#  Percent Identity  Matrix - created by Clustal2.1

#

#

 

     1: AAA91586.2            100.00  100.00   99.28   97.46   33.47   39.44   33.72   30.00   29.80   31.25   31.25   31.64   31.64   24.18   24.18   26.23   24.18   24.18   25.00   22.95   22.95   24.49   24.90   24.49   24.49   24.49   24.79   22.27   23.29   24.50   24.50   23.14   24.10

     2: AAF72981.1            100.00  100.00   99.28   97.46   33.47   39.44   33.72   30.00   29.80   31.25   31.25   31.64   31.64   24.18   24.18   26.23   24.18   24.18   25.00   22.95   22.95   24.49   24.90   24.49   24.49   24.49   24.79   22.27   23.29   24.50   24.50   23.14   24.10

     3: AAR12140.1             99.28   99.28  100.00   97.46   33.47   39.44   33.33   29.62   29.41   30.86   30.86   31.25   31.25   24.18   24.18   26.23   24.18   24.18   25.00   22.95   22.95   24.49   24.90   24.49   24.49   24.49   24.79   22.27   23.29   24.50   24.50   23.55   24.10

     4: AAP69225.1             97.46   97.46   97.46  100.00   33.47   40.24   33.72   29.62   29.80   31.25   31.25   31.64   31.64   25.00   25.00   26.23   24.59   24.59   25.82   23.77   23.77   23.67   24.49   24.08   24.08   24.08   24.36   22.69   23.69   24.90   24.90   22.73   23.69

     5: AAA83417.1             33.47   33.47   33.47   33.47  100.00   43.13   39.16   41.60   37.40   44.11   43.73   44.11   44.11   24.46   24.46   24.03   22.75   22.75   24.89   24.89   24.46   23.40   25.11   25.11   25.11   25.11   26.13   24.03   19.75   20.50   20.92   26.81   27.85

     6: Q9AEF8|Q9AEF8_9GAMM    39.44   39.44   39.44   40.24   43.13  100.00   37.26   35.61   32.95   38.78   38.78   39.16   39.16   23.63   23.63   22.78   21.94   21.94   24.47   24.05   24.05   20.50   23.01   23.43   23.01   23.01   23.45   26.69   22.41   23.14   23.55   24.79   26.67

     7: AAA98406.2             33.72   33.72   33.33   33.72   39.16   37.26  100.00   40.52   37.83   38.29   37.92   38.29   38.29   22.41   22.41   23.24   23.24   23.24   23.24   21.99   21.99   24.69   25.10   24.28   24.69   24.69   25.97   22.46   21.95   21.46   21.46   24.27   23.98

     8: ABX38721.1             30.00   30.00   29.62   29.62   41.60   35.61   40.52  100.00   48.51   49.81   49.81   50.19   50.19   26.23   26.23   27.87   27.46   27.87   28.69   28.28   28.28   22.04   22.45   22.86   22.86   22.86   23.93   25.73   19.84   20.97   20.97   26.64   23.69

     9: AAD12233.1             29.80   29.80   29.41   29.80   37.40   32.95   37.83   48.51  100.00   50.56   50.56   50.94   50.94   23.21   23.21   23.21   22.36   22.36   23.21   22.36   22.36   22.59   23.43   23.43   23.43   23.43   26.20   22.88   21.16   21.07   20.66   24.79   24.38

    10: Q6ZZZ2|Q6ZZZ2_BURPE    31.25   31.25   30.86   31.25   44.11   38.78   38.29   49.81   50.56  100.00   99.26   99.26   99.63   26.27   26.27   27.54   26.27   26.27   27.97   27.12   27.12   22.69   25.21   26.05   25.63   25.63   24.34   23.73   20.75   21.49   21.49   25.63   26.14

    11: Q8KKG2|Q8KKG2_BURPE    31.25   31.25   30.86   31.25   43.73   38.78   37.92   49.81   50.56   99.26  100.00   99.26   99.63   25.85   25.85   27.12   25.85   25.85   27.54   26.69   26.69   22.27   24.79   25.63   25.21   25.21   23.89   23.31   20.33   21.07   21.07   25.21   25.73

