#

#

#  Percent Identity  Matrix - created by Clustal2.1

#

#

 

     1: AIT76117.1  100.00   93.18   93.18   93.44   93.44   93.70   93.70   92.65   93.44   93.18   93.44   93.18   92.91   93.70   93.96   93.44   93.70

     2: CEA29752.1   93.18  100.00   99.48   99.21   98.69   98.95   98.95   98.95   99.21   98.95   99.21   98.95   98.69   98.95   99.21   99.21   99.48

     3: AIT76116.1   93.18   99.48  100.00   99.74   99.21   99.48   99.48   98.95   99.21   98.43   99.21   98.95   98.69   98.95   99.21   98.69   98.95

     4: AIT76112.1   93.44   99.21   99.74  100.00   99.48   99.74   99.74   99.21   99.48   98.69   99.48   99.21   98.95   99.21   99.48   98.95   99.21

     5: AAD22636.1   93.44   98.69   99.21   99.48  100.00   99.74   99.74   98.69   98.95   98.69   99.48   99.21   98.95   99.21   99.48   98.95   99.21

     6: ACJ05687.1   93.70   98.95   99.48   99.74   99.74  100.00  100.00   98.95   99.21   98.95   99.74   99.48   99.21   99.48   99.74   99.21   99.48

     7: AJO16037.1   93.70   98.95   99.48   99.74   99.74  100.00  100.00   98.95   99.21   98.95   99.74   99.48   99.21   99.48   99.74   99.21   99.48

     8: AFJ79785.1   92.65   98.95   98.95   99.21   98.69   98.95   98.95  100.00   98.69   98.95   99.21   98.95   98.69   98.43   98.69   98.69   98.95

     9: AIT76115.1   93.44   99.21   99.21   99.48   98.95   99.21   99.21   98.69  100.00   98.69   98.95   98.69   98.43   99.21   99.48   98.95   99.21

    10: AAO42602.1   93.18   98.95   98.43   98.69   98.69   98.95   98.95   98.95   98.69  100.00   99.21   98.95   98.69   98.95   99.21   99.21   99.48

    11: AHL39317.1   93.44   99.21   99.21   99.48   99.48   99.74   99.74   99.21   98.95   99.21  100.00   99.74   99.48   99.21   99.48   99.48   99.74

    12: AAU95779.1   93.18   98.95   98.95   99.21   99.21   99.48   99.48   98.95   98.69   98.95   99.74  100.00   99.74   98.95   99.21   99.21   99.48

    13: ABN69112.2   92.91   98.69   98.69   98.95   98.95   99.21   99.21   98.69   98.43   98.69   99.48   99.74  100.00   98.69   98.95   98.95   99.21

    14: AIT76113.1   93.70   98.95   98.95   99.21   99.21   99.48   99.48   98.43   99.21   98.95   99.21   98.95   98.69  100.00   99.74   99.21   99.48

    15: AIT76111.1   93.96   99.21   99.21   99.48   99.48   99.74   99.74   98.69   99.48   99.21   99.48   99.21   98.95   99.74  100.00   99.48   99.74

    16: AIT76104.1   93.44   99.21   98.69   98.95   98.95   99.21   99.21   98.69   98.95   99.21   99.48   99.21   98.95   99.21   99.48  100.00   99.74

    17: AIT76114.1   93.70   99.48   98.95   99.21   99.21   99.48   99.48   98.95   99.21   99.48   99.74   99.48   99.21   99.48   99.74   99.74  100.00

 

CLUSTAL O(1.2.4) multiple sequence alignment

 

 

