#

#

#  Percent Identity  Matrix - created by Clustal2.1

#

#

 

     1: ABF47919.1  100.00   99.29   99.29   99.64   60.15   59.41   59.78   59.78   53.51   52.19   52.92   52.92   48.53   48.53   52.75   53.11   52.75   45.96   47.06   47.06   46.69   47.43   47.06   46.69   47.06   46.69   47.06   47.08   47.45   47.08   47.45   47.08   47.08   47.45   47.45   50.36   50.00   50.00   49.27   49.64   29.32   29.70   33.59   32.85   33.33   33.33   33.33   31.82   32.58   32.58   32.58   32.20   32.58   46.30   49.45   49.08   49.82   49.82   49.45   48.34   48.71   48.71   48.71   48.34   48.71   48.71   49.08   49.08   49.08   49.08   50.18   48.71   49.82   49.45   49.82   49.45   49.82   49.82   49.08   49.08   49.45   48.71   49.08   49.08   49.08   49.08   49.45   49.82   49.45   49.45   49.08   49.82   49.45   49.82   49.82   49.45   49.82   49.45   49.45   49.08   49.45   49.08   49.08   49.08   49.08   49.45   48.71   48.71   49.08   49.45   49.08   49.45   49.45   49.45   49.04   48.71   48.71   49.45   48.71   48.71   49.08

     2: ABO33299.1   99.29  100.00   99.29   99.64   60.52   59.78   60.15   60.15   53.87   52.55   53.28   53.28   48.90   48.90   53.11   53.48   53.11   46.32   47.43   47.43   47.06   47.79   47.43   47.06   47.43   47.06   47.43   47.45   47.81   47.45   47.81   47.45   47.45   47.81   47.81   50.73   50.36   50.36   49.64   50.00   29.70   30.08   33.97   33.21   33.33   33.71   33.71   32.20   32.95   32.95   32.95   32.58   32.95   46.67   49.82   49.45   50.18   50.18   49.82   48.71   49.08   49.08   49.08   48.71   49.08   49.08   49.45   49.45   49.45   49.45   50.55   49.08   50.18   49.82   50.18   49.82   50.18   50.18   49.45   49.45   49.82   49.08   49.45   49.45   49.45   49.45   49.82   50.18   49.82   49.82   49.45   50.18   49.82   50.18   50.18   49.82   50.18   49.82   49.82   49.45   49.82   49.45   49.45   49.45   49.45   49.82   49.08   49.08   49.45   49.82   49.45   49.82   49.82   49.82   49.43   49.08   49.08   49.82   49.08   49.08   49.45

     3: ADK34116.1   99.29   99.29  100.00   99.64   60.15   59.41   59.78   59.78   53.51   52.19   52.92   52.92   48.53   48.53   52.75   53.11   52.75   45.96   47.06   47.06   46.69   47.43   47.06   46.69   47.06   46.69   47.06   47.45   47.81   47.45   47.81   47.45   47.45   47.81   47.81   50.73   50.36   50.36   49.64   50.00   29.70   30.08   33.97   33.21   33.71   33.71   33.71   32.20   32.95   32.95   32.95   32.58   32.95   46.30   49.45   49.08   49.82   49.82   49.45   48.34   48.71   48.71   48.71   48.34   48.71   48.71   49.08   49.08   49.08   49.08   50.18   48.71   49.82   49.45   49.82   49.45   49.82   49.82   49.08   49.08   49.45   48.71   49.08   49.08   49.08   49.08   49.45   49.82   49.45   49.45   49.08   49.82   49.45   49.82   49.82   49.45   49.82   49.45   49.45   49.08   49.45   49.08   49.08   49.08   49.08   49.45   48.71   48.71   49.08   49.45   49.08   49.45   49.45   49.45   49.04   48.71   48.71   49.45   48.71   48.71   49.08

     4: AAW57529.1   99.64   99.64   99.64  100.00   60.52   59.78   60.15   60.15   53.87   52.55   53.28   53.28   48.90   48.90   53.11   53.48   53.11   46.32   47.43   47.43   47.06   47.79   47.43   47.06   47.43   47.06   47.43   47.45   47.81   47.45   47.81   47.45   47.45   47.81   47.81   50.73   50.36   50.36   49.64   50.00   29.70   30.08   33.97   33.21   33.71   33.71   33.71   32.20   32.95   32.95   32.95   32.58   32.95   46.67   49.82   49.45   50.18   50.18   49.82   48.71   49.08   49.08   49.08   48.71   49.08   49.08   49.45   49.45   49.45   49.45   50.55   49.08   50.18   49.82   50.18   49.82   50.18   50.18   49.45   49.45   49.82   49.08   49.45   49.45   49.45   49.45   49.82   50.18   49.82   49.82   49.45   50.18   49.82   50.18   50.18   49.82   50.18   49.82   49.82   49.45   49.82   49.45   49.45   49.45   49.45   49.82   49.08   49.08   49.45   49.82   49.45   49.82   49.82   49.82   49.43   49.08   49.08   49.82   49.08   49.08   49.45

     5: AGK07370.1   60.15   60.52   60.15   60.52  100.00   97.83   97.83   97.83   59.11   58.46   58.82   59.19   55.97   55.97   57.84   57.46   57.46   54.89   56.39   56.02   55.64   56.77   56.39   56.02   56.39   56.02   56.39   54.85   55.60   54.85   55.22   54.85   54.85   55.22   55.22   54.85   55.22   55.22   54.48   54.85   27.76   27.76   32.95   33.09   32.82   33.20   33.20   31.66   32.43   32.43   32.43   32.05   32.43   59.02   57.30   56.93   57.68   57.68   57.30   57.30   57.68   57.68   57.30   57.30   57.68   57.68   58.05   58.05   58.05   58.05   58.05   57.30   57.68   57.68   57.68   57.30   57.68   58.05   57.30   57.30   57.68   56.93   57.30   57.30   56.55   56.93   57.68   57.68   57.30   57.68   57.68   58.05   57.68   57.68   58.05   58.05   58.05   57.68   57.68   56.93   57.68   57.30   57.30   57.30   57.30   57.68   56.93   57.68   57.30   57.30   57.30   57.68   57.30   57.68   58.59   57.30   57.30   57.68   57.30   57.30   57.68

     6: AFM55000.1   59.41   59.78   59.41   59.78   97.83  100.00   97.83   98.55   59.48   58.82   59.19   59.56   55.60   55.60   58.21   57.84   57.84   55.64   57.14   56.77   56.39   57.52   57.14   56.77   57.14   56.77   57.14   55.22   55.97   55.22   55.60   55.22   55.22   55.60   55.60   55.22   55.60   55.60   54.85   55.22   27.76   27.76   32.56   32.72   32.43   32.82   32.82   31.27   32.05   32.05   32.05   31.66   32.05   59.40   56.93   56.55   57.30   57.30   56.93   56.93   57.30   57.30   56.93   56.93   57.30   57.30   57.68   57.68   57.68   57.68   57.68   56.93   57.30   57.30   57.30   56.93   57.30   57.68   56.93   56.93   57.30   56.55   56.93   56.93   56.18   56.55   57.30   57.30   56.93   57.30   57.30   57.68   57.30   57.30   57.68   57.68   57.68   57.30   57.30   56.55   57.30   56.93   56.93   56.93   56.93   57.30   56.55   57.30   56.93   56.93   56.93   57.30   56.93   57.30   58.20   56.93   56.93   57.30   56.93   56.93   57.30

