#

#

#  Percent Identity  Matrix - created by Clustal2.1

#

#

 

     1: AGS82587.1           100.00   96.73   78.78   78.78   80.00   80.00   80.00   82.04   78.78   83.67   83.67   84.08   84.08   83.67   83.67   82.86   82.04   81.63   80.00   79.59   82.04   82.45   82.45   82.45   82.86   83.67   78.37   78.78   78.78   80.00   79.59   79.59   79.59   79.59   79.18   80.00   79.18   80.00   79.59   81.63   82.04   80.41   80.82   80.82   81.63   81.63

     2: AFO59566.1            96.73  100.00   80.08   80.08   81.30   81.30   81.30   83.33   80.08   86.18   86.18   86.59   86.59   86.18   86.18   84.15   83.33   82.52   81.22   80.82   83.27   83.67   83.67   83.67   85.37   85.77   80.49   80.89   80.89   82.11   81.71   81.71   81.71   81.71   81.30   82.11   81.30   82.11   81.71   84.15   84.15   82.11   82.52   82.52   83.74   83.74

     3: AAV49162.2            78.78   80.08  100.00   99.59   91.06   91.46   91.46   83.33   81.71   87.80   87.40   88.21   88.21   87.80   87.80   83.74   82.52   82.11   78.78   78.37   81.22   81.63   81.22   81.22   82.11   81.71   78.86   79.27   78.86   79.67   80.08   80.08   80.08   80.08   79.67   80.08   79.67   80.49   80.08   79.67   81.71   79.67   80.08   79.67   80.89   80.49

     4: AKO63210.1            78.78   80.08   99.59  100.00   90.65   91.06   91.06   82.93   81.30   87.40   87.80   87.80   87.80   87.40   87.40   83.33   82.11   81.71   78.78   78.37   81.63   81.22   81.22   81.63   81.71   81.30   78.46   78.86   79.27   79.27   79.67   80.49   79.67   79.67   79.27   80.49   79.27   80.08   79.67   79.27   81.30   79.27   79.67   80.08   80.49   80.08

     5: AIT76110.1            80.00   81.30   91.06   90.65  100.00   99.59   99.19   81.71   83.74   87.80   87.40   88.21   88.21   87.80   87.80   85.37   83.74   83.33   81.22   80.82   83.27   83.67   83.27   83.27   83.74   83.74   80.89   81.30   80.89   80.49   80.89   80.89   80.89   80.89   80.49   80.89   80.49   81.30   80.89   80.89   82.11   81.30   81.71   81.30   82.11   82.11

     6: AAT49068.1            80.00   81.30   91.46   91.06   99.59  100.00   99.59   81.71   83.74   87.80   87.40   88.21   88.21   87.80   87.80   85.37   83.74   83.33   81.22   80.82   83.27   83.67   83.27   83.27   83.74   83.74   80.89   81.30   80.89   80.49   80.89   80.89   80.89   80.89   80.49   80.89   80.49   81.30   80.89   80.89   82.11   81.30   81.71   81.30   82.11   82.11

     7: AFR33816.1            80.00   81.30   91.46   91.06   99.19   99.59  100.00   81.71   83.74   87.80   87.40   88.21   88.21   87.80   87.80   85.37   83.74   83.33   81.22   80.82   83.27   83.67   83.27   83.27   83.74   83.74   80.89   81.30   80.89   80.49   80.89   80.89   80.89   80.89   80.49   80.89   80.49   81.30   80.89   80.89   82.11   81.30   81.71   81.30   82.11   82.11

     8: Q8GIW8|Q8GIW8_PSEPU   82.04   83.33   83.33   82.93   81.71   81.71   81.71  100.00   83.33   86.59   86.18   86.99   86.99   86.59   86.59   84.96   84.15   83.33   80.82   81.22   84.08   84.90   84.49   84.49   86.59   86.59   81.71   81.30   80.89   81.71   82.11   81.71   82.11   82.11   82.93   82.11   82.52   82.52   82.93   84.55   85.77   83.74   83.33   82.93   82.93   83.33

     9: AEH41427.1            78.78   80.08   81.71   81.30   83.74   83.74   83.74   83.33  100.00   86.99   86.59   87.40   87.40   86.99   86.99   86.18   84.96   84.15   78.78   79.18   80.82   81.63   81.22   81.22   83.33   82.93   80.49   80.08   79.67   78.86   79.27   78.86   79.27   79.27   79.67   79.27   79.67   79.67   80.08   80.49   82.93   81.71   81.30   80.89   81.71   81.30

    10: ABM68358.1            83.67   86.18   87.80   87.40   87.80   87.80   87.80   86.59   86.99  100.00   98.78   99.59   99.59   98.78   99.19   93.09   92.68   91.87   84.49   84.08   88.16   88.98   88.57   88.57   88.21   89.43   84.55   84.96   84.55   84.55   84.96   84.55   84.96   84.96   84.55   84.96   84.55   85.37   84.96   85.77   88.21   86.99   87.40   86.99   87.80   87.40

    11: BAD81061.1            83.67   86.18   87.40   87.80   87.40   87.40   87.40   86.18   86.59   98.78  100.00   99.19   99.19   99.19   99.59   92.68   92.28   91.46   84.90   84.49   88.57   88.57   88.57   88.98   87.80   89.02   84.15   84.55   84.96   84.15   84.55   84.96   84.55   84.55   84.15   85.37   84.15   84.96   84.55   85.37   87.80   86.59   86.99   87.40   87.40   86.99

    12: AAK13430.1            84.08   86.59   88.21   87.80   88.21   88.21   88.21   86.99   87.40   99.59   99.19  100.00  100.00   99.19   99.59   93.50   93.09   92.28   84.90   84.49   88.57   89.39   88.98   88.98   88.62   89.84   84.96   85.37   84.96   84.96   85.37   84.96   85.37   85.37   84.96   85.37   84.96   85.77   85.37   86.18   88.62   87.40   87.80   87.40   88.21   87.80

    13: AJO16039.1            84.08   86.59   88.21   87.80   88.21   88.21   88.21   86.99   87.40   99.59   99.19  100.00  100.00   99.19   99.59   93.50   93.09   92.28   84.90   84.49   88.57   89.39   88.98   88.98   88.62   89.84   84.96   85.37   84.96   84.96   85.37   84.96   85.37   85.37   84.96   85.37   84.96   85.77   85.37   86.18   88.62   87.40   87.80   87.40   88.21   87.80