AIT76117.1      MMTKSLSCALLLSVASSAFAAPMSEKQLAEVVERTVTPLMKAQAIPGMAVAVIYQGQPHY

CEA29752.1      MMTKSLSCALLLSVTSAAFAAPMSEKQLAEVVERTVTPLMNAQAIPGMAVAVIYQGQPHY

AIT76116.1      MMTKSLSCALLLSVTSSAFAAPMSEKQLAEVVERTVTPLMNAQAIPGMAVAVIYQGQPHY

AIT76112.1      MMTKSLSCALLLSVTSSAFAAPMSEKQLAEVVERTVTPLMNAQAIPGMAVAVIYQGQPHY

AAD22636.1      MMTKSLSCALLLSVASSAFAAPMSEKQLAEVVERTVTPLMNAQAIPGMAVAVIYQGQPHY

ACJ05687.1      MMTKSLSCALLLSVASSAFAAPMSEKQLAEVVERTVTPLMNAQAIPGMAVAVIYQGQPHY

AJO16037.1      MMTKSLSCALLLSVASSAFAAPMSEKQLAEVVERTVTPLMNAQAIPGMAVAVIYQGQPHY

AFJ79785.1      MMTKSLSCALLLSVTSAAFAAPMSETQLAEVVERTVTPLMNAQAIPGMAVAVIYQGQPHY

AIT76115.1      MMTKSLSCALLLSVTSSAFAAPMSEKQLAEVVERTVTPLMNAQAIPGMAVAVIYQGQPHY

AAO42602.1      MMTKSLSCALLLSVASAAFAAPMSETQLAEVVERTVTPLMNAQAIPGMAVAVIYQGQPHY

AHL39317.1      MMTKSLSCALLLSVASAAFAAPMSEKQLAEVVERTVTPLMNAQAIPGMAVAVIYQGQPHY

AAU95779.1      MMTKSLSCALLLSVASAAFAAPMSEKQLAEVVERTVTPLMNAQAIPGMAVAVIYQGQPHY

ABN69112.2      MMTKSLSCALLLSVASAAFAAPMFEKQLAEVVERTVTPLMNAQAIPGMAVAVIYQGQPHY

AIT76113.1      MMTKSLSCALLLSVASSAFAAPMSEKQLAEVVERTVTPLMNAQAIPGMAVAVIYQGQPHY

AIT76111.1      MMTKSLSCALLLSVASSAFAAPMSEKQLAEVVERTVTPLMNAQAIPGMAVAVIYQGQPHY

AIT76104.1      MMTKSLSCALLLSVASAAFAAPMSEKQLAEVVERTVTPLINAQAIPGMAVAVIYQGQPHY

AIT76114.1      MMTKSLSCALLLSVASAAFAAPMSEKQLAEVVERTVTPLMNAQAIPGMAVAVIYQGQPHY

                **************:*:****** *.*************::*******************

 

AIT76117.1      FTFGKADVAANKPVTPQTLFELGSISKTFTGVLGGDAIARGEISLGDPVTKYWPELTGKQ

CEA29752.1      FTFGKADVAANKPVTPQTLFELGSISKTFTGVLGGDAIARGEVALGDPVAKYWPELTGKQ

AIT76116.1      FTFGKADVAANKPVTPQTLFELGSISKTFTGVLGGDAIARGEVALGDPVAKYWPELTGKQ

AIT76112.1      FTFGKADVAANKPVTPQTLFELGSISKTFTGVLGGDAIARGEIALGDPVAKYWPELTGKQ

AAD22636.1      FTFGKADVAANKPVTPQTLFELGSISKTFTGVLGGDAIARGEIALGDPVAKYWPELTGKQ

ACJ05687.1      FTFGKADVAANKPVTPQTLFELGSISKTFTGVLGGDAIARGEIALGDPVAKYWPELTGKQ

AJO16037.1      FTFGKADVAANKPVTPQTLFELGSISKTFTGVLGGDAIARGEIALGDPVAKYWPELTGKQ

AFJ79785.1      FTFGKADVAANKPVTPQTLFELGSISKTSTGVLGGDAIARGEIALGDPVAKYWPELTGKQ

AIT76115.1      FTFGKADVAANKPVTPQTLFELGSISKTFTGVLGGDAIARGEIALGDPVAKYWPELTGKQ

AAO42602.1      FTFGKADVAANKPVTPQTLFELGSISKTFTGVLGGDAIARGEIALGDPVAKYWPELTGKQ

AHL39317.1      FTFGKADVAANKPVTPQTLFELGSISKTFTGVLGGDAIARGEIALGDPVAKYWPELTGKQ

AAU95779.1      FTFGKADVAANKPVTPQTLFELGSISKTFTGVLGGDAIARGEIALGDPVAKYWPELTGKQ

ABN69112.2      FTFGKADVAANKPVTPQTLFELGSISKTFTGVLGGDAIARGEIALGDPVAKYWPELTGKQ

AIT76113.1      FTFGKADVAANKPVTPQTLFELGSISKTFTGVLGGDAIARGEIALGDPVAKYWPELTGKQ

AIT76111.1      FTFGKADVAANKPVTPQTLFELGSISKTFTGVLGGDAIARGEIALGDPVAKYWPELTGKQ

AIT76104.1      FTFGKADVAANKPVTPQTLFELGSISKTFTGVLGGDAIARGEIALGDPVAKYWPELTGKQ

AIT76114.1      FTFGKADVAANKPVTPQTLFELGSISKTFTGVLGGDAIARGEIALGDPVAKYWPELTGKQ

                **************************** *************::*****:**********

 

