#  Percent Identity  Matrix - created by Clustal2.1

#

#

 

     1: ABY79006.1  100.00   99.25   95.85   96.62   95.86   96.24   95.86   34.36   34.75   34.36   34.75   34.36   34.36   26.38   27.31   23.46

     2: CAA80304.1   99.25  100.00   95.85   96.62   95.86   96.24   95.86   34.36   34.36   33.98   34.36   33.98   33.98   25.98   26.89   23.05

     3: ACN85419.1   95.85   95.85  100.00   99.25   99.25   99.62   99.25   33.33   33.72   33.33   33.33   33.33   34.11   26.09   27.00   23.14

     4: AAD02245.1   96.62   96.62   99.25  100.00   99.25   99.62   99.25   33.20   33.59   33.20   33.59   33.20   33.98   26.77   27.31   23.46

     5: ACO72579.1   95.86   95.86   99.25   99.25  100.00   99.62   99.62   33.20   33.59   33.59   33.20   33.20   33.98   26.38   26.89   23.05

     6: AAK49460.1   96.24   96.24   99.62   99.62   99.62  100.00   99.62   33.59   33.98   33.59   33.59   33.59   34.36   26.77   27.31   23.46

     7: AAF72942.1   95.86   95.86   99.25   99.25   99.62   99.62  100.00   33.20   33.59   33.59   33.20   33.20   33.98   26.38   26.89   23.05

     8: ACT09125.1   34.36   34.36   33.33   33.20   33.20   33.59   33.20  100.00   99.27   99.27   99.27   99.27   90.55   27.41   23.77   26.91

     9: AAB05874.1   34.75   34.36   33.72   33.59   33.59   33.98   33.59   99.27  100.00   99.27   99.27   99.27   90.55   27.41   23.77   26.91

    10: ACM67635.1   34.36   33.98   33.33   33.20   33.59   33.59   33.59   99.27   99.27  100.00   99.27   99.27   90.55   27.41   23.77   26.91

    11: ABQ15112.1   34.75   34.36   33.33   33.59   33.20   33.59   33.20   99.27   99.27   99.27  100.00   99.27   90.55   28.19   24.59   27.71

    12: AAK58418.1   34.36   33.98   33.33   33.20   33.20   33.59   33.20   99.27   99.27   99.27   99.27  100.00   90.55   27.41   23.77   26.91

    13: AAP43641.1   34.36   33.98   34.11   33.98   33.98   34.36   33.98   90.55   90.55   90.55   90.55   90.55  100.00   27.03   24.59   25.70

    14: AAK52604.1   26.38   25.98   26.09   26.77   26.38   26.77   26.38   27.41   27.41   27.41   28.19   27.41   27.03  100.00   29.41   33.85

    15: CAD58780.1   27.31   26.89   27.00   27.31   26.89   27.31   26.89   23.77   23.77   23.77   24.59   23.77   24.59   29.41  100.00   67.42

    16: AAB58555.1   23.46   23.05   23.14   23.46   23.05   23.46   23.05   26.91   26.91   26.91   27.71   26.91   25.70   33.85   67.42  100.00

 

CLUSTAL O(1.2.4) multiple sequence alignment

 

 