    14: Q9KVZ2|Q9KVZ2_ACIBA   83.67   86.18   87.80   87.40   87.80   87.80   87.80   86.59   86.99   98.78   99.19   99.19   99.19  100.00   99.59   93.09   92.28   91.46   84.90   84.49   88.16   88.98   88.57   88.57   88.21   89.43   84.55   84.96   84.55   84.55   84.96   84.55   84.96   84.96   84.55   84.96   84.55   85.37   84.96   85.77   88.21   86.59   86.99   86.59   87.80   87.40

    15: ABM67078.1            83.67   86.18   87.80   87.40   87.80   87.80   87.80   86.59   86.99   99.19   99.59   99.59   99.59   99.59  100.00   93.09   92.68   91.87   84.90   84.49   88.16   88.98   88.57   88.57   88.21   89.43   84.55   84.96   84.55   84.55   84.96   84.55   84.96   84.96   84.55   84.96   84.55   85.37   84.96   85.77   88.21   86.99   87.40   86.99   87.80   87.40

    16: AEU17778.1            82.86   84.15   83.74   83.33   85.37   85.37   85.37   84.96   86.18   93.09   92.68   93.50   93.50   93.09   93.09  100.00   97.97   97.15   83.27   82.86   85.31   86.12   85.71   85.71   86.99   87.40   82.93   83.33   82.93   82.52   82.93   82.52   82.93   82.93   82.52   82.93   82.52   83.33   82.93   84.15   86.99   84.55   84.96   84.55   85.77   85.37

    17: Q7WYA8|Q7WYA8_PSEAI   82.04   83.33   82.52   82.11   83.74   83.74   83.74   84.15   84.96   92.68   92.28   93.09   93.09   92.28   92.68   97.97  100.00   99.19   82.04   81.63   84.08   84.90   84.49   84.49   85.37   85.77   82.52   82.93   82.52   81.71   82.11   81.71   82.11   82.11   81.71   82.11   81.71   82.52   82.11   82.52   85.37   83.74   84.15   83.74   84.15   83.74

    18: AFP97028.1            81.63   82.52   82.11   81.71   83.33   83.33   83.33   83.33   84.15   91.87   91.46   92.28   92.28   91.46   91.87   97.15   99.19  100.00   82.04   81.63   84.08   84.90   84.49   84.49   84.55   84.96   82.11   82.52   82.11   80.89   81.30   80.89   81.30   81.30   80.89   81.30   80.89   81.71   81.30   81.71   84.55   82.93   83.33   82.93   83.33   82.93

    19: AGL46523.1            80.00   81.22   78.78   78.78   81.22   81.22   81.22   80.82   78.78   84.49   84.90   84.90   84.90   84.90   84.90   83.27   82.04   82.04  100.00   99.59   86.94   87.35   87.35   87.35   83.27   84.08   84.90   85.31   85.31   84.90   85.31   85.31   85.31   85.31   84.90   85.71   84.90   85.71   85.31   88.16   88.57   88.16   88.57   88.57   90.61   89.39

    20: AIA58910.1            79.59   80.82   78.37   78.37   80.82   80.82   80.82   81.22   79.18   84.08   84.49   84.49   84.49   84.49   84.49   82.86   81.63   81.63   99.59  100.00   86.53   86.94   86.94   86.94   82.86   83.67   85.31   84.90   84.90   84.49   84.90   84.90   84.90   84.90   85.31   85.31   85.31   85.31   85.71   87.76   88.16   88.57   88.16   88.16   90.20   88.98

    21: BAM98942.1            82.04   83.27   81.22   81.63   83.27   83.27   83.27   84.08   80.82   88.16   88.57   88.57   88.57   88.16   88.16   85.31   84.08   84.08   86.94   86.53  100.00   99.18   99.18   99.59   90.20   91.02   83.67   84.08   84.49   83.67   84.08   85.31   84.08   84.08   84.08   84.90   83.67   84.49   84.08   88.57   84.90   84.08   84.49   84.90   86.12   84.90

    22: BAB72072.1            82.45   83.67   81.63   81.22   83.67   83.67   83.67   84.90   81.63   88.98   88.57   89.39   89.39   88.98   88.98   86.12   84.90   84.90   87.35   86.94   99.18  100.00   99.59   99.59   91.02   91.84   84.49   84.90   84.49   84.49   84.90   84.49   84.90   84.90   84.90   84.90   84.49   85.31   84.90   89.39   85.71   84.90   85.31   84.90   86.94   85.71

    23: BAD89802.1            82.45   83.67   81.22   81.22   83.27   83.27   83.27   84.49   81.22   88.57   88.57   88.98   88.98   88.57   88.57   85.71   84.49   84.49   87.35   86.94   99.18   99.59  100.00   99.59   90.61   91.43   84.08   84.49   84.49   84.08   84.49   84.49   84.49   84.49   84.49   84.90   84.08   84.90   84.49   88.98   85.31   84.49   84.90   84.90   86.53   85.31

    24: BAM62795.1            82.45   83.67   81.22   81.63   83.27   83.27   83.27   84.49   81.22   88.57   88.98   88.98   88.98   88.57   88.57   85.71   84.49   84.49   87.35   86.94   99.59   99.59   99.59  100.00   90.61   91.43   84.08   84.49   84.90   84.08   84.49   84.90   84.49   84.49   84.49   85.31   84.08   84.90   84.49   88.98   85.31   84.49   84.90   85.31   86.53   85.31

    25: Q70E85|Q70E85_PSEAI   82.86   85.37   82.11   81.71   83.74   83.74   83.74   86.59   83.33   88.21   87.80   88.62   88.62   88.21   88.21   86.99   85.37   84.55   83.27   82.86   90.20   91.02   90.61   90.61  100.00   94.31   82.93   83.33   82.93   84.15   84.55   84.15   84.55   84.55   84.55   84.55   84.15   84.96   84.55   91.06   86.18   84.96   85.37   84.96   86.59   85.37