    12: Q8KKG3|Q8KKG3_BURPE    31.64   31.64   31.25   31.64   44.11   39.16   38.29   50.19   50.94   99.26   99.26  100.00   99.63   26.27   26.27   27.54   26.27   26.27   27.97   27.12   27.12   22.69   25.21   26.05   25.63   25.63   24.78   23.73   20.75   21.49   21.49   25.63   26.14

    13: Q6ZZU6|Q6ZZU6_BURPE    31.64   31.64   31.25   31.64   44.11   39.16   38.29   50.19   50.94   99.63   99.63   99.63  100.00   26.27   26.27   27.54   26.27   26.27   27.97   27.12   27.12   22.69   25.21   26.05   25.63   25.63   24.34   23.73   20.75   21.49   21.49   25.63   26.14

    14: AAC23554.1             24.18   24.18   24.18   25.00   24.46   23.63   22.41   26.23   23.21   26.27   25.85   26.27   26.27  100.00   99.62   72.18   73.68   74.06   75.19   74.81   75.19   36.92   34.75   33.20   34.75   33.98   36.14   37.50   36.54   37.55   37.93   36.43   30.80

    15: AAG33665.1             24.18   24.18   24.18   25.00   24.46   23.63   22.41   26.23   23.21   26.27   25.85   26.27   26.27   99.62  100.00   71.80   73.31   73.68   74.81   74.44   74.81   36.54   34.75   33.20   34.75   33.98   36.14   37.50   36.54   37.55   37.93   36.43   30.80

    16: AAN63499.1             26.23   26.23   26.23   26.23   24.03   22.78   23.24   27.87   23.21   27.54   27.12   27.54   27.54   72.18   71.80  100.00   91.73   92.48   80.45   80.45   80.45   34.62   34.75   32.82   33.98   33.20   31.33   32.66   33.46   34.10   34.87   33.72   32.32

    17: AAK55330.1             24.18   24.18   24.18   24.59   22.75   21.94   23.24   27.46   22.36   26.27   25.85   26.27   26.27   73.68   73.31   91.73  100.00   99.25   80.83   80.45   80.45   35.77   34.75   33.59   34.36   33.59   31.73   32.66   33.85   34.87   35.63   33.72   31.94

    18: AAN41427.1             24.18   24.18   24.18   24.59   22.75   21.94   23.24   27.87   22.36   26.27   25.85   26.27   26.27   74.06   73.68   92.48   99.25  100.00   81.20   81.20   81.20   36.15   35.14   33.98   34.75   33.98   31.73   32.26   33.85   34.87   35.63   33.72   31.94

    19: P0A1V8|BLO2_SALTM      25.00   25.00   25.00   25.82   24.89   24.47   23.24   28.69   23.21   27.97   27.54   27.97   27.97   75.19   74.81   80.45   80.83   81.20  100.00   90.55   90.91   35.00   34.75   33.98   33.98   33.98   33.47   34.68   34.23   35.63   36.02   34.50   31.56

    20: AAC41449.1             22.95   22.95   22.95   23.77   24.89   24.05   21.99   28.28   22.36   27.12   26.69   27.12   27.12   74.81   74.44   80.45   80.45   81.20   90.55  100.00   99.64   35.38   33.98   32.05   33.20   32.43   33.07   34.27   33.85   35.25   35.63   34.11   31.56

    21: P94124|P94124_ACIBA    22.95   22.95   22.95   23.77   24.46   24.05   21.99   28.28   22.36   27.12   26.69   27.12   27.12   75.19   74.81   80.45   80.45   81.20   90.91   99.64  100.00   35.38   33.98   32.05   33.20   32.43   32.67   33.87   33.46   34.87   35.25   34.11   31.18

    22: sp|Q00982|BLO5_PSEAI   24.49   24.49   24.49   23.67   23.40   20.50   24.69   22.04   22.59   22.69   22.27   22.69   22.69   36.92   36.54   34.62   35.77   36.15   35.00   35.38   35.38  100.00   81.58   80.75   81.58   81.20   35.06   38.80   31.44   32.83   32.45   35.66   34.09

    23: AAB60534.1             24.90   24.90   24.90   24.49   25.11   23.01   25.10   22.45   23.43   25.21   24.79   25.21   25.21   34.75   34.75   34.75   34.75   35.14   34.75   33.98   33.98   81.58  100.00   95.47   96.62   95.86   35.60   37.60   30.30   30.94   30.57   34.50   32.70