ABY79006.1      -----------MKTFAAYVIIACLSS-TALAGSITENTSWNKEFSAEAVNGVFVLCKSSS

CAA80304.1      -----------MKTFAAYVIIACLSS-TALAGSITENTSWNKEFSAEAVNGVFVLCKSSS

ACN85419.1      -----------MKTFAAYVITACLSS-TALASSITENTSWNKEFSAEAVNGVFVLCKSSS

AAD02245.1      -----------MKTFAAYVITACLSS-TALASSITENTSWNKEFSAEAVNGVFVLCKSSS

ACO72579.1      -----------MKTFAAYVITACLSS-TALASSITENTSWNKEFSAEAVNGVFVLCKSSS

AAK49460.1      -----------MKTFAAYVITACLSS-TALASSITENTSWNKEFSAEAVNGVFVLCKSSS

AAF72942.1      -----------MKTFAAYVITACLSS-TALASSITENTSWNKEFSAEAVNGVFVLCKSSS

ACT09125.1      ---------MAIRIFAILFSIFSLATFAHAQEGTLERSDWRKFFSEFQAKGTIVVADERQ

AAB05874.1      ---------MAIRIFAILFSIFSLATFAHAQEGTLERSDWRKFFSEFQAKGTIVVADERQ

ACM67635.1      ---------MAIRIFAILFSIFSLATFAHAQEGTLERSDWRKFFSEFQAKGTIVVADERQ

ABQ15112.1      ---------MAIRIFAILFSIFSLATFAHAQEGTLERSDWRKFFSEFQAKGTIVVADERQ

AAK58418.1      ---------MAIRIFAILFSIFSLATFAHAQEGTLERSDWRKFFSEFQAKGTIVVADERQ

AAP43641.1      ---------MAIQIFAILFSTFVLATFAHAQDGTLERSDWGKFFSDFQAKGTIVVADERQ

AAK52604.1      ------MKNTIHINFAIFLIIANI--IYSSASASTDISTVASP-LFEGTEGCFLLYDVST

CAD58780.1      ------MRGKHTVILGA-----ALSALFAGAAG-------------AQMLECTLVADAAS

AAB58555.1      MQRSLSMSGKRHFIFAVSFVISTVCLTFSPANA-------------AQKLSCTLVIDEAS

                              :.       :        .                    :: .  

 

ABY79006.1      --KSCATNDLARASKEYLPASTFKIPSAIIGLETGVIKNEHQVFKWDGKPR--AMKQWER

CAA80304.1      --KSCATNDLARASKEYLPASTFKIPNAIIGLETGVIKNEHQVFKWDGKPR--AMKQWER

ACN85419.1      --KSCATNNLARASKEYLPASTFKIPNAIIGLETGVIKNEHQVFKWDGKPR--AMKQWER

AAD02245.1      --KSCATNNLARASKEYLPASTFKIPNAIIGLETGVIKNEHQVFKWDGKPR--AMKQWER

ACO72579.1      --KSCATNNLARASKEYLPASTFKIPNAIIGLETGVIKNEHQVFKWDGKPR--AMKQWER

AAK49460.1      --KSCATNNLARASKEYLPASTFKIPNAIIGLETGVIKNEHQVFKWDGKPR--AMKQWER

AAF72942.1      --KSCATNNLARASKEYLPASTFKIPNAIIGLETGVIKNEHQVFKWDGKPR--AMKQWER

ACT09125.1      ADRAMLVFDPVRSKKRYSPASTFKIPHTLFALDAGAVRDEFQIFRWDGVNR--GFAGHNQ

AAB05874.1      ADRAMLVFDPVRSKKRYSPASTFKIPHTLFALDAGAVRDEFQIFRWDGVNR--GFAGHNQ

ACM67635.1      ADRAMLVFDPVRSKKRYSPASTFKIPHTLFALDAGAVRDEFQIFRWDGVNR--GFAGHNQ

ABQ15112.1      ADRAMLVFDPVRSKKRYSPASTFKIPHTLFALDAGAVRDEFQIFRWDGVNR--GFAGHNQ

AAK58418.1      ADRAMLVFDPVRSKKRYSPASTFKIPHTLFALDAGAVRDEFQIFRWDGVNR--GFAGHNQ

AAP43641.1      ADHAILVFDQARSMKRYSPASTFKIPHTLFALDAGAVRDEFQIFRWDGVKR--SFAGHNK

AAK52604.1      NA-EIAQFNKAKCATQMPPDSTFKIALSLMAFDAEIIDQ-KTIFKWDKTPK--GMEIWNS

CAD58780.1      GQ---ELYRKGACDKAFAPMSTFKVPLAVMGYDAGILVD-AHNPRWDYKPEFNGYKFQQK

AAB58555.1      GD---LLHREGSCDKAFAPMSTFKLPLAIMGYDADILLD-ATTPRWDYKPEFNGYKSQQK

                            . .   * ****:  :::. ::  : :     :**   .  .    :

 