    26: ABC88434.1            83.67   85.77   81.71   81.30   83.74   83.74   83.74   86.59   82.93   89.43   89.02   89.84   89.84   89.43   89.43   87.40   85.77   84.96   84.08   83.67   91.02   91.84   91.43   91.43   94.31  100.00   83.74   84.15   83.74   84.55   84.96   84.55   84.96   84.96   84.96   84.96   84.55   85.37   84.96   91.87   87.40   84.96   85.37   84.96   87.40   86.18

    27: AEN75249.1            78.37   80.49   78.86   78.46   80.89   80.89   80.89   81.71   80.49   84.55   84.15   84.96   84.96   84.55   84.55   82.93   82.52   82.11   84.90   85.31   83.67   84.49   84.08   84.08   82.93   83.74  100.00   99.59   99.19   94.72   95.12   94.72   95.12   95.12   95.53   95.12   95.53   95.53   95.93   86.99   88.62   90.24   89.84   89.43   91.06   91.46

    28: AAK13078.1            78.78   80.89   79.27   78.86   81.30   81.30   81.30   81.30   80.08   84.96   84.55   85.37   85.37   84.96   84.96   83.33   82.93   82.52   85.31   84.90   84.08   84.90   84.49   84.49   83.33   84.15   99.59  100.00   99.59   95.12   95.53   95.12   95.53   95.53   95.12   95.53   95.12   95.93   95.53   87.40   89.02   89.84   90.24   89.84   91.46   91.87

    29: ACY01749.1            78.78   80.89   78.86   79.27   80.89   80.89   80.89   80.89   79.67   84.55   84.96   84.96   84.96   84.55   84.55   82.93   82.52   82.11   85.31   84.90   84.49   84.49   84.49   84.90   82.93   83.74   99.19   99.59  100.00   94.72   95.12   95.53   95.12   95.12   94.72   95.93   94.72   95.53   95.12   86.99   88.62   89.43   89.84   90.24   91.06   91.46

    30: BAR80870.1            80.00   82.11   79.67   79.27   80.49   80.49   80.49   81.71   78.86   84.55   84.15   84.96   84.96   84.55   84.55   82.52   81.71   80.89   84.90   84.49   83.67   84.49   84.08   84.08   84.15   84.55   94.72   95.12   94.72  100.00   98.78   98.37   98.78   98.78   98.37   98.78   98.37   99.19   98.78   87.80   89.02   89.84   90.24   89.84   92.28   91.46

    31: BAM62793.1            79.59   81.71   80.08   79.67   80.89   80.89   80.89   82.11   79.27   84.96   84.55   85.37   85.37   84.96   84.96   82.93   82.11   81.30   85.31   84.90   84.08   84.90   84.49   84.49   84.55   84.96   95.12   95.53   95.12   98.78  100.00   98.78   99.19   99.19   98.78   99.19   98.78   99.59   99.19   88.21   89.43   90.24   90.65   90.24   92.68   91.87

    32: BAM62794.1            79.59   81.71   80.08   80.49   80.89   80.89   80.89   81.71   78.86   84.55   84.96   84.96   84.96   84.55   84.55   82.52   81.71   80.89   85.31   84.90   85.31   84.49   84.49   84.90   84.15   84.55   94.72   95.12   95.53   98.37   98.78  100.00   98.78   98.78   98.37   99.59   98.37   99.19   98.78   87.80   89.02   89.84   90.24   90.65   92.28   91.46

    33: BAP75826.1            79.59   81.71   80.08   79.67   80.89   80.89   80.89   82.11   79.27   84.96   84.55   85.37   85.37   84.96   84.96   82.93   82.11   81.30   85.31   84.90   84.08   84.90   84.49   84.49   84.55   84.96   95.12   95.53   95.12   98.78   99.19   98.78  100.00   99.19   98.78   99.19   99.59   99.59   99.19   88.21   89.43   90.24   90.65   90.24   92.68   91.87

    34: ABF70513.1            79.59   81.71   80.08   79.67   80.89   80.89   80.89   82.11   79.27   84.96   84.55   85.37   85.37   84.96   84.96   82.93   82.11   81.30   85.31   84.90   84.08   84.90   84.49   84.49   84.55   84.96   95.12   95.53   95.12   98.78   99.19   98.78   99.19  100.00   98.78   99.19   98.78   99.59   99.19   88.21   89.43   90.24   90.65   90.24   92.68   91.87

    35: ACB41775.1            79.18   81.30   79.67   79.27   80.49   80.49   80.49   82.93   79.67   84.55   84.15   84.96   84.96   84.55   84.55   82.52   81.71   80.89   84.90   85.31   84.08   84.90   84.49   84.49   84.55   84.96   95.53   95.12   94.72   98.37   98.78   98.37   98.78   98.78  100.00   98.78   99.19   99.19   99.59   88.21   89.02   90.65   90.24   89.84   92.28   91.46

    36: BAB72069.1            80.00   82.11   80.08   80.49   80.89   80.89   80.89   82.11   79.27   84.96   85.37   85.37   85.37   84.96   84.96   82.93   82.11   81.30   85.71   85.31   84.90   84.90   84.90   85.31   84.55   84.96   95.12   95.53   95.93   98.78   99.19   99.59   99.19   99.19   98.78  100.00   98.78   99.59   99.19   88.21   89.43   90.24   90.65   91.06   92.68   91.87

    37: BAA77393.1            79.18   81.30   79.67   79.27   80.49   80.49   80.49   82.52   79.67   84.55   84.15   84.96   84.96   84.55   84.55   82.52   81.71   80.89   84.90   85.31   83.67   84.49   84.08   84.08   84.15   84.55   95.53   95.12   94.72   98.37   98.78   98.37   99.59   98.78   99.19   98.78  100.00   99.19   99.59   87.80   89.02   90.65   90.24   89.84   92.28   91.46

    38: AAB30289.1            80.00   82.11   80.49   80.08   81.30   81.30   81.30   82.52   79.67   85.37   84.96   85.77   85.77   85.37   85.37   83.33   82.52   81.71   85.71   85.31   84.49   85.31   84.90   84.90   84.96   85.37   95.53   95.93   95.53   99.19   99.59   99.19   99.59   99.59   99.19   99.59   99.19  100.00   99.59   88.62   89.84   90.65   91.06   90.65   93.09   92.28