AIT76117.1      WQGIHMLELATYTAGGLPLQVPDEVTDNASLLRFYQNWQPQWKPGTTRLYANASIGLFGA

CEA29752.1      WQGIRMLDLATYTAGGLPLQVPDEVTDTASLLRFYQNWQPQWKPGTTRLYANASIGLFGA

AIT76116.1      WQGIRMLDLATYTAGGLPLQVPDEVTDTASLLRFYQNWQPQWKPGTTRLYANASIGLFGA

AIT76112.1      WQGIRMLDLATYTAGGLPLQVPDEVTDTASLLRFYQNWQPQWKPGTTRLYANASIGLFGA

AAD22636.1      WQGIRMLDLATYTAGGLPLQVPDEVTDTASLLRFYQNWQPQWKPGTTRLYANASIGLFGA

ACJ05687.1      WQGIRMLDLATYTAGGLPLQVPDEVTDTASLLRFYQNWQPQWKPGTTRLYANASIGLFGA

AJO16037.1      WQGIRMLDLATYTAGGLPLQVPDEVTDTASLLRFYQNWQPQWKPGTTRLYANASIGLFGA

AFJ79785.1      WQGIRMLDLATYTAGGLPLQVPDEVTDTASLLRFYQNWQPQWKPGTTRLYANASIGLFGA

AIT76115.1      WQGIRMLDLATYTAGGLPLQVPDEVTDTASLLRFYQNWQPQWKPGTTRLYANASIGLFGA

AAO42602.1      WQGIRMLDLATYTAGGLPLQVPDEVTDTASLLRFYQNWQPQWKPGTTRLYANASIGLFGA

AHL39317.1      WQGIRMLDLATYTAGGLPLQVPDEVTDTASLLRFYQNWQPQWKPGTTRLYANASIGLFGA

AAU95779.1      WQGIRMLDLATYTAGGLPLQVPDEVTDTASLLRFYQNWQPQWKPGTTRLYANASIGLFGA

ABN69112.2      WQGIRMLDLATYTAGGLPLQVPDEVTDTASLLRFYQNWQPQWKPGTTRLYANASIGLFGA

AIT76113.1      WQSIRMLDLATYTAGGLPLQVPDEVTDTASLLRFYQNWQPQWKPGTTRLYANASIGLFGA

AIT76111.1      WQGIRMLDLATYTAGGLPLQVPDEVTDTASLLRFYQNWQPQWKPGTTRLYANASIGLFGA

AIT76104.1      WQGIRMLDLATYTAGGLPLQVPDEVTDTASLLRFYQNWQPQWKPGTTRLYANASIGLFGA

AIT76114.1      WQGIRMLDLATYTAGGLPLQVPDEVTDTASLLRFYQNWQPQWKPGTTRLYANASIGLFGA

                **.*:**:*******************.********************************

 