     7: AFM55002.1   59.78   60.15   59.78   60.15   97.83   97.83  100.00   98.55   59.85   59.19   59.56   59.93   55.97   55.97   58.21   57.84   57.84   55.26   56.77   56.39   56.02   57.14   56.77   56.39   56.77   56.39   56.77   54.85   55.60   54.85   55.22   54.85   54.85   55.22   55.22   54.85   55.22   55.22   54.48   54.85   28.14   28.14   32.95   33.09   32.43   32.82   32.82   31.27   32.05   32.05   32.05   31.66   32.05   59.02   57.30   56.93   57.68   57.68   57.30   57.30   57.68   57.68   57.30   57.30   57.68   57.68   58.05   58.05   58.05   58.05   58.05   57.30   57.68   57.68   57.68   57.30   57.68   58.05   57.30   57.30   57.68   56.93   57.30   57.30   56.55   56.93   57.68   57.68   57.30   57.68   57.68   58.05   57.68   57.68   58.05   58.05   58.05   57.68   57.68   56.93   57.68   57.30   57.30   57.30   57.30   57.68   56.93   57.68   57.30   57.30   57.30   57.68   57.30   57.68   58.59   57.30   57.30   57.68   57.30   57.30   57.68

     8: AFM55001.1   59.78   60.15   59.78   60.15   97.83   98.55   98.55  100.00   59.48   58.82   59.19   59.56   55.97   55.97   57.84   57.46   57.46   55.26   56.77   56.39   56.02   57.14   56.77   56.39   56.77   56.39   56.77   54.48   55.22   54.48   54.85   54.48   54.48   54.85   54.85   54.48   54.85   54.85   54.10   54.85   27.76   27.76   32.56   33.09   32.05   32.43   32.43   30.89   31.66   31.66   31.66   31.27   31.66   59.02   57.30   56.93   57.68   57.68   57.30   57.30   57.68   57.68   57.30   57.30   57.68   57.68   58.05   58.05   58.05   58.05   58.05   57.30   57.68   57.68   57.68   57.30   57.68   58.05   57.30   57.30   57.68   56.93   57.30   57.30   56.55   56.93   57.68   57.68   57.30   57.68   57.68   58.05   57.68   57.68   58.05   58.05   58.05   57.68   57.68   56.93   57.68   57.30   57.30   57.30   57.30   57.68   56.93   57.68   57.30   57.30   57.30   57.68   57.30   57.68   58.59   57.30   57.30   57.68   57.30   57.30   57.68

     9: ADM47435.1   53.51   53.87   53.51   53.87   59.11   59.48   59.85   59.48  100.00   87.91   86.08   86.08   54.89   54.89   59.18   60.67   61.05   59.02   60.15   60.15   59.02   60.53   59.77   59.77   60.15   59.77   60.15   56.72   57.46   56.72   57.09   56.72   56.72   57.09   57.09   57.09   57.46   57.84   57.46   58.21   28.08   28.46   33.46   33.21   32.56   33.33   33.33   31.78   32.56   32.56   32.56   32.17   32.56   61.36   59.62   59.25   60.00   60.00   59.62   58.49   58.87   58.87   58.49   58.49   58.49   58.87   58.87   59.25   59.25   59.25   60.38   59.25   59.25   59.25   59.25   59.25   59.62   60.00   59.25   59.25   59.62   59.25   59.62   59.62   59.62   59.62   59.62   60.00   59.62   59.25   59.25   60.38   59.62   60.00   60.00   60.00   60.00   60.00   60.00   59.25   60.00   59.62   59.62   59.62   59.62   60.00   59.25   59.25   59.62   59.25   59.25   59.62   59.25   59.62   60.00   58.87   59.25   59.62   59.25   59.25   59.62

    10: AGI65307.1   52.19   52.55   52.19   52.55   58.46   58.82   59.19   58.82   87.91  100.00   92.39   92.39   53.53   53.53   57.78   58.52   59.26   56.88   57.99   57.99   56.88   58.36   57.62   57.62   57.99   57.62   57.99   57.56   58.30   57.56   57.93   57.56   57.56   57.93   57.93   57.56   57.93   58.30   58.30   59.04   29.28   29.66   33.46   36.53   34.10   34.48   34.48   32.95   33.72   33.72   33.72   33.33   33.72   58.43   57.09   56.72   57.46   57.46   57.09   55.97   56.34   56.34   55.97   55.97   55.97   56.34   56.34   56.72   56.72   56.72   57.46   56.72   56.72   56.72   56.72   56.72   57.09   57.46   56.72   56.72   57.09   56.72   57.09   57.09   57.09   57.09   56.72   57.46   57.09   57.09   56.72   57.84   57.09   57.46   57.46   57.46   57.46   57.46   57.46   56.72   57.46   57.09   57.09   57.09   57.09   57.46   56.72   56.72   56.72   56.34   56.34   56.72   56.72   57.09   56.98   56.34   56.34   56.72   56.34   56.34   56.72

    11: AFH36331.1   52.92   53.28   52.92   53.28   58.82   59.19   59.56   59.19   86.08   92.39  100.00   99.64   55.39   55.39   58.15   58.89   59.26   56.13   57.25   57.25   56.13   57.62   56.88   56.88   57.25   56.88   57.25   56.83   57.56   56.83   57.20   56.83   56.83   57.20   57.20   56.83   57.20   57.56   57.56   58.30   29.66   29.66   33.46   36.53   33.72   34.10   34.10   32.57   33.33   33.33   33.33   32.95   33.33   58.05   56.72   56.34   56.72   56.72   56.34   55.22   55.60   55.60   55.22   55.22   55.22   55.60   55.60   55.97   55.97   55.97   57.09   56.34   56.34   56.34   56.34   56.34   56.72   56.72   55.97   55.97   56.34   55.97   56.72   56.34   56.34   56.34   55.97   56.72   56.34   56.34   55.97   57.09   56.34   56.72   56.72   56.72   56.72   56.72   56.72   55.97   56.72   56.34   56.34   56.34   56.34   56.72   55.97   55.97   55.97   55.60   55.60   55.97   55.97   56.34   56.59   55.60   55.60   55.97   55.60   55.60   55.97

    12: AFH36330.1   52.92   53.28   52.92   53.28   59.19   59.56   59.93   59.56   86.08   92.39   99.64  100.00   55.02   55.02   58.15   58.89   59.26   55.76   56.88   56.88   55.76   57.25   56.51   56.51   56.88   56.51   56.88   56.46   57.20   56.46   56.83   56.46   56.46   56.83   56.83   56.46   56.83   57.20   57.20   57.93   30.04   30.04   33.46   36.90   34.10   34.48   34.48   32.95   33.72   33.72   33.72   33.33   33.72   57.68   56.34   55.97   56.34   56.34   55.97   54.85   55.22   55.22   54.85   54.85   54.85   55.22   55.22   55.60   55.60   55.60   56.72   55.97   55.97   55.97   55.97   55.97   56.34   56.34   55.60   55.60   55.97   55.60   56.34   55.97   55.97   55.97   55.60   56.34   55.97   55.97   55.60   56.72   55.97   56.34   56.34   56.34   56.34   56.34   56.34   55.60   56.34   55.97   55.97   55.97   55.97   56.34   55.60   55.60   55.60   55.22   55.22   55.60   55.60   55.97   56.20   55.22   55.22   55.60   55.22   55.22   55.60