    39: BAB15941.1            79.59   81.71   80.08   79.67   80.89   80.89   80.89   82.93   80.08   84.96   84.55   85.37   85.37   84.96   84.96   82.93   82.11   81.30   85.31   85.71   84.08   84.90   84.49   84.49   84.55   84.96   95.93   95.53   95.12   98.78   99.19   98.78   99.19   99.19   99.59   99.19   99.59   99.59  100.00   88.21   89.43   91.06   90.65   90.24   92.68   91.87

    40: ADT63777.1            81.63   84.15   79.67   79.27   80.89   80.89   80.89   84.55   80.49   85.77   85.37   86.18   86.18   85.77   85.77   84.15   82.52   81.71   88.16   87.76   88.57   89.39   88.98   88.98   91.06   91.87   86.99   87.40   86.99   87.80   88.21   87.80   88.21   88.21   88.21   88.21   87.80   88.62   88.21  100.00   91.87   87.80   88.21   87.80   93.09   91.06

    41: AAT49070.1            82.04   84.15   81.71   81.30   82.11   82.11   82.11   85.77   82.93   88.21   87.80   88.62   88.62   88.21   88.21   86.99   85.37   84.55   88.57   88.16   84.90   85.71   85.31   85.31   86.18   87.40   88.62   89.02   88.62   89.02   89.43   89.02   89.43   89.43   89.02   89.43   89.02   89.84   89.43   91.87  100.00   91.06   91.46   91.06   93.50   92.68

    42: BAQ56016.1            80.41   82.11   79.67   79.27   81.30   81.30   81.30   83.74   81.71   86.99   86.59   87.40   87.40   86.59   86.99   84.55   83.74   82.93   88.16   88.57   84.08   84.90   84.49   84.49   84.96   84.96   90.24   89.84   89.43   89.84   90.24   89.84   90.24   90.24   90.65   90.24   90.65   90.65   91.06   87.80   91.06  100.00   99.59   99.19   94.72   92.68

    43: AAK12087.1            80.82   82.52   80.08   79.67   81.71   81.71   81.71   83.33   81.30   87.40   86.99   87.80   87.80   86.99   87.40   84.96   84.15   83.33   88.57   88.16   84.49   85.31   84.90   84.90   85.37   85.37   89.84   90.24   89.84   90.24   90.65   90.24   90.65   90.65   90.24   90.65   90.24   91.06   90.65   88.21   91.46   99.59  100.00   99.59   95.12   93.09

    44: BAM98935.1            80.82   82.52   79.67   80.08   81.30   81.30   81.30   82.93   80.89   86.99   87.40   87.40   87.40   86.59   86.99   84.55   83.74   82.93   88.57   88.16   84.90   84.90   84.90   85.31   84.96   84.96   89.43   89.84   90.24   89.84   90.24   90.65   90.24   90.24   89.84   91.06   89.84   90.65   90.24   87.80   91.06   99.19   99.59  100.00   94.72   92.68

    45: AAK27847.1            81.63   83.74   80.89   80.49   82.11   82.11   82.11   82.93   81.71   87.80   87.40   88.21   88.21   87.80   87.80   85.77   84.15   83.33   90.61   90.20   86.12   86.94   86.53   86.53   86.59   87.40   91.06   91.46   91.06   92.28   92.68   92.28   92.68   92.68   92.28   92.68   92.28   93.09   92.68   93.09   93.50   94.72   95.12   94.72  100.00   97.15

    46: AFG73659.1            81.63   83.74   80.49   80.08   82.11   82.11   82.11   83.33   81.30   87.40   86.99   87.80   87.80   87.40   87.40   85.37   83.74   82.93   89.39   88.98   84.90   85.71   85.31   85.31   85.37   86.18   91.46   91.87   91.46   91.46   91.87   91.46   91.87   91.87   91.46   91.87   91.46   92.28   91.87   91.06   92.68   92.68   93.09   92.68   97.15  100.00

 

 

CLUSTAL O(1.2.4) multiple sequence alignment

 

 

