMTQGLGWESYAYPVTE

WP_064511492.1           EAYGIKTGSADLLKFVEANMGYQGDAAVKSAIALTHTGFYSVGEMTQGLGWESYAYPVTE

P94856|P94856_KLEOX      EAYGIKTGSADLLKFAEANMGYQGDALVKSAIALTHTGFYSVGEMTQGLGWESYDYPVTE

ADK73994.1               EAYGIKTGSADLLKFAEANMGYQGDALVKSAIALTHTGFYSVGEMTQGLGWESYDYPVTE

CDP41984.1               EAYGIKTGSADLLKFTEANMGYQGDAALKSAIALTHTGFYSVGDMTQGLGWESYAYPLTE

Q48437|Q48437_KLEPN      EAYGIKTGSADLLKFTEANMGYQGDAALKTRIALTHTGFYSVGDMTQGLGWESYAYPLTE

Q53IN1|Q53IN1_KLEPN      EAYGIKTGSADLLKFTEANMGYQGDAALKSAIALTHTGFYSVGDMTQGLGWESYAYPLTE

O52988|O52988_ECOLX      EAYGIKTGSADLLKFVEANMGYQGDAALKSAIALTHTGFYSVGDMTQGLGWESYAYPVTE

Q9L387|Q9L387_ECOLX      EAYGIKTGSADLLKFVEANMGYQGDAALKSAIALTHTGFHSVGEMTQGLGWESYDYPVTE

                         ***************.********** :*: ********:***:********** **:**

 

AEK78851.1               QVLLADNSPAVSFQANPVTRFAVPKAMGEQRLYNKTGSTGGFGAYVAFVPARGIAIVMLA

AAG12974.1               QTLLAGNAPAVSFQANPVTRFAVPKAMGEQRLYNKTGSTGGFGAYVAFVPARGIAIVMLA

AAK70221.1               QTLLAGNAPAVSFQANPVTRFAVPKAMGEQRLYNKTGSTGGFGAYVAFVPARGIAIVMLA

AGE45503.1               QTLLAGNAPAVSFQANPVTRFAVPKAMGEQRLYNKTGSTGGFGAYVAFVPARGIAIVMLA

WP_063860496.1           QTLLAGNSPAVSFQANPVTRFAVPKAMGEQRLYNKTGSTGGFGAYVAFVPARGIAIVMLA

WP_064511492.1           QTLLAGNSPAVSFQANPVTRFAVPKAMGEQRLYNKTGSTGGFGAYVAFVPARGIAIVMLA

P94856|P94856_KLEOX      QVLLAGNSPAVSFQANPVTRFAVPKAMGEQRLYNKTGSTGGFGAYVAFVPARGIAIVMLA

ADK73994.1               QVLLAGNSPAVSLQANPVTRFAVPKAMGEQRLYNKTGSTGGFGAYVAFVPARGIAIVMLA

CDP41984.1               QALLAGNS---SFQANPVTRFAVPKAMGEQRLYNKTGSTGGFGAYVAFVPARGIAIVMLA

Q48437|Q48437_KLEPN      QALLAGNSPAVSFQANPVTRFAVPKAMGEQRLYNKTGSTGGFGAYVAFVPARGIAIVMLA

Q53IN1|Q53IN1_KLEPN      QALLAGNSPAVSFQANPVTRFAVPKAMGEQRLYNKTGSTGGFGAYVAFVPARGIAIVMLA

O52988|O52988_ECOLX      QALLAGNSPAVSFQANPVTRFAVPKAMGEQRLYNKTGSTGGFGAYVAFVPARGIAIVMLA

Q9L387|Q9L387_ECOLX      QVLLAGNSPAVSFQANPVTRFAVPKAMGEQRLYNKTGSTGGFGAYVAFVPARGIAIVMLA

                         *.***.*:   *:***********************************************

 

AEK78851.1               NRNYPIEARVKAAHAILSQLAE

AAG12974.1               NRNYPIEARVKAAHAILSQLAE

AAK70221.1               NRNYPIEARVKAAHAILSQLAE

AGE45503.1               NRNYPIEARVKAAHAILSQLAE

WP_063860496.1           NRNYPIEARVKAAHAILSQLNE

WP_064511492.1           NRNYPIEARVKAAHAILSQLAE

P94856|P94856_KLEOX      NRNYPIEARVKAAHAILSQLAE

ADK73994.1               NRNYPIEARVKAAHAILSQLAE

CDP41984.1               NRNYPIEARVKAAHAILSQLAE

Q48437|Q48437_KLEPN      NRNYPIEARVKAAHAILSQLAE

Q53IN1|Q53IN1_KLEPN      NRNYPIEARVKAAHAILSQLAE

O52988|O52988_ECOLX      NRNYPIEARVKAAHAILSQLAE

Q9L387|Q9L387_ECOLX      NRNYPIEARVKAAHAILSQLAE

                         ******************** *