    13: AEV91554.1   48.53   48.90   48.53   48.90   55.97   55.60   55.97   55.97   54.89   53.53   55.39   55.02  100.00   99.64   52.94   52.21   52.57   52.40   52.77   52.40   52.03   52.40   52.77   52.40   52.77   52.40   52.03   54.58   54.95   54.21   54.58   54.21   54.21   54.58   54.58   54.95   55.31   56.04   54.58   54.95   28.20   28.20   31.78   32.12   31.42   31.42   31.42   31.42   31.42   31.80   31.80   31.80   31.80   56.88   55.56   55.56   55.93   55.93   56.30   55.56   55.93   55.93   55.56   55.56   55.56   55.93   55.93   55.93   55.56   55.56   56.67   56.30   57.04   56.67   56.67   56.67   57.04   56.67   56.67   56.67   57.04   55.19   55.56   55.56   55.56   55.56   55.93   56.30   55.93   56.30   55.93   56.30   55.56   55.93   55.93   55.93   55.56   55.93   55.93   55.56   55.93   55.56   55.56   55.56   55.56   55.93   55.19   55.56   55.56   54.81   54.81   55.19   55.56   55.19   55.81   55.56   55.19   55.56   55.19   55.19   55.56

    14: AEV91553.1   48.53   48.90   48.53   48.90   55.97   55.60   55.97   55.97   54.89   53.53   55.39   55.02   99.64  100.00   52.94   52.21   52.57   52.40   52.77   52.40   52.03   52.40   52.77   52.40   52.77   52.40   52.03   54.58   54.95   54.21   54.58   54.21   54.21   54.58   54.58   54.95   55.31   56.04   54.58   54.95   28.57   28.57   31.78   32.12   31.42   31.42   31.42   31.42   31.42   31.80   31.80   31.80   31.80   56.51   55.56   55.56   55.93   55.93   56.30   55.56   55.93   55.93   55.56   55.56   55.56   55.93   55.93   55.93   55.56   55.56   56.67   56.30   57.04   56.67   56.67   56.67   57.04   56.67   56.67   56.67   57.04   55.19   55.56   55.56   55.56   55.56   55.93   56.30   55.93   56.30   55.93   56.30   55.56   55.93   55.93   55.93   55.56   55.93   55.93   55.56   55.93   55.56   55.56   55.56   55.56   55.93   55.19   55.56   55.56   54.81   54.81   55.19   55.56   55.19   55.81   55.19   55.19   55.56   55.19   55.19   55.56

    15: AEV91551.1   52.75   53.11   52.75   53.11   57.84   58.21   58.21   57.84   59.18   57.78   58.15   58.15   52.94   52.94  100.00   95.26   95.62   55.51   55.88   55.88   54.78   55.88   55.88   55.51   55.88   55.51   55.88   55.11   55.84   55.11   55.11   55.11   55.11   55.47   55.47   57.30   57.66   57.66   57.66   58.39   30.08   30.45   35.77   36.26   35.36   34.60   34.60   33.84   34.22   34.60   34.60   34.22   34.60   57.46   58.36   57.99   58.36   58.36   57.99   57.25   57.62   57.62   57.25   57.25   57.62   57.62   57.62   56.88   57.62   57.99   59.11   58.36   58.74   58.74   59.11   58.74   59.11   58.74   57.99   57.99   58.36   57.25   57.99   57.62   57.25   57.25   57.99   57.99   57.62   57.62   57.99   58.36   57.62   57.62   57.99   57.99   57.99   57.99   57.99   57.25   57.99   57.62   57.62   57.62   57.62   57.99   57.62   57.99   58.36   57.62   57.62   57.99   57.25   57.25   58.08   57.25   57.62   57.99   57.62   57.62   57.99

    16: CCW28916.1   53.11   53.48   53.11   53.48   57.46   57.84   57.84   57.46   60.67   58.52   58.89   58.89   52.21   52.21   95.26  100.00   96.72   55.15   56.25   56.25   55.15   56.25   56.25   55.88   56.25   55.88   56.25   55.84   56.57   55.84   55.84   55.84   55.84   56.20   56.20   57.66   58.03   58.03   58.03   58.76   30.83   30.83   35.77   35.53   35.74   34.98   34.98   33.46   33.84   34.22   34.22   33.84   34.22   57.46   58.36   57.99   58.36   58.36   57.99   57.25   57.62   57.62   57.25   57.25   57.62   57.62   57.62   56.88   57.62   57.99   59.11   58.36   58.74   58.74   59.11   58.74   59.11   58.74   57.99   57.99   58.36   57.25   57.99   57.62   57.25   57.25   57.99   57.99   57.62   57.62   57.99   58.36   57.62   57.62   57.99   57.99   57.99   57.99   57.99   57.25   57.99   57.62   57.62   57.62   57.62   57.99   57.62   57.99   58.36   57.62   57.62   57.99   57.25   57.25   58.08   57.25   57.62   57.99   57.62   57.62   57.99

    17: AEV91550.1   52.75   53.11   52.75   53.11   57.46   57.84   57.84   57.46   61.05   59.26   59.26   59.26   52.57   52.57   95.62   96.72  100.00   55.51   56.62   56.62   55.51   56.62   56.62   56.25   56.62   56.25   56.62   56.20   56.93   56.20   56.20   56.20   56.20   56.57   56.57   57.66   58.03   58.03   58.03   58.76   29.70   30.08   35.38   35.90   35.74   34.98   34.98   33.46   33.84   34.22   34.22   33.84   34.22   58.21   59.11   58.74   59.11   59.11   58.74   57.99   58.36   58.36   57.99   57.99   58.36   58.36   58.36   57.62   58.36   58.74   59.85   59.48   59.48   59.48   59.85   59.48   59.85   59.48   58.74   58.74   59.11   57.99   58.74   58.36   57.99   57.99   58.74   58.74   58.36   58.36   58.74   59.11   58.36   58.36   58.74   58.74   58.74   58.74   58.74   57.99   58.74   58.36   58.36   58.36   58.36   58.74   58.36   58.74   59.11   58.36   58.36   58.74   57.99   57.99   58.85   57.99   58.36   58.74   58.36   58.36   58.74

    18: ACE63186.1   45.96   46.32   45.96   46.32   54.89   55.64   55.26   55.26   59.02   56.88   56.13   55.76   52.40   52.40   55.51   55.15   55.51  100.00   97.44   97.80   96.34   97.07   97.07   97.07   97.44   97.07   96.70   57.88   58.97   58.24   58.61   58.24   58.61   58.61   58.61   59.34   59.71   60.07   58.97   58.97   28.84   29.21   33.08   33.09   36.40   36.78   36.78   36.02   36.78   36.78   36.78   36.40   36.78   56.13   56.30   55.93   56.67   56.67   56.30   55.56   55.93   55.93   55.56   55.56   55.93   55.93   55.56   56.30   55.93   55.93   56.30   55.93   55.93   56.30   56.30   55.93   56.30   56.30   56.30   56.30   56.67   55.56   55.93   55.93   56.30   56.30   56.30   55.93   55.56   55.56   55.93   56.67   55.93   56.67   56.30   56.30   55.93   56.30   56.30   55.93   56.30   55.93   55.93   55.93   55.93   56.30   54.81   55.56   55.56   55.19   54.81   55.19   55.56   55.56   56.15   55.19   55.19   55.56   55.19   55.19   55.56