    24: P35695|BLO7_ECOLX      24.49   24.49   24.49   24.08   25.11   23.43   24.28   22.86   23.43   26.05   25.63   26.05   26.05   33.20   33.20   32.82   33.59   33.98   33.98   32.05   32.05   80.75   95.47  100.00   98.11   99.62   35.34   38.96   30.04   31.06   30.68   34.63   32.06

    25: AAC46344.1             24.49   24.49   24.49   24.08   25.11   23.01   24.69   22.86   23.43   25.63   25.21   25.63   25.63   34.75   34.75   33.98   34.36   34.75   33.98   33.20   33.20   81.58   96.62   98.11  100.00   98.50   34.40   38.00   30.30   30.94   30.57   34.50   31.94

    26: AAR32651.1             24.49   24.49   24.49   24.08   25.11   23.01   24.69   22.86   23.43   25.63   25.21   25.63   25.63   33.98   33.98   33.20   33.59   33.98   33.98   32.43   32.43   81.20   95.86   99.62   98.50  100.00   35.20   38.80   30.30   30.94   30.57   34.50   31.94

    27: AAT01092.1             24.79   24.79   24.79   24.36   26.13   23.45   25.97   23.93   26.20   24.34   23.89   24.78   24.34   36.14   36.14   31.33   31.73   31.73   33.47   33.07   32.67   35.06   35.60   35.34   34.40   35.20  100.00   44.86   40.16   42.80   42.80   37.14   32.94

    28: AAP69916.1             22.27   22.27   22.27   22.69   24.03   26.69   22.46   25.73   22.88   23.73   23.31   23.73   23.73   37.50   37.50   32.66   32.66   32.26   34.68   34.27   33.87   38.80   37.60   38.96   38.00   38.80   44.86  100.00   53.75   56.30   55.91   41.67   34.13

    29: AAU88145.1             23.29   23.29   23.29   23.69   19.75   22.41   21.95   19.84   21.16   20.75   20.33   20.75   20.75   36.54   36.54   33.46   33.85   33.85   34.23   33.85   33.46   31.44   30.30   30.04   30.30   30.30   40.16   53.75  100.00   94.78   94.03   43.46   33.33

    30: ABW76134.1             24.50   24.50   24.50   24.90   20.50   23.14   21.46   20.97   21.07   21.49   21.07   21.49   21.49   37.55   37.55   34.10   34.87   34.87   35.63   35.25   34.87   32.83   30.94   31.06   30.94   30.94   42.80   56.30   94.78  100.00   99.26   45.98   35.47

    31: ABW76138.1             24.50   24.50   24.50   24.90   20.92   23.55   21.46   20.97   20.66   21.49   21.07   21.49   21.49   37.93   37.93   34.87   35.63   35.63   36.02   35.63   35.25   32.45   30.57   30.68   30.57   30.57   42.80   55.91   94.03   99.26  100.00   45.98   35.09

    32: AAQ76277.1             23.14   23.14   23.55   22.73   26.81   24.79   24.27   26.64   24.79   25.63   25.21   25.63   25.63   36.43   36.43   33.72   33.72   33.72   34.50   34.11   34.11   35.66   34.50   34.63   34.50   34.50   37.14   41.67   43.46   45.98   45.98  100.00   47.51

    33: AAQ08905.1             24.10   24.10   24.10   23.69   27.85   26.67   23.98   23.69   24.38   26.14   25.73   26.14   26.14   30.80   30.80   32.32   31.94   31.94   31.56   31.56   31.18   34.09   32.70   32.06   31.94   31.94   32.94   34.13   33.33   35.47   35.09   47.51  100.00

 

CLUSTAL O(1.2.4) multiple sequence alignment

 

 

