#

#

#  Percent Identity  Matrix - created by Clustal2.1

#

#

 

     1: A0A0H3UAN3|A0A0H3UAN3_CITFR  100.00   72.06   74.15   74.15   80.63   78.07   78.07   79.06   79.84   79.58   79.58   79.58   79.58

     2: ACS44783.1                    72.06  100.00   94.78   93.99   79.06   88.25   88.25   84.29   83.51   82.46   83.25   83.25   82.98

     3: ACS44784.1                    74.15   94.78  100.00   96.08   81.68   89.30   89.30   86.39   85.60   84.55   85.34   85.34   85.08

     4: ACS44785.1                    74.15   93.99   96.08  100.00   81.94   90.08   90.08   86.13   85.34   84.29   85.08   85.08   84.82

     5: Q51578|Q51578_KLEPN           80.63   79.06   81.68   81.94  100.00   89.53   89.53   91.88   92.93   93.46   93.72   93.72   93.46

     6: AGH56079.1                    78.07   88.25   89.30   90.08   89.53  100.00  100.00   96.07   95.29   94.24   94.50   94.50   94.24

     7: X2C6D0|X2C6D0_AERCA           78.07   88.25   89.30   90.08   89.53  100.00  100.00   96.07   95.29   94.24   94.50   94.50   94.24

     8: ACI89425.1                    79.06   84.29   86.39   86.13   91.88   96.07   96.07  100.00   98.43   97.38   97.64   97.64   97.38

     9: Q9L3G2|Q9L3G2_KLEPN           79.84   83.51   85.60   85.34   92.93   95.29   95.29   98.43  100.00   98.43   98.69   98.69   98.43

    10: A0A0A8P164|A0A0A8P164_AERCA   79.58   82.46   84.55   84.29   93.46   94.24   94.24   97.38   98.43  100.00   99.21   99.21   99.48

    11: B1PZ94|B1PZ94_9GAMM           79.58   83.25   85.34   85.08   93.72   94.50   94.50   97.64   98.69   99.21  100.00  100.00   99.74

    12: ACA30419.1                    79.58   83.25   85.34   85.08   93.72   94.50   94.50   97.64   98.69   99.21  100.00  100.00   99.74

    13: A0A0A8P352|A0A0A8P352_AERME   79.58   82.98   85.08   84.82   93.46   94.24   94.24   97.38   98.43   99.48   99.74   99.74  100.00

 

CLUSTAL O(1.2.4) multiple sequence alignment

 

 

A0A0H3UAN3|A0A0H3UAN3_CITFR      MQQQVRMTLLMASTLLWAGLAQATADTQADPLRPLVDASIRPVLKEHRIPGMAVAVLKDG

ACS44783.1                       MQQRQSILWGALATLMWAGLAHAGDKAATDPLRPVVDASIRPLLKEHRIPGMAVAVLKDG

ACS44784.1                       MQQRQSILWGVLPTLMWAGLAHAGDRAATDPLRPVVDASIRPLLKEHRIPGMAVAVLKDG

ACS44785.1                       MQQRQSILWGALATLMWAGLVHAGDKAATDPLRPVVDASIRPLLKEHRIPGMAVAVLKDG

Q51578|Q51578_KLEPN              MQQRQSILWGAVATLMWAGLAHAGEASPVDPLRPVVDASIQPLLKEHRIPGMAVAVLKDG

AGH56079.1                       MQQRQSILWGALATLMWAGLAHAGDKAATDPLRPVVDASIRPLLKEHRIPGMAVAVLKDG

X2C6D0|X2C6D0_AERCA              MQQRQSILWGALATLMWAGLAHAGDKAATDPLRPVVDASIRPLLKEHRIPGMAVAVLKDG

ACI89425.1                       MQQRQSILWGALATLMWAGLAHAGDTSAVDPLRPVVDASIRPLLKEHRIPGMAVAVLKDG

Q9L3G2|Q9L3G2_KLEPN              MQQRQSILWGALATLMWAGLAHAGETSPVDPLRPVVDASIRPLLKEHRIPGMAVAVLKDG

A0A0A8P164|A0A0A8P164_AERCA      MQQRQSFLWGAVATLMWAGLAHAGETSPVDPLRPVVDASIQPLLKEHRIPGMAVAVLKDG

B1PZ94|B1PZ94_9GAMM              MQQRQSILWGAVATLMWAGLAHAGETSPVDPLRPVVDASIQPLLKEHRIPGMAVAVLKDG

ACA30419.1                       MQQRQSILWGAVATLMWAGLAHAGETSPVDPLRPVVDASIQPLLKEHRIPGMAVAVLKDG

A0A0A8P352|A0A0A8P352_AERME      MQQRQSFLWGAVATLMWAGLAHAGETSPVDPLRPVVDASIQPLLKEHRIPGMAVAVLKDG

                                 ***:  :      **:****.:*   : .*****:*****:*:*****************

 