    19: ACI28281.1   47.06   47.43   47.06   47.43   56.39   57.14   56.77   56.77   60.15   57.99   57.25   56.88   52.77   52.77   55.88   56.25   56.62   97.44  100.00   99.64   98.90   99.63   99.63   99.63  100.00   99.63   99.27   58.97   60.07   59.34   59.71   59.34   59.71   59.71   59.71   60.44   60.81   60.81   60.44   60.44   29.21   29.59   33.46   33.46   36.40   36.78   36.78   35.25   36.02   36.02   36.02   35.63   36.02   57.62   57.41   57.04   57.78   57.78   57.41   56.67   57.04   57.04   56.67   56.67   57.04   57.04   56.67   57.41   57.04   57.04   57.41   57.04   57.04   57.41   57.41   57.04   57.41   57.41   57.41   57.41   57.78   56.67   57.04   57.04   57.41   57.41   57.41   57.04   56.67   56.67   57.04   57.78   57.04   57.78   57.41   57.41   57.04   57.41   57.41   56.67   57.41   57.04   57.04   57.04   57.04   57.41   55.93   56.67   56.67   56.30   55.93   56.30   56.67   56.67   57.31   56.30   56.30   56.67   56.30   56.30   56.67

    20: AAP40270.1   47.06   47.43   47.06   47.43   56.02   56.77   56.39   56.39   60.15   57.99   57.25   56.88   52.40   52.40   55.88   56.25   56.62   97.80   99.64  100.00   98.53   99.27   99.27   99.27   99.63   99.27   98.90   58.61   59.71   58.97   59.34   58.97   59.34   59.34   59.34   60.07   60.44   60.44   60.07   60.07   29.21   29.59   33.08   33.46   36.40   36.78   36.78   35.25   36.02   36.02   36.02   35.63   36.02   57.25   57.04   56.67   57.41   57.41   57.04   56.30   56.67   56.67   56.30   56.30   56.67   56.67   56.30   57.04   56.67   56.67   57.04   56.67   56.67   57.04   57.04   56.67   57.04   57.04   57.04   57.04   57.41   56.30   56.67   56.67   57.04   57.04   57.04   56.67   56.30   56.30   56.67   57.41   56.67   57.41   57.04   57.04   56.67   57.04   57.04   56.30   57.04   56.67   56.67   56.67   56.67   57.04   55.56   56.30   56.30   55.93   55.56   55.93   56.30   56.30   56.92   55.93   55.93   56.30   55.93   55.93   56.30

    21: AFN65709.1   46.69   47.06   46.69   47.06   55.64   56.39   56.02   56.02   59.02   56.88   56.13   55.76   52.03   52.03   54.78   55.15   55.51   96.34   98.90   98.53  100.00   98.53   98.53   99.27   98.90   98.53   98.17   58.61   59.34   58.97   59.34   59.71   59.34   59.34   59.34   59.71   59.71   59.71   59.34   59.34   28.46   28.84   33.08   33.09   36.02   36.40   36.40   34.87   35.63   35.63   35.63   35.25   35.63   57.25   57.04   56.67   57.41   57.41   57.04   56.30   56.67   56.67   56.30   56.30   56.67   56.67   56.30   57.04   56.67   56.67   57.04   56.67   56.67   57.04   57.04   56.67   57.04   57.04   57.04   57.04   57.41   56.30   56.67   56.67   57.04   57.04   57.04   56.67   56.30   56.30   56.67   57.41   56.67   57.41   57.04   57.04   56.67   57.04   57.04   56.30   57.04   56.67   56.67   56.67   56.67   57.04   55.56   56.30   56.30   55.93   55.56   55.93   56.30   56.30   56.92   55.93   55.93   56.30   55.93   55.93   56.30

    22: ADK35869.1   47.43   47.79   47.43   47.79   56.77   57.52   57.14   57.14   60.53   58.36   57.62   57.25   52.40   52.40   55.88   56.25   56.62   97.07   99.63   99.27   98.53  100.00   99.27   99.27   99.63   99.27   98.90   59.34   60.44   59.71   60.07   59.71   60.07   60.07   60.07   60.81   61.17   61.17   60.81   60.81   29.21   29.59   33.46   33.46   36.02   36.40   36.40   34.87   35.63   35.63   35.63   35.25   35.63   57.99   57.78   57.41   58.15   58.15   57.78   57.04   57.41   57.41   57.04   57.04   57.41   57.41   57.04   57.78   57.41   57.41   57.78   57.41   57.41   57.78   57.78   57.41   57.78   57.78   57.78   57.78   58.15   57.04   57.41   57.41   57.78   57.78   57.78   57.41   57.04   57.04   57.41   58.15   57.41   58.15   57.78   57.78   57.41   57.78   57.78   57.04   57.78   57.41   57.41   57.41   57.41   57.78   56.30   57.04   57.04   56.67   56.30   56.67   57.04   57.04   57.69   56.67   56.67   57.04   56.67   56.67   57.04

    23: ADK35875.1   47.06   47.43   47.06   47.43   56.39   57.14   56.77   56.77   59.77   57.62   56.88   56.51   52.77   52.77   55.88   56.25   56.62   97.07   99.63   99.27   98.53   99.27  100.00   99.27   99.63   99.27   98.90   58.61   59.71   58.97   59.34   58.97   59.34   59.34   59.34   60.07   60.44   60.44   60.07   60.07   29.21   29.59   33.46   33.46   36.40   36.78   36.78   35.25   36.02   36.02   36.02   35.63   36.02   57.25   57.41   57.04   57.78   57.78   57.41   56.67   57.04   57.04   56.67   56.67   57.04   57.04   56.67   57.41   57.04   57.04   57.41   57.04   57.04   57.41   57.41   57.04   57.41   57.41   57.41   57.41   57.78   56.67   57.04   57.04   57.41   57.41   57.41   57.04   56.67   56.67   57.04   57.78   57.04   57.78   57.41   57.41   57.04   57.41   57.41   56.67   57.41   57.04   57.04   57.04   57.04   57.41   55.93   56.67   56.67   56.30   55.93   56.30   56.67   56.67   57.31   56.30   56.30   56.67   56.30   56.30   56.67

    24: AEP43731.1   46.69   47.06   46.69   47.06   56.02   56.77   56.39   56.39   59.77   57.62   56.88   56.51   52.40   52.40   55.51   55.88   56.25   97.07   99.63   99.27   99.27   99.27   99.27  100.00   99.63   99.27   98.90   58.61   59.71   58.97   59.34   59.71   59.34   59.34   59.34   60.07   60.44   60.44   60.07   60.07   28.84   29.21   33.08   33.09   36.02   36.40   36.40   34.87   35.63   35.63   35.63   35.25   35.63   57.25   57.04   56.67   57.41   57.41   57.04   56.30   56.67   56.67   56.30   56.30   56.67   56.67   56.30   57.04   56.67   56.67   57.04   56.67   56.67   57.04   57.04   56.67   57.04   57.04   57.04   57.04   57.41   56.30   56.67   56.67   57.04   57.04   57.04   56.67   56.30   56.30   56.67   57.41   56.67   57.41   57.04   57.04   56.67   57.04   57.04   56.30   57.04   56.67   56.67   56.67   56.67   57.04   55.56   56.30   56.30   55.93   55.56   55.93   56.30   56.30   56.92   55.93   55.93   56.30   55.93   55.93   56.30