AAA91586.2                -MKNTIHINFAIFLIIANIIYSSASASTDISTV-------------ASPLFEGTEGCFLL

AAF72981.1                -MKNTIHINFAIFLIIANIIYSSASASTDISTV-------------ASPLFEGTEGCFLL

AAR12140.1                -MKNTIHINFAIFLIIANIIYSSASASTDISTV-------------ASPLFEGTEGCFLL

AAP69225.1                -MKNTIHINFAIFLIIANIIYSSASASTDISTV-------------ASQLFEGTEGCFLL

AAA83417.1                -------M---------SRL--LLSGLLATGLL-------------CAVPASAASGCFLY

Q9AEF8|Q9AEF8_9GAMM       -------M---------KK----LSVLLWLTLF-------------YCGTIWAQSTCFLV

AAA98406.2                -MKKIL-L---------LHMLVFVSATLPISSV-------------A-SDEVETLKCTII

ABX38721.1                ----MT-V---------RRLSCALGAALSLSAL-------------GGGPVQAAVLCTVV

AAD12233.1                -------M---------KRRHAAIGAL--LAAL-------------ATFAHAEHPICTIV

Q6ZZZ2|Q6ZZZ2_BURPE       -------M---------KFRHALSSAFVLLGCI-------------A-ASAHAKTICTAI

Q8KKG2|Q8KKG2_BURPE       -------M---------KFRHALSSAFVLLGCI-------------A-ASAHAKTICTAI

Q8KKG3|Q8KKG3_BURPE       -------M---------KFRHALSSAFVLLGCI-------------A-ASAHAKTICTAI

Q6ZZU6|Q6ZZU6_BURPE       -------M---------KFRHALSSAFVLLGCI-------------A-ASAHAKTICTAI

AAC23554.1                -MIIRFLA--LLF-----------SAVVLVSLGHAQEKTHESSNWGKYFSDFNAKGTIVV

AAG33665.1                -MIIRFLA--LLF-----------SAVVLVSLGHAQDKTHESSNWGKYFSDFNAKGTIVV

AAN63499.1                -MAIRFFT--ILL-----------STFFLTSFVYAQEHVVIRSDWKKFFSDLQAEGAIVI

AAK55330.1                -MAIRFLT--ILL-----------STFFLTSFVHAQEHVLERSDWKKFFSDLRAEGAIVI

AAN41427.1                -MAIRFLT--ILL-----------STFFLTSFVHAQEHVLERSDWKKFFSDLRAEGAIVI

P0A1V8|BLO2_SALTM         -MAIRIFA--ILF-----------SIFSLATFAHAQEGTLERSDWRKFFSEFQAKGTIVV

AAC41449.1                -MAIRIFA--ILF-----------STFVFGTFAHAQEGMRERSDWRKFFSEFQAKGTIVV

P94124|P94124_ACIBA       -MAIRIFA--ILF-----------STFVFGTFAHAQEGMRERSDWRKFFSEFQAKGTIVV

sp|Q00982|BLO5_PSEAI      -MKTIAAY--LVL--------------VFYASTALSESISENLAWNKEFSSESVHGVFVL

AAB60534.1                -MKTFAAY--VII--------------ACLSSTALAGSITENTSWNKEFSAEAVNGVFVL

P35695|BLO7_ECOLX         -MKTFAAY--VIT--------------ACLSSTALASSITENTFWNKEFSAEAVNGVFVL

AAC46344.1                -MKTFAAY--VIT--------------ACLSSTALASSITENTSWNKEFSAEAVNGVFVL

AAR32651.1                -MKTFAAY--VIT--------------ACLSSTALASSITENTFWNKEFSAEAVNGVFVL

AAT01092.1                -MKKITLF--LLF--------L-------------NLVFGQDKILNNWFKEYNTSGTFVF

AAP69916.1                -------M--LLF-----------MFSII-------SFGNENQFMKEIFERKGLNGTFVV

AAU88145.1                -MSKKNFI--LIF-----------IFVILISCKNTEKISNETTLIDNIFTNSNAEGTLVI

ABW76134.1                -MSKKNFI--LIF-----------IFVILISCKNTEKISNETTLIDNIFTNSNAEGTLVI

ABW76138.1                -MSKKNFI--LIF-----------IFVILTSCKNTEKISNETTLIDNIFTNSNAEGTLVI

AAQ76277.1                -----MRP--LLF-----------SALLLLSGHTQASEWNDSQAVDKLFGAAGVKGTFVL

AAQ08905.1                MLSRYSKT--LAF--------AVVACTLAISTATAHAELVVRNDLKRVFDDAGVSGTFVL

                                                                                     