ABY79006.1      DLTLRGAIQVSAVPVFQQIAREVGEVRMQKYLKKFSYGNQNISGGI------DKFWLEDQ

CAA80304.1      DLTLRGAIQVSAVPVFQQIAREVGEVRMQKYLKKFSYGSQNISGGI------DKFWLEDQ

ACN85419.1      DLSLRGAIQVSAVPVFQQIAREVGEVRMQKYLKKFSYGNQNISGGI------DKFWE-GQ

AAD02245.1      DLSLRGAIQVSAVPVFQQIAREVGEVRMQKYLKKFSYGNQNISGGI------DKFWLEDQ

ACO72579.1      DLSLRGAIQVSAVPVFQQIAREVGEVRMQKYLKKFSYGNQNISGGI------DKFLLEGQ

AAK49460.1      DLSLRGAIQVSAVPVFQQIAREVGEVRMQKYLKKFSYGNQNISGGI------DKFWLEGQ

AAF72942.1      DLSLRGAIQVSAVPVFQQIAREVGEVRMQKYLKKFSYGNQNISGGI------DKFGLEGQ

ACT09125.1      DQDLRSAMRNSTVWVYELFAKEIGDDKARRYLKKIDYGDADPSTSN------GDYWIEGS

AAB05874.1      DQDLRSAMRNSTVWVYELFAKEIGDDKARRYLKKIDYGNAGPSTSN------GDYWIEGS

ACM67635.1      DQDLRSAMRNSTVWVYELFAKEIGDDKARRYLKKIDYGNADPSTSN------GDYRIEGS

ABQ15112.1      DQDLRSAMRNSTVWVYELFAKEIGDDKARRYLKKIDYGNADPSTSN------GDYWIESS

AAK58418.1      DQDLRSAMRNSTVWVYELFAKEIGDDKARRYLKKIDYGNADPSTSN------GDYWIEGS

AAP43641.1      DQDLRSAMRNSTVWVYELFAKEIGDGKARRYLKQIGYGNADPSTSH------GDYWIEGS

AAK52604.1      NHTPKTWMQFSVVWVSQEITQKIGLNKIKNYLKDFDYGNQDFSGDKERNNGLTEAWLESS

CAD58780.1      TTDPTIWEKDSIVWYSQQLTRKMGQKRFAAYVAGFGYGNGDISGEPGKSNGLTHSWLGSS

AAB58555.1      PTDPTIWLKDSIVWYSQELTRRLGESRFSDYVQRFDYGNKDVSGDPGKHNGLTHAWLASS

                        : * *   : :::.:*  :   *:  :.**. . *          .    ..

 