    25: CAB69042.1   47.06   47.43   47.06   47.43   56.39   57.14   56.77   56.77   60.15   57.99   57.25   56.88   52.77   52.77   55.88   56.25   56.62   97.44  100.00   99.63   98.90   99.63   99.63   99.63  100.00   99.63   99.27   58.97   60.07   59.34   59.71   59.34   59.71   59.71   59.71   60.44   60.81   60.81   60.44   60.44   29.21   29.59   33.46   33.46   36.40   36.78   36.78   35.25   36.02   36.02   36.02   35.63   36.02   57.62   57.41   57.04   57.78   57.78   57.41   56.67   57.04   57.04   56.67   56.67   57.04   57.04   56.67   57.41   57.04   57.04   57.41   57.04   57.04   57.41   57.41   57.04   57.41   57.41   57.41   57.41   57.78   56.67   57.04   57.04   57.41   57.41   57.41   57.04   56.67   56.67   57.04   57.78   57.04   57.78   57.41   57.41   57.04   57.41   57.41   56.67   57.41   57.04   57.04   57.04   57.04   57.41   55.93   56.67   56.67   56.30   55.93   56.30   56.67   56.67   57.31   56.30   56.30   56.67   56.30   56.30   56.67

    26: AAW22056.1   46.69   47.06   46.69   47.06   56.02   56.77   56.39   56.39   59.77   57.62   56.88   56.51   52.40   52.40   55.51   55.88   56.25   97.07   99.63   99.27   98.53   99.27   99.27   99.27   99.63  100.00   99.63   58.61   59.71   58.97   59.34   58.97   59.34   59.34   59.34   60.07   60.44   60.44   60.07   60.07   28.84   29.21   33.08   33.09   36.02   36.40   36.40   34.87   35.63   35.63   35.63   35.25   35.63   57.25   57.04   56.67   57.41   57.41   57.04   56.30   56.67   56.67   56.30   56.30   56.67   56.67   56.30   57.04   56.67   56.67   57.04   56.67   56.67   57.04   57.04   56.67   57.04   57.04   57.04   57.04   57.41   56.30   56.67   56.67   57.04   57.04   57.04   56.67   56.30   56.30   56.67   57.41   56.67   57.41   57.04   57.04   56.67   57.04   57.04   56.30   57.04   56.67   56.67   56.67   56.67   57.04   55.56   56.30   56.30   55.93   55.56   55.93   56.30   56.30   56.92   55.93   55.93   56.30   55.93   55.93   56.30

    27: AAG35609.2   47.06   47.43   47.06   47.43   56.39   57.14   56.77   56.77   60.15   57.99   57.25   56.88   52.03   52.03   55.88   56.25   56.62   96.70   99.27   98.90   98.17   98.90   98.90   98.90   99.27   99.63  100.00   58.97   60.07   59.34   59.71   59.34   59.71   59.71   59.71   60.44   60.81   60.81   60.44   60.44   28.84   29.21   33.08   33.09   36.02   36.40   36.40   34.87   35.63   35.63   35.63   35.25   35.63   57.62   57.41   57.04   57.78   57.78   57.41   56.67   57.04   57.04   56.67   56.67   57.04   57.04   56.67   57.41   57.04   57.04   57.41   57.04   57.04   57.41   57.41   57.04   57.41   57.41   56.67   56.67   57.04   56.67   57.04   57.04   57.41   57.41   57.41   57.04   56.67   56.67   57.04   57.78   57.04   57.78   57.41   57.41   57.04   57.41   57.41   56.67   57.41   57.04   57.04   57.04   57.04   57.41   55.93   56.67   56.67   56.30   55.93   56.30   56.67   56.67   57.31   56.30   56.30   56.67   56.30   56.30   56.67

    28: AAG35607.1   47.08   47.45   47.45   47.45   54.85   55.22   54.85   54.48   56.72   57.56   56.83   56.46   54.58   54.58   55.11   55.84   56.20   57.88   58.97   58.61   58.61   59.34   58.61   58.61   58.97   58.61   58.97  100.00   98.91   98.91   98.91   98.91   98.91   99.27   99.27   86.91   86.91   88.36   86.55   89.09   26.22   26.22   35.00   31.39   33.08   33.08   33.08   32.32   32.70   32.70   33.08   32.32   32.70   63.20   62.96   62.96   62.59   62.96   62.59   61.48   61.85   61.85   61.48   61.48   61.48   61.85   61.48   61.11   61.48   61.48   62.22   61.48   61.85   61.85   61.48   61.48   61.85   62.22   61.48   61.48   61.85   61.85   62.22   62.22   61.85   62.22   62.22   62.96   62.59   62.22   61.85   62.96   62.22   62.59   62.59   62.59   62.59   62.59   62.59   61.85   62.59   62.22   62.22   62.22   62.22   62.59   60.74   61.48   61.11   61.85   61.48   61.85   61.48   61.85   61.54   61.11   61.11   61.48   61.11   61.11   61.48

    29: ABP87779.2   47.45   47.81   47.81   47.81   55.60   55.97   55.60   55.22   57.46   58.30   57.56   57.20   54.95   54.95   55.84   56.57   56.93   58.97   60.07   59.71   59.34   60.44   59.71   59.71   60.07   59.71   60.07   98.91  100.00   99.27   99.27   99.27   99.27   99.64   99.64   87.64   88.00   89.45   87.64   90.18   26.59   26.59   35.38   31.75   33.46   33.46   33.46   32.70   33.08   33.08   33.08   32.70   33.08   63.57   63.70   63.70   63.33   63.70   63.33   62.22   62.59   62.59   62.22   62.22   62.22   62.59   62.22   62.22   62.22   62.22   62.96   62.22   62.59   62.59   62.22   62.22   62.59   62.96   62.22   62.22   62.59   62.59   62.96   62.96   62.59   62.96   62.96   63.70   63.33   62.96   62.59   63.70   62.96   63.33   63.33   63.33   63.33   63.33   63.33   62.59   63.33   62.96   62.96   62.96   62.96   63.33   61.11   62.22   61.85   62.59   62.22   62.59   62.22   62.59   62.31   61.85   61.85   62.22   61.85   61.85   62.22