 

AAA91586.2                YDASTNAEIA-QFNKAKCATQMAPDSTFKIALSLMAFDAEIIDQKTIFKWDKT----PKG

AAF72981.1                YDASTNAEIA-QFNKAKCATQMAPDSTFKIALSLMAFDAEIIDQKTIFKWDKT----PKG

AAR12140.1                YDVSTNAEIA-QFNKAKCATQMAPDSTFKIALSLMAFDAEIIDQKTIFKWDKT----PKG

AAP69225.1                YDASTNAEIA-QFNKAKCAAQMAPDSTFKIALSLMAFDAEIIDQKTIFKWDKI----PKG

AAA83417.1                ADG-NGQTLSSEG---DCSSQLPPASTFKIPLALMGYDSGFLVNEEHPALPYKPSYDGWL

Q9AEF8|Q9AEF8_9GAMM       QEN-QTVLKHEGK---DCNKRFAPESTFKIALSLMGFDSGILKDTLNPEWPYKKEYELYL

AAA98406.2                ADAITGNTLYETG---ECARRVSPCSSFKLPLAIMGFDSGILQSPKSPTWELKPEYNPSP

ABX38721.1                ADAADGRILFQQGTQQACAERYTPASTFKLAIALMGADAGILQGPHEPVWNYQPAYPDWG

AAD12233.1                ADAATGKAVLHEG---KCDERVTPASTFKLALAVMGFDHGFLKDEHTPVEHFRHGDPDWG

Q6ZZZ2|Q6ZZZ2_BURPE       ADAGTGKLLVQDG---DCGRRASPASTFKIAISLMGYDAGFLRNEHDPVLPYRDSYIAWG

Q8KKG2|Q8KKG2_BURPE       ADAGTGKLLVQDG---DCGRRASPASTFKIAISLMGYDAGFLRNEHDPVLPYRDSYIAWG

Q8KKG3|Q8KKG3_BURPE       ADAGTGKLLVQDG---DCGRRASPASTFKIAISLMGYDAGFLRNEHDPVLPYRDSYIAWG

Q6ZZU6|Q6ZZU6_BURPE       ADAGTGKLLVQDG---DCGRRASPASTFKIAISLMGYDAGFLRNEHDPVLPYRDSYIAWG

AAC23554.1                VDERTNGNSTSVYNESRAQQRYSPASTFKIPHTLFALDAGAVRDEFHVF-RWDGA--KRS

AAG33665.1                VDERTNGNSTSVYNESRAQQRYSPASTFKIPHTLFALDAGAVRDEFHVF-RWDGA--KRS

AAN63499.1                ADERQAKHTLSVFDQERAAKRYSPASTFKIPHTLFALDADAVRDEFQVF-RWDGV--NRS

AAK55330.1                SDERQAEHALLVFGQERAAKRYSPASTFKLPHTLFALDADAVRDEFQVF-RWDGV--KRS

AAN41427.1                SDERQAEHALLVFGQERAAKRYSPASTFKLPHTLFALDADAVRDEFQVF-RWDGV--KRS

P0A1V8|BLO2_SALTM         ADERQADRAMLVFDPVRSKKRYSPASTFKIPHTLFALDAGAVRDEFQIF-RWDGV--NRG

AAC41449.1                ADERQTDRVILVFDQVRSEKRYSPASTFKIPHTLFALDAGAARDEFQVF-RWDGI--KRS

P94124|P94124_ACIBA       ADERQTDRVILVFDQVRSEKRYSPASTFKIPHTLFALDAGAARDEFQVF-RWDGI--KRS

sp|Q00982|BLO5_PSEAI      CKSSS-N-SCTTNNAARASTAYIPASTFKIPNALIGLETGAIKDERQVF-KWDGK--PRA

AAB60534.1                CKSSS-K-SCATNDLARASKEYLPASTFKIPNAIIGLETGVIKNEHQVF-KWDGK--PRA

P35695|BLO7_ECOLX         CKSSS-KLACATNNLARASKEYLPASTFKIPNAIIGLETGVIKNEHQIF-KWDGK--PRA

AAC46344.1                CKSSS-K-SCATNNLARASKEYLPASTFKIPSAIIGLETGVIKNEHQVF-KWDGK--PRA

AAR32651.1                CKSSS-K-SCATNNLARASKEYLPASTFKIPNAIIGLETGVIKNEHQIF-KWDGK--PRA

AAT01092.1                YDGK----TWASNDFSRAMETFSPASTFKIFNALIALDSGVIKTKKEIFYHYRGE--KVF

AAP69916.1                YDLKN-D-KIDYYNLDRANERFYPASSFKIFNTLIGLENGIVKNVDEMFYYYDGS--KVF

AAU88145.1                YNLND-D-KYIIHNKERAEQRFYPASTFKIYNSLIGLNEKAVKDVDEVFYKLMA---KSF

ABW76134.1                YNLND-D-KYIIHNKERAEQRFYPASTFKIYNSLIGLNEKAVKDVDEVFYKYNGE--KVF

ABW76138.1                YNLND-D-KYIIHNKERAEQRFYPASTFKIYNSLIGLNEKAVKDVDEVFYKYNGE--KVF

AAQ76277.1                YDVQR-Q-RYVGHDRERAETRFVPASTYKVANSLIGLSTGAVRSADEVL-PYGGK--PQR

AAQ08905.1                MDITA-D-RTYVVDPARAARSIHPASTFKIPNSLIAFDTGAVRDDQEVL-PYGGK--PQP

                           .               .     * *::*:  :::. .                     

 