A0A0H3UAN3|A0A0H3UAN3_CITFR      KAHYFNYGVANRESGARVSEQTLFEIGSVSKTLTATLGAYAVVKGALKLDDKVSQHGPWL

ACS44783.1                       KAHYFNYGVADRERAVGVSEQTLFEIGSVSKTLTATLGAYAVVQGGFELDDKASLFAPWL

ACS44784.1                       KAHYFNYGVADRERAVGVSEQTLFEIGSVSKTLTATLGAYAVVQGSFELDDKASLFAPWL

ACS44785.1                       KAHYFNYGVADRERAVGVSEQTLFEIGSVSKTLTATLGAYAVVQGSFELDDKASLFAPWL

Q51578|Q51578_KLEPN              KAHYFNYGVANRESGASVSEQTLFEIGSVSKTLTATLGAYAVVKGAMQLDDKASRHAPWL

AGH56079.1                       KAHYFNYGVADRERAVGVSEQTLFEIGSVSKPLTATLGAYAVVKGAMQLDDKASRHAPWL

X2C6D0|X2C6D0_AERCA              KAHYFNYGVADRERAVGVSEQTLFEIGSVSKPLTATLGAYAVVKGAMQLDDKASRHAPWL

ACI89425.1                       KAHYFNYGVADRERAVGVSEQTLFEIGSVSKPLTATLGAYAVVKGAMQLDDKASRHAPWL

Q9L3G2|Q9L3G2_KLEPN              KAHYFNYGVADRERAVGVSEQTLFEIGSVSKPLTATLGAYAVVKGAMQLDDKASRHAPWL

A0A0A8P164|A0A0A8P164_AERCA      KAHYFNYGVADRERAVGVSEQTLFEIGSVSKPLTATLGAYAVVKGAMQLDDKASRHAPWL

B1PZ94|B1PZ94_9GAMM              KAHYFNYGVADRERAVGVSEQTLFEIGSVSKPLTATLGAYAVVKGAMQLDDKASRHAPWL

ACA30419.1                       KAHYFNYGVADRERAVGVSEQTLFEIGSVSKPLTATLGAYAVVKGAMQLDDKASRHAPWL

A0A0A8P352|A0A0A8P352_AERME      KAHYFNYGVADRERAVGVSEQTLFEIGSVSKPLTATLGAYAVVKGAMQLDDKASRHAPWL

                                 **********:** .. ************** ***********:*.::****.* ..***

 

A0A0H3UAN3|A0A0H3UAN3_CITFR      KGSAFDGITMAELATYSAGGLPLQFPDEVDSIDKMRAYYRQWTPAYRAGSHRQYSNPSIG

ACS44783.1                       KGSAFDNITMGELATYSAGGLPLQFPEEVDSLEKMQAYYRQWTPAYSRGSHRQYANPSIG

ACS44784.1                       KGSVFDNITMGELATYSAGGLPLQFPEEVDSLEKMQAYYRQWTPAYSPGSHRQYANPSIG

ACS44785.1                       KGSVFDNITMGELATYSAGGLPLQFPEEVDSLEKMQAYYRQWTPAYSPGSHRQYANPSIG

Q51578|Q51578_KLEPN              KGSVFDSITMGELATYSAGGLPLQFPEEVDSSEKMRAYYRQWAPVYSPGSHRQYSNPSIG

AGH56079.1                       KGSAFDSITMGELATYSAGGLPLQFPEEVDSLEKMQAYYRQWTPAYSPGSHRQYSNPSIG

X2C6D0|X2C6D0_AERCA              KGSAFDSITMGELATYSAGGLPLQFPEEVDSLEKMQAYYRQWTPAYSPGSHRQYSNPSIG

ACI89425.1                       KGSAFDSITMGELATYSAGGLPLQFPEEVDSLEKMQAYYRQWTPAYSPGSHRQYSNPSIG

Q9L3G2|Q9L3G2_KLEPN              KGSAFDSITMGELATYSAGGLPLQFPEEVDSLEKMQAYYRQWTPAYSPGSHRQYSNPSIG

A0A0A8P164|A0A0A8P164_AERCA      KGSAFDSITMGELATYSAGGLPLQFPEEVDSLEKMQAYYRQWTPAYSPGSHRQYSNPSIG

B1PZ94|B1PZ94_9GAMM              KGSAFDSITMGELATYSAGGLPLQFPEEVDSLEKMQAYYRQWTPAYSPGSHRQYSNPSIG

ACA30419.1                       KGSAFDSITMGELATYSAGGLPLQFPEEVDSLEKMQAYYRQWTPAYSPGSHRQYSNPSIG

A0A0A8P352|A0A0A8P352_AERME      KGSAFDSITMGELATYSAGGLPLQFPEEVDSLEKMQAYYRQWTPAYSPGSHRQYSNPSIG

                                 ***.**.***.***************:**** :**:******:*.*  ******:*****

 