    30: CAQ51348.1   47.08   47.45   47.45   47.45   54.85   55.22   54.85   54.48   56.72   57.56   56.83   56.46   54.21   54.21   55.11   55.84   56.20   58.24   59.34   58.97   58.97   59.71   58.97   58.97   59.34   58.97   59.34   98.91   99.27  100.00   99.27   99.27   99.27   99.64   99.64   87.27   87.27   88.73   86.91   89.45   25.84   25.84   35.38   31.75   33.08   33.08   33.08   32.32   32.70   32.70   33.08   32.32   32.70   62.83   62.96   62.96   62.59   62.96   62.59   61.48   61.85   61.85   61.48   61.48   61.48   61.85   61.48   61.48   61.48   61.48   62.22   61.48   61.85   61.85   61.48   61.48   61.85   62.22   61.48   61.48   61.85   61.85   62.22   62.22   61.85   62.22   62.22   62.96   62.59   62.22   61.85   62.96   62.22   62.59   62.59   62.59   62.59   62.59   62.59   61.85   62.59   62.22   62.22   62.22   62.22   62.59   60.37   61.48   61.11   61.85   61.48   61.85   61.48   61.85   61.54   61.11   61.11   61.48   61.11   61.11   61.48

    31: AAG35608.1   47.45   47.81   47.81   47.81   55.22   55.60   55.22   54.85   57.09   57.93   57.20   56.83   54.58   54.58   55.11   55.84   56.20   58.61   59.71   59.34   59.34   60.07   59.34   59.34   59.71   59.34   59.71   98.91   99.27   99.27  100.00   99.27   99.27   99.64   99.64   87.64   87.64   88.73   86.91   89.45   26.22   26.22   35.38   31.75   33.46   33.46   33.46   32.70   33.08   33.08   33.46   32.70   33.08   63.20   63.33   63.33   62.96   63.33   62.96   61.85   62.22   62.22   61.85   61.85   61.85   62.22   61.85   61.85   61.85   61.85   62.59   61.85   62.22   62.22   61.85   61.85   62.22   62.59   61.85   61.85   62.22   62.22   62.59   62.59   62.22   62.59   62.59   63.33   62.96   62.59   62.22   63.33   62.59   62.96   62.96   62.96   62.96   62.96   62.96   62.22   62.96   62.59   62.59   62.59   62.59   62.96   60.37   61.85   61.48   62.22   61.85   62.22   61.85   62.22   61.92   61.48   61.48   61.85   61.48   61.48   61.85

    32: ADB28891.1   47.08   47.45   47.45   47.45   54.85   55.22   54.85   54.48   56.72   57.56   56.83   56.46   54.21   54.21   55.11   55.84   56.20   58.24   59.34   58.97   59.71   59.71   58.97   59.71   59.34   58.97   59.34   98.91   99.27   99.27   99.27  100.00   99.27   99.64   99.64   87.27   87.27   88.73   86.91   89.45   25.84   25.84   35.00   31.39   33.08   33.08   33.08   32.32   32.70   32.70   33.08   32.32   32.70   62.83   62.96   62.96   62.59   62.96   62.59   61.48   61.85   61.85   61.48   61.48   61.48   61.85   61.48   61.48   61.48   61.48   62.22   61.48   61.85   61.85   61.48   61.48   61.85   62.22   61.48   61.48   61.85   61.85   62.22   62.22   61.85   62.22   62.22   62.96   62.59   62.22   61.85   62.96   62.22   62.59   62.59   62.59   62.59   62.59   62.59   61.85   62.59   62.22   62.22   62.22   62.22   62.59   60.37   61.48   61.11   61.85   61.48   61.85   61.48   61.85   61.54   61.11   61.11   61.48   61.11   61.11   61.48

    33: AFK28473.1   47.08   47.45   47.45   47.45   54.85   55.22   54.85   54.48   56.72   57.56   56.83   56.46   54.21   54.21   55.11   55.84   56.20   58.61   59.71   59.34   59.34   60.07   59.34   59.34   59.71   59.34   59.71   98.91   99.27   99.27   99.27   99.27  100.00   99.64   99.64   87.27   87.27   88.73   86.91   89.45   26.22   26.22   35.00   31.39   33.46   33.46   33.46   32.70   33.08   33.08   33.46   32.70   33.08   62.83   62.96   62.96   62.59   62.96   62.59   61.48   61.85   61.85   61.48   61.48   61.48   61.85   61.48   61.48   61.48   61.48   62.22   61.48   61.85   61.85   61.48   61.48   61.85   62.22   61.48   61.48   61.85   61.85   62.22   62.22   61.85   62.22   62.22   62.96   62.59   62.22   61.85   62.96   62.22   62.59   62.59   62.59   62.59   62.59   62.59   61.85   62.59   62.22   62.22   62.22   62.22   62.59   60.37   61.48   61.11   61.85   61.48   61.85   61.48   61.85   61.54   61.11   61.11   61.48   61.11   61.11   61.48

    34: CAB92323.2   47.45   47.81   47.81   47.81   55.22   55.60   55.22   54.85   57.09   57.93   57.20   56.83   54.58   54.58   55.47   56.20   56.57   58.61   59.71   59.34   59.34   60.07   59.34   59.34   59.71   59.34   59.71   99.27   99.64   99.64   99.64   99.64   99.64  100.00  100.00   87.64   87.64   89.09   87.27   89.82   26.22   26.22   35.38   31.75   33.46   33.46   33.46   32.70   33.08   33.08   33.46   32.70   33.08   63.20   63.33   63.33   62.96   63.33   62.96   61.85   62.22   62.22   61.85   61.85   61.85   62.22   61.85   61.85   61.85   61.85   62.59   61.85   62.22   62.22   61.85   61.85   62.22   62.59   61.85   61.85   62.22   62.22   62.59   62.59   62.22   62.59   62.59   63.33   62.96   62.59   62.22   63.33   62.59   62.96   62.96   62.96   62.96   62.96   62.96   62.22   62.96   62.59   62.59   62.59   62.59   62.96   60.74   61.85   61.48   62.22   61.85   62.22   61.85   62.22   61.92   61.48   61.48   61.85   61.48   61.48   61.85

    35: AAM34291.1   47.45   47.81   47.81   47.81   55.22   55.60   55.22   54.85   57.09   57.93   57.20   56.83   54.58   54.58   55.47   56.20   56.57   58.61   59.71   59.34   59.34   60.07   59.34   59.34   59.71   59.34   59.71   99.27   99.64   99.64   99.64   99.64   99.64  100.00  100.00   87.64   87.64   89.09   87.27   89.82   26.22   26.22   35.38   31.75   33.46   33.46   33.46   32.70   33.08   33.08   33.46   32.70   33.08   63.20   63.33   63.33   62.96   63.33   62.96   61.85   62.22   62.22   61.85   61.85   61.85   62.22   61.85   61.85   61.85   61.85   62.59   61.85   62.22   62.22   61.85   61.85   62.22   62.59   61.85   61.85   62.22   62.22   62.59   62.59   62.22   62.59   62.59   63.33   62.96   62.59   62.22   63.33   62.59   62.96   62.96   62.96   62.96   62.96   62.96   62.22   62.96   62.59   62.59   62.59   62.59   62.96   60.74   61.85   61.48   62.22   61.85   62.22   61.85   62.22   61.92   61.48   61.48   61.85   61.48   61.48   61.85