AGS82587.1               MKKIFVLFVFLFCSITAAGESLPDIKIEKLDEDVYVHTSFEKITGWGVITKHGLVVLVNT

AFO59566.1               MKKIFVLFVFLFCSITAAGESLPDIKIEKLDEDVYVHTSFEEDNGWGVITKHGLVVLVNT

AAV49162.2               MKKLFVLCVFFLCNIAAADDSLPDLKIEKLEKGVYVHTSFEEVKGWGVVTKHGLVVLVKN

AKO63210.1               MKKLFVLCVFFLCNIAAADDSLPDLKIEKLEKGVYVHTSFEEVKGWGVFTKHGLVVLVKN

AIT76110.1               MKKLFVLCVFFFCNIAVAEESLPDLKIEKLEEGVYVHTSFEEVKGWSVVTKHGLVVLVKN

AAT49068.1               MKKLFVLCVFFFCNIAVAEESLPDLKIEKLEEGVYVHTSFEEVKGWSVVTKHGLVVLVKN

AFR33816.1               MKKLFVLCVFFFCNIAVAEESLPDLKIEKLEEGVYVHTSFEEVKGWSVVTKHGLVVLVKN

Q8GIW8|Q8GIW8_PSEPU      MKKLFVLCIFLFLSITASGEVLPDLKIEKLEEGVYLHTSFEEVSGWGVVTKHGLVVLVNN

AEH41427.1               MKKLFVLCVFVFCSITVAGETLPNLRVEKLEEGVYVHTSYEEVKGWGVVTKHGLVVLIGA

ABM68358.1               MKKLFVLCVCFLCSITAAGAALPDLKIEKLEEGVYVHTSFEEVNGWGVVSKHGLVVLVNT

BAD81061.1               MKKLFVLCVCFLCSITAAGAALPDLKIEKLEEGVYVHTSFEEVNGWGVFSKHGLVVLVNT

AAK13430.1               MKKLFVLCVCFLCSITAAGAALPDLKIEKLEEGVYVHTSFEEVNGWGVVSKHGLVVLVNT

AJO16039.1               MKKLFVLCVCFLCSITAAGAALPDLKIEKLEEGVYVHTSFEEVNGWGVVSKHGLVVLVNT

Q9KVZ2|Q9KVZ2_ACIBA      MKKLFVLCVCFLCSITAAGARLPDLKIEKLEEGVYVHTSFEEVNGWGVVSKHGLVVLVNT

ABM67078.1               MKKLFVLCVCFLCSITAAGAALPDLKIEKLEEGVYVHTSFEEVNGWGVVSKHGLVVLVNT

AEU17778.1               MKKLFVLCVCFFCSITAAGSSLPDLKIEKLEEGVFVHTSFEEVNGWGVVTKHGLVVLVNT

Q7WYA8|Q7WYA8_PSEAI      MKKLFVLCVCFFCSITAAGAALPDLKIEKLEEGVFVHTSFEEVNGWGVVTKHGLVVLVNT

AFP97028.1               MKKLFVLCVCFFCSITAAGAALPDLKIEKLEEGVFVHTSFEEVNGWGVVTKHGLVVLVNT

AGL46523.1               MSKLFVFFMFLFCSITAAGESLPDLKIEKLDEGVYVHTSFEEVNGWGVIPKHGLVVLVNT

AIA58910.1               MSKLFVFFMFLFCSITAAGESLPDLKIEKLDEGVYVHTSFEEVNGWGVIPKHGLVVLVNT

BAM98942.1               MKKLFVLCIFLFCSITAAGASLPDLKIEKLEEGVYVHTSFEEVNGWGVFSKHGLVVLVNT

BAB72072.1               MKKLFVLCIFLFCSITAAGASLPDLKIEKLEEGVYVHTSFEEVNGWGVVSKHGLVVLVNT

BAD89802.1               MKKLFVLCIFLFCSITAAGASLPDLKIEKLEEGVYVHTSFEEVNGWGVASKHGLVVLVNT

BAM62795.1               MKKLFVLCIFLFCSITAAGASLPDLKIEKLEEGVYVHTSFEEVNGWGVFSKHGLVVLVNT

Q70E85|Q70E85_PSEAI      MKKLFVLCIFLFCSITAAGESLPDLKIEKLEDGVYVHTSFEEVNGWGVVTKHGLVFLVNT

ABC88434.1               MKKLFVLCVFLFCSITAAGESLPDLKIEKLEEGVYVHTSFEEVNGWGVVSKHGLVILVNT

AEN75249.1               MSKLSVFFIFLFCSIATAAEPLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVDA

AAK13078.1               MSKLSVFFIFLFCSIATAAEPLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVDA

ACY01749.1               MSKLSVFFIFLFCSIATAAEPLPDLKIEKLDEGVYVHTSFEEVNGWGVFPKHGLVVLVDA

BAR80870.1               MSKLSVFFIFLFCSIATAAESLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNA

BAM62793.1               MSKLSVFFIFLFCSIATAAESLPDLKIEKLDEGVYVHTSFEEVNRWGVVPKHGLVVLVNA

BAM62794.1               MSKLSVFFIFLFCSIATAAESLPDLKIEKLDEGVYVHTSFEEVNGWGVFPKHGLVVLVNA

BAP75826.1               MSKLSVFFIFLFCSIATAAESLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNA

ABF70513.1               MSKLSVFFIFLFCSIATAAESLPDLKIEKLDEGVYVHTSFKEVNGWGVVPKHGLVVLVNA

ACB41775.1               MSKLSVFFIFLFCSIATAAESLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNA

BAB72069.1               MSKLSVFFIFLFCSIATAAESLPDLKIEKLDEGVYVHTSFEEVNGWGVFPKHGLVVLVNA

BAA77393.1               MSKLSVFFIFLFCSIATAAESLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNA

AAB30289.1               MSKLSVFFIFLFCSIATAAESLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNA

BAB15941.1               MSKLSVFFIFLFCSIATAAESLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNA

ADT63777.1               MSKLFVFLIFLFCSITAAAESLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNT

AAT49070.1               MNKLSVFFMFMFCSITAAGESLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNT

BAQ56016.1               MKKLSVFFMFLFCSIAASGEALPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNT

AAK12087.1               MKKLSVFFMFLFCSIAASGEALPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNT

BAM98935.1               MKKLSVFFMFLFCSIAASGEALPDLKIEKLDEGVYVHTSFEEVNGWGVFPKHGLVVLVNT

AAK27847.1               MSKLFVFFMFLFCSITAAAESLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNT

AFG73659.1               MSKLFVFFMFLFCSITAAAESLPDLKIERLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNT

                         *.*: *: : .: .*:.:   **::::*:*:..*::***::: . *.*  *****.*: 

 