AIT76117.1      LAVKPSGMSYEQAMTTRIFKPLNLNHTWINVPKTEEAHYAWGYRDGKAVHVSPGMLDAEA

CEA29752.1      LAVKPSGMSYEQAMTTRVFKPLKLDHTWINVPKAEEAHYAWGYREGKAVHVSPGMLDAEA

AIT76116.1      LAVKPSGMSYEQAMTTRVFKPLKLDHTWINVPKAEEAHYAWGYREGKAVHVSPGMLDAEA

AIT76112.1      LAVKPSGMSYEQAMTTRVFKPLKLDHTWINVPKAEEAHYAWGYREGKAVHVSPGMLDAEA

AAD22636.1      LAVKPSGMSYEQAMTTRVFKPLKLDHTWINVPKAEEAHFAWGYREGKAVHVSPGMLDAEA

ACJ05687.1      LAVKPSGMSYEQAMTTRVFKPLKLDHTWINVPKAEEAHYAWGYREGKAVHVSPGMLDAEA

AJO16037.1      LAVKPSGMSYEQAMTTRVFKPLKLDHTWINVPKAEEAHYAWGYREGKAVHVSPGMLDAEA

AFJ79785.1      LAVKPSGMSYEQAMTTRVFKPLKLDHTWINVPKAEEAHYAWGYREGKAVHVSPGMLDAEA

AIT76115.1      LAVKPSGMSYEQAMTTRVFKPLKLDHTWINVPKAEEAHYAWGYREGKAVHVSPGMLNAEA

AAO42602.1      LAVKPSGMSYEQAMTTRVFKPLKLDHTWINVPKAEEAHYAWGYREGKAVHVSPGMLDAEA

AHL39317.1      LAVKPSGMSYEQAMTTRVFKPLKLDHTWINVPKAEEAHYAWGYREGKAVHVSPGMLDAEA

AAU95779.1      LAVKPSGMSYEQAMTTRVFKPLKLDHTWINVPKAEEAHYAWGYREGKAVHVSPGMLDAEA

ABN69112.2      LAVKPSGMSYEQAMTTRVFKPLKLDHTWINVPKAEEAHYAWGYREGKAVHVSPGMLDAEA

AIT76113.1      LAVKPSGMSYEQAMTTRVFKPLKLDHTWINVPKAEEAHYAWGYREGKAVHVSPGMLDAEA

AIT76111.1      LAVKPSGMSYEQAMTTRVFKPLKLDHTWINVPKAEEAHYAWGYREGKAVHVSPGMLDAEA

AIT76104.1      LAVKPSGMSYEQAMTTRVFKPLKLDHTWINVPKAEEAHYAWGYREGKAVHVSPGMLDAEA

AIT76114.1      LAVKPSGMSYEQAMTTRVFKPLKLDHTWINVPKAEEAHYAWGYREGKAVHVSPGMLDAEA

                *****************:****:*:********:****:*****:***********:***

 

AIT76117.1      YGVKTNVQDMASWVMVNMKPDSLQDSSLRKGIALAQSRYWRVGAMYQGLGWEMLNWPVDA

CEA29752.1      YGVKTNVKDMASWVIANMKPDSLQAPSLKQGIALAQSRYWRVGAMYQGLGWEMLNWPVDA

AIT76116.1      YGVKTNVKDMASWLIANMKPDSLQAPSLKQGIALAQSRYWRVGAMYQGLGWEMLNWPVDA

AIT76112.1      YGVKTNVKDMASWLIANMKPDSLQAPSLKQGIALAQSRYWRVGAMYQGLGWEMLNWPVDA

AAD22636.1      YGVKTNVKDMASWLIANMKPDSLQAPSLKQGIALAQSRYWRVGAMYQGLGWEMLNWPVDA

ACJ05687.1      YGVKTNVKDMASWLIANMKPDSLQAPSLKQGIALAQSRYWRVGAMYQGLGWEMLNWPVDA

AJO16037.1      YGVKTNVKDMASWLIANMKPDSLQAPSLKQGIALAQSRYWRVGAMYQGLGWEMLNWPVDA

AFJ79785.1      YGVKTNVKDMASWLIANMKPDSLQAPSLKQGIALAQSRYWRVGAMYQGLGWEMLNWPVDA

AIT76115.1      YGVKTNVKDMASWVIANMKPDSLQAPSLKQGIALAQSRYWRVGAMYQGLGWEMLNWPVDA

AAO42602.1      YGVKTNVKDMASWVIANMKPDSLQAPSLKQGIALAQSRYWRVGAMYQGLGWEMLNWPVDA

AHL39317.1      YGVKTNVKDMASWLIANMKPDSLQAPSLKQGIALAQSRYWRVGAMYQGLGWEMLNWPVDA

AAU95779.1      YGVKTNVKDMASWLIANMKPDSLHAPSLKQGIALAQSRYWRVGAMYQGLGWEMLNWPVDA

ABN69112.2      YGVKTNVKDMASWLIANMKPDSLHAPSLKQGIALAQSRYWRVGAMYQGLGWEMLNWPVDA

AIT76113.1      YGVKTNVKDMASWVIANMKPDSLQAPSLKQGIALAQSRYWRVGAMYQGLGWEMLNWPVDA

AIT76111.1      YGVKTNVKDMASWVIANMKPDSLQAPSLKQGIALAQSRYWRVGAMYQGLGWEMLNWPVDA

AIT76104.1      YGVKTNVKDMASWVIANMKPDSLQAPSLKQGIALAQSRYWRVGAMYQGLGWEMLNWPVDA

AIT76114.1      YGVKTNVKDMASWVIANMKPDSLQAPSLKQGIALAQSRYWRVGAMYQGLGWEMLNWPVDA

                *******:*****::.*******:  **::******************************

 