A0A0H3UAN3|A0A0H3UAN3_CITFR      LFGHLAAQSLGQPFEQLMSQTLLPGLGLEHTYLKVPAEAMANYAYGYSKEDKPIRVNPGV

ACS44783.1                       LFGYLAASSMKQPFDRLMEQTMLPGLGLYHTYLNVPEQPMGHYAYGYWKEDKPFRVTPAM

ACS44784.1                       LFGYLAASSMKQPFDRLMEQTILPGLGLYHTYLNVPEQAMGHYAYGYSKEDKPIRVTPGM

ACS44785.1                       LFGYLAASSMKQPFDRLMEQTMLPGLGLYHTYLTVPEQAMGHYAYGYSKEDKPIRVTPGM

Q51578|Q51578_KLEPN              LFGHLAASSLKQPFAQLMEQTLLPGLGMHHTYVNVPKQAMASYAYGYSKEDKPIRVNPGM

AGH56079.1                       LFGHLAASSMKQPFAQLMEQTLLPGLGLHHTYVNVPKQAMASYAYGYSKEDKPIRVSPGM

X2C6D0|X2C6D0_AERCA              LFGHLAASSMKQPFAQLMEQTLLPGLGLHHTYVNVPKQAMASYAYGYSKEDKPIRVSPGM

ACI89425.1                       LFGHLAASSMKQPFAQLMEQTLLPGLGLHHTYVNVPKQAMASYAYGYSKEDKPIRVSPGM

Q9L3G2|Q9L3G2_KLEPN              LFGHLAASSMKQPFAQLMEQTLLPGLGLHHTYVNVPKQAMASYAYGYSKEDKPIRVSPGM

A0A0A8P164|A0A0A8P164_AERCA      LFGHLAASSLKQPFAQLMEQTLLPGLGLHHTYVNVPKQAMASYAYGYSKEDKPIRVSPGM

B1PZ94|B1PZ94_9GAMM              LFGHLAASSLKQPFAQLMEQTLLPGLGLHHTYVNVPKQAMASYAYGYSKEDKPIRVSPGM

ACA30419.1                       LFGHLAASSLKQPFAQLMEQTLLPGLGLHHTYVNVPKQAMASYAYGYSKEDKPIRVSPGM

A0A0A8P352|A0A0A8P352_AERME      LFGHLAASSLKQPFAQLMEQTLLPGLGLHHTYVNVPKQAMASYAYGYSKEDKPIRVSPGM

                                 ***:***.*: *** :**.**:*****: ***:.** : *. ***** *****:**.*.:

 