AGS82587.1               DAYIIDTPFTAKDTEKLVRWFVGRGYKIKGSISSHFHSDSAGGIEWLNSQSIPTYASKLT

AFO59566.1               DAYIIDTPFTAKDTEKLVRWFVGRGYKIKGSISSHFHSDSAGGIEWLNSQSIPTYASKLT

AAV49162.2               DAYLIDTPITAKDTEKLVNWFIEHGYRIKGSISTHFHGDSTAGIEWLNSQSISTYASELT

AKO63210.1               DAYLIDTPITAKDTEKLVNWFIEHGYRIKGSISTHFHGDSTAGIEWLNSQSISTYASELT

AIT76110.1               DAYLIDTPTTAKDTEKLVNWFVERGYKIKGSISTHFHGDSTAGIEWLNSQSIPTYASELT

AAT49068.1               DAYLIDTPITAKDTEKLVNWFVERGYKIKGSISTHFHGDSTAGIEWLNSQSIPTYASELT

AFR33816.1               DAYLIDTPITAKDTEKLVNWFVERGYKIKGSISTHFHGDSTAGIEWLNSQSIPTYASELT

Q8GIW8|Q8GIW8_PSEPU      DAYLIDTPFTNKDTEKLVAWFVGRGFTIKGSVSSHFHSDSTGGIEWLNSQSIPTYASELT

AEH41427.1               DAYLIDTPFTAKDTEKLVNWFVERGYKIKGTVSSHFHSDSTGGIEWLNSQSIPTYASELT

ABM68358.1               DAYLIDTPFTATDTEKLVNWFVERGYKIKGTISSHFHSDSTGGIEWLNSQSIPTYASELT

BAD81061.1               DAYLIDTPFTATDTEKLVNWFVERGYKIKGTISSHFHSDSTGGIEWLNSQSIPTYASELT

AAK13430.1               DAYLIDTPFTATDTEKLVNWFVERGYKIKGTISSHFHSDSTGGIEWLNSQSIPTYASELT

AJO16039.1               DAYLIDTPFTATDTEKLVNWFVERGYKIKGTISSHFHSDSTGGIEWLNSQSIPTYASELT

Q9KVZ2|Q9KVZ2_ACIBA      DAYLIDTPFTATDTEKLVNWFVERGYKIKGTISSHFHSDSTGGIEWLNSQSIPTYASELT

ABM67078.1               DAYLIDTPFTATDTEKLVNWFVERGYKIKGTISSHFHSDSTGGIEWLNSQSIPTYASELT

AEU17778.1               DAYLIDTPFTATDTEKLVNWFVERGYKIKGTISSHFHSDSTGGIEWLNSQSIPTYASELT

Q7WYA8|Q7WYA8_PSEAI      DAYLIDTPFTATDTEKLVNWFVERGYEIKGTISSHFHSDSTGGIEWLNSQSIPTYASELT

AFP97028.1               DAYLIDTPFTATDTEKLVNWFVERGYEIKGTISSHFHSDSTGGIEWLNSQSIPTYASELT

AGL46523.1               DAYLIDTPFTAKDTENLVNWFVERGYRIKGSISSHFHSDSTGGIEWLNSQSIPTYASELT

AIA58910.1               DAYLIDTPFTAKDTENLVNWFVERGYRIKGSISSHFHSDSTGGIEWLNSQSIPTYASELT

BAM98942.1               DAYLIDTPSTAKDTEKLVNWFVERGYKIKGSISSHFHSDSTGGIEWLNSQSIPTYASVLT

BAB72072.1               DAYLIDTPFTAKDTEKLVNWFVERGYKIKGSISSHFHSDSTGGIEWLNSQSIPTYASVLT

BAD89802.1               DAYLIDTPFTAKDTEKLVNWFVERGYKIKGSISSHFHSDSTGGIEWLNSQSIPTYASVLT

BAM62795.1               DAYLIDTPFTAKDTEKLVNWFVERGYKIKGSISSHFHSDSTGGIEWLNSQSIPTYASVLT

Q70E85|Q70E85_PSEAI      DAYLIDTPFAAKDTEKLVNWFVERGYKIKGSISSHFHSDSSGGIEWLNSQSIPTYASELT

ABC88434.1               DAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSQSIPTYASELT

AEN75249.1               EAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSQSIPTYASELT

AAK13078.1               EAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSQSIPTYASELT

ACY01749.1               EAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSQSIPTYASELT

BAR80870.1               EAYIIDTPFTAKDTEKLGTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELT

BAM62793.1               EAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELT

BAM62794.1               EAYLIDTPSTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELT

BAP75826.1               EAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIGWLNSRSIPTYASELT

ABF70513.1               EAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELT

ACB41775.1               EAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELT

BAB72069.1               EAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELT

BAA77393.1               EAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIGWLNSRSIPTYASELT

AAB30289.1               EAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELT

BAB15941.1               EAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELT

ADT63777.1               EAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSQSIPTYASELT

AAT49070.1               EAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSQSIPTYASELT

BAQ56016.1               DAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSQSIPTYASELT

AAK12087.1               DAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSQSIPTYASELT

BAM98935.1               DAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSQSIPTYASELT

AAK27847.1               EAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSQSIPTYASELT

AFG73659.1               EAYLIDTPFTAKDTEKLVTWFVGRGYKIKGSISSHFHSDSTGGIEWLNSQSIPTYASELT

                         :**:**** : .***:*  **: :*: ***::*:***.**:.** ****:** **** **

 