    36: AFG29918.1   50.36   50.73   50.73   50.73   54.85   55.22   54.85   54.48   57.09   57.56   56.83   56.46   54.95   54.95   57.30   57.66   57.66   59.34   60.44   60.07   59.71   60.81   60.07   60.07   60.44   60.07   60.44   86.91   87.64   87.27   87.64   87.27   87.27   87.64   87.64  100.00   99.64   92.73   92.00   93.45   25.84   25.84   35.00   32.85   32.32   32.32   32.32   31.56   31.94   31.94   31.94   31.56   31.94   65.06   63.70   63.70   63.70   64.07   63.70   62.59   62.96   62.96   62.59   62.59   62.59   62.96   62.59   62.59   62.59   62.59   63.33   62.59   62.96   62.96   62.59   62.59   62.96   63.33   62.59   62.59   62.96   62.96   63.33   63.33   62.96   63.33   63.33   63.70   63.33   63.33   62.96   64.07   63.33   63.70   63.70   63.70   63.70   63.70   63.70   62.96   63.70   63.33   63.33   63.33   63.33   63.70   60.74   62.59   62.22   62.96   62.59   62.96   62.59   62.96   62.69   62.22   62.22   62.59   62.22   62.22   62.59

    37: ACX70402.1   50.00   50.36   50.36   50.36   55.22   55.60   55.22   54.85   57.46   57.93   57.20   56.83   55.31   55.31   57.66   58.03   58.03   59.71   60.81   60.44   59.71   61.17   60.44   60.44   60.81   60.44   60.81   86.91   88.00   87.27   87.64   87.27   87.27   87.64   87.64   99.64  100.00   93.09   92.36   93.82   26.22   26.22   35.00   32.85   32.32   32.32   32.32   31.56   31.94   31.94   31.94   31.56   31.94   65.43   64.07   64.07   64.07   64.44   64.07   62.96   63.33   63.33   62.96   62.96   62.96   63.33   62.96   62.96   62.96   62.96   63.70   62.96   63.33   63.33   62.96   62.96   63.33   63.70   62.96   62.96   63.33   63.33   63.70   63.70   63.33   63.70   63.70   64.07   63.70   63.70   63.33   64.44   63.70   64.07   64.07   64.07   64.07   64.07   64.07   63.33   64.07   63.70   63.70   63.70   63.70   64.07   61.11   62.96   62.59   63.33   62.96   63.33   62.96   63.33   63.08   62.59   62.59   62.96   62.59   62.59   62.96

    38: ADK92148.1   50.00   50.36   50.36   50.36   55.22   55.60   55.22   54.85   57.84   58.30   57.56   57.20   56.04   56.04   57.66   58.03   58.03   60.07   60.81   60.44   59.71   61.17   60.44   60.44   60.81   60.44   60.81   88.36   89.45   88.73   88.73   88.73   88.73   89.09   89.09   92.73   93.09  100.00   92.00   93.82   27.34   27.34   35.00   31.75   32.70   32.70   32.70   31.94   32.32   32.32   32.32   32.32   32.32   64.31   63.70   63.70   63.70   64.07   63.70   62.59   62.96   62.96   62.59   62.59   62.59   62.96   62.59   62.96   62.96   62.96   63.33   62.59   62.96   62.96   62.59   62.59   62.96   63.33   62.59   62.59   62.96   62.96   63.33   63.33   62.96   63.33   63.33   63.70   63.33   63.33   62.96   64.07   63.33   63.70   63.70   63.70   63.70   63.70   63.70   63.33   64.07   63.33   63.33   63.33   63.33   63.70   61.48   62.59   62.22   62.96   62.59   62.96   62.59   62.96   62.69   62.22   62.22   62.59   62.22   62.22   62.59

    39: AGK07369.1   49.27   49.64   49.64   49.64   54.48   54.85   54.48   54.10   57.46   58.30   57.56   57.20   54.58   54.58   57.66   58.03   58.03   58.97   60.44   60.07   59.34   60.81   60.07   60.07   60.44   60.07   60.44   86.55   87.64   86.91   86.91   86.91   86.91   87.27   87.27   92.00   92.36   92.00  100.00   95.27   25.47   25.47   33.46   32.48   32.32   32.70   32.70   32.32   32.32   32.32   32.32   31.94   32.32   65.43   64.44   64.44   64.44   64.81   64.44   63.33   63.70   63.70   63.33   63.33   63.33   63.70   63.33   63.33   63.33   63.33   64.07   63.33   63.70   63.70   63.33   63.33   63.70   64.07   63.33   63.33   63.70   63.70   64.07   64.07   63.70   64.07   64.07   64.44   64.07   64.07   63.70   64.81   64.07   64.44   64.44   64.44   64.44   64.44   64.44   63.70   64.44   64.07   64.07   64.07   64.07   64.44   62.22   63.33   62.96   63.70   63.33   63.70   63.33   63.70   63.46   62.96   62.96   63.33   62.96   62.96   63.33

    40: AGK07368.1   49.64   50.00   50.00   50.00   54.85   55.22   54.85   54.85   58.21   59.04   58.30   57.93   54.95   54.95   58.39   58.76   58.76   58.97   60.44   60.07   59.34   60.81   60.07   60.07   60.44   60.07   60.44   89.09   90.18   89.45   89.45   89.45   89.45   89.82   89.82   93.45   93.82   93.82   95.27  100.00   26.59   26.59   35.38   32.48   33.08   33.08   33.08   32.32   32.70   32.70   32.70   32.32   32.70   66.17   64.81   64.81   64.81   65.19   64.81   63.70   64.07   64.07   63.70   63.70   63.70   64.07   63.70   63.70   63.70   63.70   64.44   63.70   64.07   64.07   63.70   63.70   64.07   64.81   63.70   63.70   64.07   64.07   64.44   64.44   64.07   64.44   64.44   64.81   64.44   64.44   64.07   65.19   64.44   64.81   64.81   64.81   64.81   64.81   64.81   64.07   64.81   64.44   64.44   64.44   64.44   64.81   62.59   63.70   63.33   64.07   63.70   64.07   63.70   64.07   63.85   63.33   63.33   63.70   63.33   63.33   63.70

    41: ALA99185.1   29.32   29.70   29.70   29.70   27.76   27.76   28.14   27.76   28.08   29.28   29.66   30.04   28.20   28.57   30.08   30.83   29.70   28.84   29.21   29.21   28.46   29.21   29.21   28.84   29.21   28.84   28.84   26.22   26.59   25.84   26.22   25.84   26.22   26.22   26.22   25.84   26.22   27.34   25.47   26.59  100.00   98.25   36.96   39.35   38.22   37.45   37.45   36.68   37.45   37.45   37.45   37.45   37.45   26.52   29.43   29.43   29.81   29.81   30.19   29.43   30.19   29.81   29.43   30.19   29.81   29.81   29.43   29.43   29.43   29.06   29.43   29.06   29.43   29.43   29.06   29.81   29.43   29.81   29.43   30.19   29.81   30.19   30.19   30.57   30.57   30.57   30.19   30.19   30.57   29.81   29.81   30.19   29.81   30.19   30.19   30.19   30.19   30.57   30.19   29.81   30.19   29.81   29.81   29.81   29.81   30.19   29.43   29.81   29.43   29.43   29.43   29.81   30.19   30.19   29.92   30.19   29.81   29.81   29.81   30.19   29.81