ABY79006.1      LRISAVNQVEFLESLYLNKLSASKENQLIVKEALVTE-AAPEYLVHSKTGFSGVG--TES

CAA80304.1      LRISAVNQVEFLESLYLNKLSASKENQLIVKEALVTE-AAPEYLVHSKTGFSGVG--TES

ACN85419.1      LRISAVNQVEFLESLFLNKLSASKENQLIVKEALVTE-AAPEYLVHSKTGFSGVG--TES

AAD02245.1      LRISAVNQVEFLESLFLNKLSASKENQLIVKEALVTE-AAPEYLVHSKTGFSGVG--TES

ACO72579.1      LRISAVNQVEFLESLFLNKLSASKENQLIVKEALVTE-AAPEYLVHSKTGFSGVG--TES

AAK49460.1      LRISAVNQVEFLESLFLNKLSASKENQLIVKEALVTE-AAPEYLVHSKTGFSGVG--TES

AAF72942.1      LRISAVNQVEFLESLFLNKLSASKENQLIVKEALVTE-AAPEYLVHSKTGFSGVG--TES

ACT09125.1      LAISAQEQIAFLRKLYRNELPFRVEHQRLVKDLMIVE-AGRNWILRAKTGWEG-------

AAB05874.1      LAISAQEQIAFLRKLYRNELPFRVEHQRLVKDLMIVE-AGRNWILRAKTGWEG-------

ACM67635.1      LAISAQEQIAFLRKLYRNELPFRVEHQRLVKDLMIVE-AGRNWILRAKTGWEG-------

ABQ15112.1      LAISAQEQIAFLRKLYRNELPFRVEHQRLVKDLMIVE-AGRNWILRAKTGWEG-------

AAK58418.1      IAISAQEQIAFLRKLYRNELPFRVEHQRLVKDLMIVE-AGRNWILRAKTGWEG-------

AAP43641.1      LAISAQEQIAFLRKLYQNDLPFRVEHQRLVKDLMIVE-AGRNWILRAKTGWEG-------

AAK52604.1      LKISPEEQIQFLRKIINHNLPVKNSAIENTIENMYLQDLENSTKLYGKTGAGFTA---NR

CAD58780.1      LKISPEGQVRFVRDLLSAKLPASKDAQQMTVSILPHF-AAGDWAVQGKTGTGSFIDARGA

AAB58555.1      LKISPEEQVRFLRRFLRGELPVSEDALEMTKAVVPHF-EAGDWDVQGKTGTGSLSDAKGG

                : **   *: *:. :   .*    .    .   :       .  : .***         

 

ABY79006.1      NPGVAWWVGWVEKETE-VYFFAFNMDIDNESKLPLRK-SIPTKIMESEGIIGG-------

CAA80304.1      NPGVAWWVGWVEKETE-VYFFAFNMDIDNESKLPLRK-SIPTKIMESEGIIGG-------

ACN85419.1      NPGVAWWVGWVEKGTE-VYFFAFNMDIDNENKLPLRK-SIPTKIMASEGIIGG-------

AAD02245.1      NPGVAWWVGWVEKGTE-VYFFAFNMDIDNENKLPLRK-SIPTKIMASEGIIGG-------

ACO72579.1      NPGVAWWVGWVEKGTE-VYFFAFNMDIDNENKLPLRK-SIPTKIMASEGIIGG-------

AAK49460.1      NPGVAWWVGWVEKGTE-VYFFAFNMDIDNENKLPLRK-SIPTKIMASEGIIGG-------

AAF72942.1      NPGVAWWVGWVEKGTE-VYFFAFNMDIDNENKLPLRK-SIPTKIMASEGIIGG-------

ACT09125.1      --RMGWWVGWVEWPTG-SVFFALNIDTPNRMDDLFKREAIVRAILRSIEALPPNPAVNSD

AAB05874.1      --RMGWWVGWVEWPTG-SVFFALNIDTPNRMDDLFKREAIVRAILRSIEALPPNPAVNSD

ACM67635.1      --RMGWWVGWVEWPTG-SVFFALNIDTPNRMDDLFKREAIVRAILRSIEALPPNPAVNSD

ABQ15112.1      --RMGWWVGWVEWPTG-SVFFALNIDTPNRMDDLFKREAIVRAILRSIEALPPNPAVNSD

AAK58418.1      --RMGWWVGWVEWPTG-SVFFALNIDTPNRMDDLFKREAIVRAILRSIEALPPNPAVNSD

AAP43641.1      --SMGWWVGWVEWPTG-PVFFALNIDTPNRMDDLFKREAIARAILLSIEALPPNPAVHSD

AAK52604.1      TLQNGWFEGFIISKSGHKYVFVSA-LTGNLGSNL------TSSIKAKKNAITILNTLNL-

CAD58780.1      KAPLGWFIGWATHEER-RVVFARM-TAGGKKGEQ------PAGPAARDAFLKALPDLAKR

AAB58555.1      KAPIGWFIGWATRDDR-RVVFARL-TVGARKGEQ------PAGPAARDEFLNTLPALSEN

                    .*: *:         .*.                            :        

 

ABY79006.1      ---

CAA80304.1      ---

ACN85419.1      ---

AAD02245.1      ---

ACO72579.1      ---

AAK49460.1      ---

AAF72942.1      ---

ACT09125.1      AAR

AAB05874.1      AAR

ACM67635.1      AAR

ABQ15112.1      AAR

AAK58418.1      AAR

AAP43641.1      AAR

AAK52604.1      ---

CAD58780.1      F--

AAB58555.1      F--