AGS82587.1               NELLKKNGNAQAENSFSGVSYWLVKHKIEVFYPGPGHTQDNVVVWLPEKKILFGGCFIKP

AFO59566.1               NELLKKNGNAQAENSFSGVSYWLVKHKIEVFYPGPGHTQDNVVVWLPEKKILFGGCFIKP

AAV49162.2               NELLKKDNKVQATNSFSGVSYSLIKNKIEVFYPGPGHTQDNVVVWLPEKKILFGGCFVKP

AKO63210.1               NELLKKDNKVQATNSFSGVSYSLIKNKIEVFYPGPGHTQDNVVVWLPEKKILFGGCFVKP

AIT76110.1               NELLKKDNKVQAKHSFNGVSYSLIKNKIEVFYPGPGHTQDNVVVWLPEKKILFGGCFVKP

AAT49068.1               NELLKKDNKVQAKHSFNGVSYSLIKNKIEVFYPGPGHTQDNVVVWLPEKKILFGGCFVKP

AFR33816.1               NELLKKDNKVQAKHSFYGVSYSLIKNKIEVFYPGPGHTQDNVVVWLPEKKILFGGCFVKP

Q8GIW8|Q8GIW8_PSEPU      NELLKKNGKVQATNSFSGVSYWLVKNKIEIFYPGPGHTQDNVVVWLPENKILFGGCFVKP

AEH41427.1               NELLKKDGKVQAKNSFDGVSYWLAKDKIEVFYPGPGHTQDNVVVWLPEKEILFGGCFVKP

ABM68358.1               NELLKKDGKVQAKNSFSGVSYWLVKNKIEVFYPGPGHTQDNVVVWLPEKKILFGGCFVKP

BAD81061.1               NELLKKDGKVQAKNSFSGVSYWLVKNKIEVFYPGPGHTQDNVVVWLPEKKILFGGCFVKP

AAK13430.1               NELLKKDGKVQAKNSFSGVSYWLVKNKIEVFYPGPGHTQDNVVVWLPEKKILFGGCFVKP

AJO16039.1               NELLKKDGKVQAKNSFSGVSYWLVKNKIEVFYPGPGHTQDNVVVWLPEKKILFGGCFVKP

Q9KVZ2|Q9KVZ2_ACIBA      NELLKKDGKVQAKNSFSGVSYWLVKNKIEVFYPGPGHTQDNVVVWLPEKKILFGGCFVKP

ABM67078.1               NELLKKDGKVQAKNSFSGVSYWLVKNKIEVFYPGPGHTQDNVVVWLPEKKILFGGCFVKP

AEU17778.1               NELLKKSGKVQAKYSFSEVSYWLVKNKIEVFYPGPGHTQDNLVVWLPESKILFGGCFVKP

Q7WYA8|Q7WYA8_PSEAI      NELLKKSGKVQAKYSFSEVSYWLVKNKIEVFYPGPGHTQDNLVVWLPESKILFGGCFIKP

AFP97028.1               NELLKKSGKVQAKYSFSEVSYWLVKNKIEVFYPGPGHTQDNLVVWLPESKILFGGCFIKP

AGL46523.1               NELLKKDGKVQAKYSFSGVSYWLVKKKIEVFYPGPGHAPDNVVVWLPENRVLFGGCFVKP

AIA58910.1               NELLKKDGKVQAKYSFSGVSYWLVKKKIEVFYPGPGHAPDNVVVWLPENRVLFGGCFVKP

BAM98942.1               NELLKKDGKVQAKNSFSGVSYWLVKNKIEVFYPGPGHTQDNVVVWLPKNKILFGGCFVKP

BAB72072.1               NELLKKDGKVQAKNSFSGVSYWLVKNKIEVFYPGPGHTQDNVVVWLPKNKILFGGCFVKP

BAD89802.1               NELLKKDGKVQAKNSFSGVSYWLVKNKIEVFYPGPGHTQDNVVVWLPKNKILFGGCFVKP

BAM62795.1               NELLKKDGKVQAKNSFSGVSYWLVKNKIEVFYPGPGHTQDNVVVWLPKNKILFGGCFVKP

Q70E85|Q70E85_PSEAI      NELLKKNGKVQAKNSFSGVSYWLLKNKIEIFYPGPGHTQDNVVVWLPEKKILFGGCFVKP

ABC88434.1               NDLLKQNGKVQAKNSFSGVSYWLVKNKIEVFYPGPGHTQDNVVVWLPEKKILFGGCFVKP

AEN75249.1               NELLKKDGKVQAKNSFGGVNYWLVKNKIEVFYPGPGHTPDNLVVWLPERKILFGGCFIKP

AAK13078.1               NELLKKDGKVQAKNSFGGVNYWLVKNKIEVFYPGPGHTPDNLVVWLPERKILFGGCFIKP

ACY01749.1               NELLKKDGKVQAKNSFGGVNYWLVKNKIEVFYPGPGHTPDNLVVWLPERKILFGGCFIKP

BAR80870.1               NELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKP

BAM62793.1               NELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKP

BAM62794.1               NELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKP

BAP75826.1               NELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKP

ABF70513.1               NELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKP

ACB41775.1               NELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKP

BAB72069.1               NELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKP

BAA77393.1               NELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKP

AAB30289.1               NELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKP

BAB15941.1               NELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKP

ADT63777.1               NELLKKGGKVQAKNSFSGVSYWLVKKKIEVFYPGPGHTPDNVVVWLPENRVLFGGCFVKP

AAT49070.1               NELLKKDGKVQAKNSFSGGSYWLVNNKIEVFYPGPGHTPDNVVVWLPENRVLFGGCFVKP

BAQ56016.1               NELLKKDGKVQAKNSFSGASYWLVKKKIEIFYPGPGHTPDNVVVWLPEHRVLFGGCFVKP

AAK12087.1               NELLKKDGKVQAKNSFSGASYWLVKKKIEIFYPGPGHTPDNVVVWLPEHRVLFGGCFVKP

BAM98935.1               NELLKKDGKVQAKNSFSGASYWLVKKKIEIFYPGPGHTPDNVVVWLPEHRVLFGGCFVKP

AAK27847.1               NELLKKDGKVQAKNSFSGASYWLVKKKIEVFYPGPGHTPDNVVVWLPENRVLFGGCFVKP

AFG73659.1               NELLKKDGKVQAKNSFGGVSYWLVKNKIEVFYPGPGHTPDNVVVWLPENRVLFGGCFVKP

                         *:***:..:.**  **   .* * :.***:*******: **:*****: .:******:**

 