A0A0H3UAN3|A0A0H3UAN3_CITFR      LADEAYGIKTSSADLLKFVGANMTGTGDEAMQQAIALTHKGVYSVGAMTQGLGWESYAYP

ACS44783.1                       LAEEPYGIKTSSADLLRFVKANISGVDNAAMQQAIDLTHQGQYAVGEMTQGLGWERYPYP

ACS44784.1                       LADEAYGIKTSSADLLRFVKANISGVDNAAMQQAIDLTHQGQYAVGEMTQGLGWERYAYP

ACS44785.1                       LADEAYGIKTSSADLLRFVKANIGGVDNAAMQQAIDLTHQGQYAVGEMTQGLGWERYAYP

Q51578|Q51578_KLEPN              LADEAYGIKTSSADLLAFVKANIGGVDDKALQQAISLTHKGHYSVGGMTQGLGWESYAYP

AGH56079.1                       LADEAYGIKTSSADLLRFVKANISGVDDKALQQAISLTHKGHYSVGGMTQGLGWESYAYP

X2C6D0|X2C6D0_AERCA              LADEAYGIKTSSADLLRFVKANISGVDDKALQQAISLTHKGHYSVGGMTQGLGWESYAYP

ACI89425.1                       LADEAYGIKTSSADLLRFVKANISGVDDKALQQAISLTHKGHYSVGGMTQGLGWESYAYP

Q9L3G2|Q9L3G2_KLEPN              LADEAYGIKTSSADLLRFVKANISGVHDKALQQAISLTHKGHYSVGGMTQGLGWESYAYP

A0A0A8P164|A0A0A8P164_AERCA      LADEAYGIKTSSADLLRFVKANISGVDDKALQQAISLTHKGHYSVGGMTQGLGWESYAYP

B1PZ94|B1PZ94_9GAMM              LADEAYGIKTSSADLLRFVKANISGVDDKALQQAISLTHKGHYSVGGMTQGLGWERYAYP

ACA30419.1                       LADEAYGIKTSSADLLRFVKANISGVDDKALQQAISLTHKGHYSVGGMTQGLGWERYAYP

A0A0A8P352|A0A0A8P352_AERME      LADEAYGIKTSSADLLRFVKANISGVDDKALQQAISLTHKGHYSVGGMTQGLGWERYAYP

                                 **:* *********** ** **: *. : *:**** ***:* *:** ******** * **

 

A0A0H3UAN3|A0A0H3UAN3_CITFR      VTEETLLAGNSGKVILEANPTAPASNETGSQVLFNKTGSTGGFGAYVAFVPAKGIGIVML

ACS44783.1                       VSEQTLLAGNSPAMIYNANPAAPAPAAAGHPVLFKKTGSTNGFGAYVAFVPAKGIGVVML

ACS44784.1                       VSEQTLLAGNSAAMIYNANPAAPAPAARGHPVLFNKTGSTNGFGAYVAFVPAKGIGIVML

ACS44785.1                       VSEQTLLAGNSPAMIYNAIPAVPAPAAAGHPVLFNKTGSTNGFGAYVAFVPAKGIGIVML

Q51578|Q51578_KLEPN              VTEQTLLAGNSAKVILEANPTA-APRESGSQVLFNKTGSSNGFGAYVAFVPARGIGIVML

AGH56079.1                       VSEQTLLAGNSPAMIYNANPAAPAPAAAGHPVLFNKTGSTSGFGAYVAFVPAKGIGIVML

X2C6D0|X2C6D0_AERCA              VSEQTLLAGNSPAMIYNANPAAPAPAAAGHPVLFNKTGSTSGFGAYVAFVPAKGIGIVML

ACI89425.1                       VSEQTLLAGNSAEVILEANPTA-APRESGNLMLFNKTGSTSGFGAYVAFVPAKGIGIVML

Q9L3G2|Q9L3G2_KLEPN              VSEQTLLAGNSAKVILEANPTA-APRESGSQMLFNKTGSTSGFGAYVAFVPAKGIGIVML

A0A0A8P164|A0A0A8P164_AERCA      VSEQILLAGNSAKVILEANPTA-APRESGSQMLFNKTGSTSGFGAYVAFVPAKGIGIVML

B1PZ94|B1PZ94_9GAMM              VSEQTLLAGNSAKVILEANPTA-APRESGSQMLFNKTGSTSGFGAYVAFVPAKGIGIVML

ACA30419.1                       VSEQTLLAGNSAKVILEANPTA-APRESGSQMLFNKTGSTSGFGAYVAFVPAKGIGIVML

A0A0A8P352|A0A0A8P352_AERME      VSEQTLLAGNSAKVILEANPTA-APRESGSQMLFNKTGSTSGFGAYVAFVPAKGIGIVML

                                 *:*: ******  :* :* *:. *    *  :**:****:.***********:***:***

 

A0A0H3UAN3|A0A0H3UAN3_CITFR      ANRNYPIQARVETAHAILSKLAE

ACS44783.1                       ANRNYPNEGTLKAGHAILTQLAR

ACS44784.1                       ANRNSPIEGTLKAGHAILTQLAR

ACS44785.1                       ANRNSPIEARIKAAHAILTQLAR

Q51578|Q51578_KLEPN              ANRNYPIPARVKAAHAILAQLAG

AGH56079.1                       ANRNYPIPARVKAAHAILTQLAR

X2C6D0|X2C6D0_AERCA              ANRNYPIPARVKAAHAILTQLAR

ACI89425.1                       ANRNYPIPARVKAAHAILTQLAR

Q9L3G2|Q9L3G2_KLEPN              ANRNYPIPARVKAAHAILTQLAR

A0A0A8P164|A0A0A8P164_AERCA      ANRNYPIPARVKAAHAILTQLAR

B1PZ94|B1PZ94_9GAMM              ANRNYPIPARVKAAHAILTQLAR

ACA30419.1                       ANRNYPIPARVKAAHAILTQLAR

A0A0A8P352|A0A0A8P352_AERME      ANRNYPIPARVKAAHAILTQLAR

                                 **** *  . :::.****::**