AIT76117.1      KTVVEGSDNKVALAPLPAREVNPPAPLVNASWVHKTGSTGGFGSYVAFIPEKQLGIVMLA

CEA29752.1      KTVVGGSDNKVALAPLPVAEVNPPAPPVKASWVHKTGSTGGFGSYVAFIPEKQLGIVMLA

AIT76116.1      KTVVGGSDNKVALAPLPVAEVNPPAPPVKASWVHKTGSTGGFGSYVAFIPEKQLGIVMLA

AIT76112.1      KTVVGGSDNKVALAPLPVAEVNPPAPPVKASWVHKTGSTGGFGSYVAFIPEKQLGIVMLA

AAD22636.1      KTVVGGSDNKVALAPLPVAEVNPPAPPVKASWVHKTGSTGGFGSYVAFIPEKQLGIVMLA

ACJ05687.1      KTVVGGSDNKVALAPLPVAEVNPPAPPVKASWVHKTGSTGGFGSYVAFIPEKQLGIVMLA

AJO16037.1      KTVVGGSDNKVALAPLPVAEVNPPAPPVKASWVHKTGSTGGFGSYVAFIPEKQLGIVMLA

AFJ79785.1      KTVVGGSDNKVALAPLPVAEVNPPAPPVKASWVHKTGSTGGFGSYVAFIPEKQLGIVMLA

AIT76115.1      KTVVGGSDNKVALAPLPVAEVNPPAPPVKASWVHKTGSTGGFGSYVAFIPEKQLGIVMLA

AAO42602.1      KTVVGGSDNKVALAPLPVAEVNPPAPPVKASWVHKTGSTGGFGSYVAFIPEKQLGIVMLA

AHL39317.1      KTVVGGSDNKVALAPLPVAEVNPPAPPVKASWVHKTGSTGGFGSYVAFIPEKQLGIVMLA

AAU95779.1      KTVVGGSDNKVALAPLPVAEVNPPAPPVKASWVHKTGSTGGFGSYVAFIPEKQLGIVMLA

ABN69112.2      KTVVGGSDNKVALAPLPVAEVNPPAPPVKASWVHKTGSTGGFGSYVAFIPEKQLGIVMLA

AIT76113.1      KTVVGGSDNKVALAPLPVAEVNPPAPPVKASWVHKTGSTGGFGSYVAFIPEKQLGIVMLA

AIT76111.1      KTVVGGSDNKVALAPLPVAEVNPPAPPVKASWVHKTGSTGGFGSYVAFIPEKQLGIVMLA

AIT76104.1      KTVVGGSDNKVALAPLPVAEVNPPAPPVKASWVHKTGSTGGFGSYVAFIPEKQLGIVMLA

AIT76114.1      KTVVGGSDNKVALAPLPVAEVNPPAPPVKASWVHKTGSTGGFGSYVAFIPEKQLGIVMLA

                **** ************. ******* *:*******************************

 

AIT76117.1      NKSYPNPARVEAAYRILDALQ

CEA29752.1      NKSYPNPARVEAAYRILDALQ

AIT76116.1      NKSYPNPARVEAAYRILDALQ

AIT76112.1      NKSYPNPARVEAAYRILDALQ

AAD22636.1      NKSYPNPARVEAAYRILDALQ

ACJ05687.1      NKSYPNPARVEAAYRILDALQ

AJO16037.1      NKSYPNPARVEAAYRILDALQ

AFJ79785.1      NKSYPNPARVEAAYRILDALQ

AIT76115.1      NKSYPNPARVEAAYRILDALQ

AAO42602.1      NKSYPNPARVEAAYHILDALQ

AHL39317.1      NKSYPNPARVEAAYRILDALQ

AAU95779.1      NKSYPNPARVEAAYRILDALQ

ABN69112.2      NKSYPNPARVEAAYRILDALQ

AIT76113.1      NKSYPNPARVEAAYRILDALQ

AIT76111.1      NKSYPNPARVEAAYRILDALQ

AIT76104.1      NKSYPNPARVEAAYRILDALQ

AIT76114.1      NKSYPNPARVEAAYRILDALQ

                **************:******