AAA91586.2                MEIWNSNHTPKTWMQFSVVWVSQEITQKIGLNKIKNYLKDFDYGNQDFSGDKERNNGLTE

AAF72981.1                MEIWNSNHTPKTWMQFSVVWVSQEITQKIGLNKIKNYLKDFDYGNQDFSGDKERNNGLTE

AAR12140.1                MEIWNSNHTPKTWMQFSVVWVSQEITQKIGLNKIKNYLKDFDYGNQDFSGDKERNNGLTE

AAP69225.1                MEIWNSNHTPKTWMQFSVVWVSQEITQKIGLNKIKNYLKDFDYGNQDFSGDKERNNGLTE

AAA83417.1                -PAWRETTTPRRWETYSVVWFSQQITEWLGMERFQQYVDRFDYGNRDLSGNPGKHDGLTQ

Q9AEF8|Q9AEF8_9GAMM       -NVWKYPHNPRTWIRDSCVWYSQVLTQQLGMTRFKNYVDAFHYGNQDISGDKGQNNGLTH

AAA98406.2                RDRTYKQVYPALWQSDSVVWFSQQLTSRLGVDRFTEYVKKFEYGNQDVSGDSGKHNGLTQ

ABX38721.1                GDAWRQPTDPARWIKYSVVWYSQLTAKALGQDRFQRYTSAFGYGNADVSGEPGKHNGTDG

AAD12233.1                GEAWHQPIDPALWLKYSVVWYSQRITHAMGAQTFQAYVRKLGYGNMDVSGDPGKNNGMDR

Q6ZZZ2|Q6ZZZ2_BURPE       GEAWKQPTDPTRWLKYSVVWYSQQVAHHLGAQRFAQYAKAFGYGNADVSGDPGQNNGLDR

Q8KKG2|Q8KKG2_BURPE       GEAWKQPTDPTRWLKYPVVWYSQQVAHHLGAQRFAQYAKAFGYGNADVSGDPGQNNGLDR

Q8KKG3|Q8KKG3_BURPE       GEAWKQPTDPTRWLKYSVVWYSQQVAHHLGAQRFAQYAKAFGYGNADVSGDPGQNNGLDR

Q6ZZU6|Q6ZZU6_BURPE       GEAWKQPTDPTRWLKYSVVWYSQQVAHHLGAQRFAQYAKAFGYGNADVSGDPGQNNGLDR

AAC23554.1                FAGHNQDQNLRSAMRNSTVWVYQLFAKEIGENKARSYLEKLNYGNADPSTK------SGD

AAG33665.1                FAGHNQDQNLRSAMRNSTVWVYQLFAKEIGENKARSYLEKLNYGNADPSTK------SGD

AAN63499.1                FAGHNQDQDLRSAMRNSTVWVYELFAKDIGEDKARRYLKQIDYGNVDPSTI------KGD

AAK55330.1                FAGHNQDQDLRSAMRNSAVWVYELFAKEIGKDKARHYLKQIDYGNADPSTI------KGD

AAN41427.1                FAGHNQDQDLRSAMRNSAVWVYELFAKEIGEDKARRYLKQIDYGNADPSTI------KGD

P0A1V8|BLO2_SALTM         FAGHNQDQDLRSAMRNSTVWVYELFAKEIGDDKARRYLKKIDYGNADPSTS------NGD

AAC41449.1                FAAHNQDQDLRSAMRNSTVWIYELFAKEIGEDKARRYLKQIDYGNADPSTS------NGD

P94124|P94124_ACIBA       FAAHNQDQDLRSAMRNSTVWIYELFAKEIGEDKARRYLKQIDYGNADPSTS------NGD