AGS82587.1               DGLGYLGDANLEAWPKSAETLMSKYGNAKLVVSSHSEIGGASLLKRTWEQAVKGLKESKN

AFO59566.1               DGLGYLGDANLEAWPKSAETLMSKYGNAKLVVSSHSEIGGASLLKRTWEQAVKGLKESKK

AAV49162.2               DGLGNLGDANLEAWPKSAKILMSKYGKAKLVVSSHSEIGNASLLQRTWEQAVKGLNESKK

AKO63210.1               DGLGNLGDANLEAWPKSAKILMSKYGKAKLVVSSHSEIGNASLLQRTWEQAVKGLNESKK

AIT76110.1               DGLGYLGDANLEAWPKSAKILMSKYGKAKLVVSSHSDIGDVSLLKRTWEQAVKGLNESKK

AAT49068.1               DGLGYLGDANLEAWPKSAKILMSKYGKAKLVVSSHSDIGDVSLLKRTWEQAVKGLNESKK

AFR33816.1               DGLGYLGDANLEAWPKSAKILMSKYGKAKLVVSSHSDIGDVSLLKRTWEQAVKGLNESKK

Q8GIW8|Q8GIW8_PSEPU      DGLGNLDDANLKAWPKSAKILMSKYGKAKLVVSGHSEIGNASLLKLTWEQAVKGLKESKK

AEH41427.1               HGLGNLGDANLEAWPESAKILMEKYGKAKLVVSGHSETGDATHLKRTWEQAVKGLKESKK

ABM68358.1               DGLGNLGDANLEAWPKSAKILMSKYGKAKLVVSSHSEIGDASLLKRTWEQAVKGLNESRK

BAD81061.1               DGLGNLGDANLEAWPKSAKILMSKYVKAKLVVSSHSEIGDASLLKRTWEQAVKGLNESKK

AAK13430.1               DGLGNLGDANLEAWPKSAKILMSKYGKAKLVVSSHSEIGDASLLKRTWEQAVKGLNESKK

AJO16039.1               DGLGNLGDANLEAWPKSAKILMSKYGKAKLVVSSHSEIGDASLLKRTWEQAVKGLNESKK

Q9KVZ2|Q9KVZ2_ACIBA      DGLGNLGDANLEAWPKSAKILMSKYVKAKLVVSSHSEIGDASLLKRTWEQAVKGLNESKK

ABM67078.1               DGLGNLGDANLEAWPKSAKILMSKYVKAKLVVSSHSEIGDASLLKRTWEQAVKGLNESKK

AEU17778.1               HGLGNLGDANLEAWPKSAKILMSKYGKAKLVVSSHSEKGDASLLKRTWEQALKGLKESKK

Q7WYA8|Q7WYA8_PSEAI      HGLGNLGDANLEAWPKSAKILMSKYGKAKLVVSSHSEKGDASLMKRTWEQALKGLKESKK

AFP97028.1               HGLGNLGDANLEAWPKSAKILMSKYGKAKLVVSSHSEKGDASLMKRTWEQALKGLKESKK

AGL46523.1               YGLGNLGDANLEAWPKSAKLLMSKYSKAKLVVPSHSDIGDSSLLKLTWEQTVKGFNESKK

AIA58910.1               YGLGNLGDANLEAWPKSAKLLMSKYSKAKLVVPGHSDIGDSSLLKLTWEQTVKGFNESKK

BAM98942.1               YGLGNLDDANVEAWPHSAEKLISKYGNAKLVVPSHSDIGDASLLKLTWEQAVKGLNESKK

BAB72072.1               YGLGNLDDANVEAWPHSAEKLISKYGNAKLVVPSHSDIGDASLLKLTWEQAVKGLNESKK

BAD89802.1               YGLGNLDDANVEAWPHSAEKLISKYGNAKLVVPSHSDIGDASLLKLTWEQAVKGLNESKK

BAM62795.1               YGLGNLDDANVEAWPHSAEKLISKYGNAKLVVPSHSDIGDASLLKLTWEQAVKGLNESKK

Q70E85|Q70E85_PSEAI      YGLGNLDDANVEAWPHSAEILMSRYGNAKLVVPSHSDVGDASLLKLTWEQAVKGLKESKK

ABC88434.1               YGLGNLDDANVVAWPHSAEILMSRYGNAKLVVPSHSDIGDASLLKLTWEQAVKGLKESKK

AEN75249.1               YGLGNLGDANLEAWPKSAKLLISKYGKAKLVVPGHSEAGDASLLKLTLEQAVKGLNESKK

AAK13078.1               YGLGNLGDANLEAWPKSAKLLISKYGKAKLVVPSHSEAGDASLLKLTLEQAVKGLNESKK

ACY01749.1               YGLGNLGDANLEAWPKSAKLLISKYGKAKLVVPSHSEAGDASLLKLTLEQAVKGLNESKK

BAR80870.1               YGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESKK

BAM62793.1               YGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESKK

BAM62794.1               YGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESKK

BAP75826.1               YGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESKK

ABF70513.1               YGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESKK

ACB41775.1               YGLGNLSDANIEAWPKSAKLLKSKYGKAKLVVPGHSEVGDASLLKLTLEQAVKGLNESKK

BAB72069.1               YGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESKK

BAA77393.1               YGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPGHSEVGDASLLKLTLEQAVKGLNESKK

AAB30289.1               YGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESKK

BAB15941.1               YGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPGHSEVGDASLLKLTLEQAVKGLNESKK

ADT63777.1               YGLGNLDDANVEAWPHSAEILMSRYGNAKLVVPSHSDIGNASLLKLTWEQAVKGLKESKK

AAT49070.1               YGLGNLGDANLEAWPKSAKILMSKYGKAKLVVSSHSETGNASLLKLTWEQAVKGLKESKK

BAQ56016.1               YGLGNLGDANLEAWPKSAKLLVSKYGKAKLVVPGHSEVGDASLLKRTLEQAVKGLNESKK

AAK12087.1               YGLGNLGDANLEAWPKSAKLLVSKYGKAKLVVPSHSEVGDASLLKRTLEQAVKGLNESKK

BAM98935.1               YGLGNLGDANLEAWPKSAKLLVSKYGKAKLVVPSHSEVGDASLLKRTLEQAVKGLNESKK

AAK27847.1               YGLGNLGDANVEAWPKSAKLLMSKYGKAKLVVPSHSEVGDASLLKRTLEQAVKGLNESKK

AFG73659.1               YGLGNLGDANLEAWPKSAKLLMSKYGKAKLVVPSHSEVGDASLLKRTLEHAVKGLNESKK

                          *** *.***: ***.**: * .:* :***** .**: *. : :: * *:::**::**::

 

AGS82587.1               HHSPK---

AFO59566.1               PSQPNN--

AAV49162.2               PLQPSS--

AKO63210.1               PLQPSS--

AIT76110.1               SSQPSD--

AAT49068.1               SSQPSD--

AFR33816.1               SSQPSD--

Q8GIW8|Q8GIW8_PSEPU      PLLPSN--

AEH41427.1               TLQPSN--

ABM68358.1               PSQPSN--

BAD81061.1               PSQPSN--

AAK13430.1               PSQPSN--

AJO16039.1               PSQPSN--

Q9KVZ2|Q9KVZ2_ACIBA      PSQPSN--

ABM67078.1               PSQPSN--

AEU17778.1               TSSPSN--

Q7WYA8|Q7WYA8_PSEAI      TSSPSN--

AFP97028.1               TSSQSTAS

AGL46523.1               STTAH---

AIA58910.1               STTAH---

BAM98942.1               SNTVH---

BAB72072.1               SNTVH---

BAD89802.1               SNTVH---

BAM62795.1               SNTVH---

Q70E85|Q70E85_PSEAI      PSQPSN--

ABC88434.1               PSEPSN--

AEN75249.1               PSKLSN--

AAK13078.1               PSKLSN--

ACY01749.1               PSKLSN--

BAR80870.1               PSKPSN--

BAM62793.1               PSKPSN--

BAM62794.1               PSKPSN--

BAP75826.1               PSKPSN--

ABF70513.1               PSKPSN--

ACB41775.1               PSKPSN--

BAB72069.1               PSKPSN--

BAA77393.1               PSKPSN--

AAB30289.1               PSKPSN--

BAB15941.1               PSKPSN--

ADT63777.1               PSQPSN--

AAT49070.1               PSLPSN--

BAQ56016.1               LSKPSN--

AAK12087.1               LSKPSN--

BAM98935.1               LSKPSN--

AAK27847.1               PSKPSN--

AFG73659.1               PSKPSN--