sp|Q00982|BLO5_PSEAI      MKQWEKDLKLRGAIQVSAVPVFQQIAREVGEIRMQKYLNLFSYGNANIGGG------IDK

AAB60534.1                MKQWERDLTLRGAIQVSAVPVFQQIAREVGEVRMQKYLKKFSYGNQNISGG------IDK

P35695|BLO7_ECOLX         MKQWERDLSLRGAIQVSAVPVFQQIAREVGEVRMQKYLKKFSYGNQNISGG------IDK

AAC46344.1                MKQWERDLSLRGAIQVSAVPVFQQIAREVGEVRMQKYLKKFSYGNQNISGG------IDK

AAR32651.1                MKQWERDLSLRGAIQVSAVPVFQQIAREVGEVRMQKYLKKFSYGNQNISGG------IDK

AAT01092.1                LSSWAQDMNLSSAIKYSNVLAFKEVARRIGIKTMQEYLNKLHYGNAKIS-K------IDT

AAP69916.1                LDSWAKDSNLRYAIKVSQVPAYKKLARELGKERMQEGLNKLNYGNKEIGSE------IDK

AAU88145.1                LESWAKDSNLRYAIKNSQVPAYKELARRIGIKKMKENIEKLDFGNKSIGDS------VDT

ABW76134.1                LESWAKDSNLRYAIKNSQVPAYKELARRIGLKKMKENIEKLDFGNKSIGDS------VDT

ABW76138.1                LESWAKDSNLRYAIKNSQVPAYKELARRIGLKKMKENIEKLDFGNKSIGDS------VDT

AAQ76277.1                FKAWEHDMSLRDAIKASNVPVYQELARRIGLERMRANVSRLGYGNAEIGQV------VDN

AAQ08905.1                YEQWEHDMALPEAIRLSAVPIYQEVARRVGFERMQAYVDAFDYGNRQLGSA------IDQ

                                            *   :  :  :*          : :** . .          

 

AAA91586.2                AWLESSLKISPEEQIQFLRKIINHNLPVKNSAIENTIENMYLQDLDNSTKLYGKTGAGFT

AAF72981.1                AWLESSLKISPEEQIQFLRKIINHNLPVKNSAIENTIENMYLQDLDNSTKLYGKTGAGFT

AAR12140.1                AWLESSLKISPEEQIQFLRKIINHNLPVKNSAIENTIENMYLQDLENSTKLYGKTGAGFT

AAP69225.1                AWLESSLKISPEEQIQFLRKIINHNLPVRNSAIENTIDNMYLQDLENSTKLYGKTGAGFT

AAA83417.1                AWLSSSLAISPEEQARFLGKMVSGKLPVSAQTLQYTANILKVSEV-EGWQIHGKTGMGYP

Q9AEF8|Q9AEF8_9GAMM       SWLSSSLAISPSEQIQFLQKIVNKKLSVNPKAFTMTKDILYIQELAGGWKLYGKTGNGRQ

AAA98406.2                SWLMSSLTISPKEQIQFLLRFVAHKLPVSEAAYDMAYATIPQYQAAEGWAVHGKSGSGWL

ABX38721.1                AWIISSLRISPLEQLAFLRKLVNRQLPVKAAAYELAENLFEAG-QADGWRLYGKTGTGSP

AAD12233.1                SWITSSLKISPEE