    42: AAR32134.1   29.70   30.08   30.08   30.08   27.76   27.76   28.14   27.76   28.46   29.66   29.66   30.04   28.20   28.57   30.45   30.83   30.08   29.21   29.59   29.59   28.84   29.59   29.59   29.21   29.59   29.21   29.21   26.22   26.59   25.84   26.22   25.84   26.22   26.22   26.22   25.84   26.22   27.34   25.47   26.59   98.25  100.00   36.58   38.99   37.84   36.68   36.68   35.91   36.68   36.68   36.68   36.68   36.68   26.52   29.43   29.43   29.81   29.81   30.19   29.43   30.19   29.81   29.43   30.19   29.81   29.81   29.43   29.43   29.43   29.06   29.43   29.06   29.43   29.43   29.06   29.81   29.43   29.81   29.43   30.19   29.81   30.19   30.19   30.57   30.57   30.57   30.19   30.19   30.57   29.81   29.81   30.19   29.81   30.19   30.19   30.19   30.19   30.57   30.19   29.81   30.19   29.81   29.81   29.81   29.81   30.19   29.43   29.81   29.43   29.43   29.43   29.81   30.19   30.19   29.92   30.19   29.81   29.81   29.81   30.19   29.81

    43: AID67109.1   33.59   33.97   33.97   33.97   32.95   32.56   32.95   32.56   33.46   33.46   33.46   33.46   31.78   31.78   35.77   35.77   35.38   33.08   33.46   33.08   33.08   33.46   33.46   33.08   33.46   33.08   33.08   35.00   35.38   35.38   35.38   35.00   35.00   35.38   35.38   35.00   35.00   35.00   33.46   35.38   36.96   36.58  100.00   39.31   45.98   45.59   45.59   44.83   45.59   45.21   45.59   45.59   45.59   32.05   33.46   33.46   33.46   33.46   33.85   33.46   33.85   33.85   33.46   33.46   33.85   33.85   33.08   33.46   33.08   33.08   33.85   34.23   33.85   34.23   33.46   33.46   33.85   33.85   33.46   33.46   33.85   33.85   34.23   34.23   34.23   34.23   34.62   34.23   33.85   34.23   34.23   34.62   33.85   34.23   34.23   34.62   34.62   34.62   34.62   34.23   34.62   34.23   34.23   34.23   34.23   34.62   33.08   33.46   33.46   33.46   33.85   33.85   33.46   33.46   32.68   33.46   33.08   33.08   33.46   33.46   33.46

    44: AAR03105.1   32.85   33.21   33.21   33.21   33.09   32.72   33.09   33.09   33.21   36.53   36.53   36.90   32.12   32.12   36.26   35.53   35.90   33.09   33.46   33.46   33.09   33.46   33.46   33.09   33.46   33.09   33.09   31.39   31.75   31.75   31.75   31.39   31.39   31.75   31.75   32.85   32.85   31.75   32.48   32.48   39.35   38.99   39.31  100.00   55.47   54.72   54.34   53.96   54.34   54.34   53.96   54.34   54.34   31.00   34.19   34.19   34.19   34.19   33.46   32.72   33.09   33.09   32.72   32.72   33.09   33.09   33.09   33.46   33.09   33.09   33.46   33.09   33.09   33.09   33.09   32.72   33.09   33.46   33.09   33.09   33.46   33.09   33.46   33.46   33.09   33.09   33.46   33.82   33.46   33.09   33.09   34.19   33.46   33.46   33.82   33.82   33.46   33.82   33.82   33.46   33.82   33.46   33.46   33.46   33.46   33.82   32.72   33.82   33.09   33.09   32.72   33.09   33.09   33.46   32.69   33.09   32.72   33.09   33.09   33.09   33.09

    45: AAR89917.1   33.33   33.33   33.71   33.71   32.82   32.43   32.43   32.05   32.56   34.10   33.72   34.10   31.42   31.42   35.36   35.74   35.74   36.40   36.40   36.40   36.02   36.02   36.40   36.02   36.40   36.02   36.02   33.08   33.46   33.08   33.46   33.08   33.46   33.46   33.46   32.32   32.32   32.70   32.32   33.08   38.22   37.84   45.98   55.47  100.00   93.21   92.83   91.32   91.70   92.08   92.08   92.08   92.45   32.56   33.98   33.98   33.98   33.98   33.98   33.20   33.59   33.59   33.20   33.20   33.59   33.59   33.59   33.98   33.59   33.59   34.36   34.36   34.36   34.36   33.98   33.98   34.36   34.36   34.36   33.98   34.36   33.20   33.59   33.59   33.20   33.59   33.98   33.98   33.59   33.98   33.98   34.36   33.59   33.98   33.98   33.98   33.59   33.98   33.98   33.59   33.98   33.59   33.59   33.59   33.59   33.98   33.59   33.98   33.59   33.59   33.59   33.59   33.20   33.20   33.20   33.59   33.20   33.59   33.59   33.59   33.59

    46: AEP16366.1   33.33   33.71   33.71   33.71   33.20   32.82   32.82   32.43   33.33   34.48   34.10   34.48   31.42   31.42   34.60   34.98   34.98   36.78   36.78   36.78   36.40   36.40   36.78   36.40   36.78   36.40   36.40   33.08   33.46   33.08   33.46   33.08   33.46   33.46   33.46   32.32   32.32   32.70   32.70   33.08   37.45   36.68   45.59   54.72   93.21  100.00   99.62   97.36   97.74   98.11   98.11   98.11   98.49   32.95   34.75   34.75   34.75   34.75   34.75   33.98   34.36   34.36   33.98   33.98   34.36   34.36   34.36   34.75   34.36   34.36   35.14   35.14   35.14   35.14   34.75   34.75   35.14   35.14   35.14   34.75   35.14   33.98   34.36   34.36   33.98   34.36   34.75   34.75   34.36   34.75   34.75   35.14   34.36   34.75   34.75   34.75   34.36   34.75   34.75   34.36   34.75   34.36   34.36   34.36   34.36   34.75   34.36   34.75   34.36   34.36   34.36   34.36   33.98   33.98   33.99   34.36   33.98   34.36   34.36   34.36   34.36

    47: AGD91915.1   33.33   33.71   33.71   33.71   33.20   32.82   32.82   32.43   33.33   34.48   34.10   34.48   31.42   31.42   34.60   34.98   34.98   36.78   36.78   36.78   36.40   36.40   36.78   36.40   36.78   36.40   36.40   33.08   33.46   33.08   33.46   33.08   33.46   33.46   33.46   32.32   32.32   32.70   32.70   33.08   37.45   36.68   45.59   54.34   92.83   99.62  100.00   96.98   97.36   97.74   98.11   97.74   98.11   32.95   34.75   34.75   34.75   34.75   34.75   33.98   34.36   34.36   33.98   33.98   34.36   34.36   34.36   34.75   34.36   34.36   35.14   35.14   35.14   35.14   34.75   34.75   35.14   35.14   35.14   34.75   35.14   33.98   34.36   34.36   33.98   34.36   34.75   34.75   34.36   34.75   34.75   35.14   34.36   34.75   34.75   34.75   34.36   34.75   34.75   34.36   34.75   34.36   34.36   34.36   34.36   34.75   34.36   34.75   34.36   34.36   34.36   34.36   33.98   33.98   33.99   34.36   33.98   34.36   34.36   34.36   34.36

    48: AFC95894.1   31.82   32.20   32.20   32.20   31.66   31.27   31.27   30.89   31.78   32.95   32.57   32.95   31.42   31.42   33.84   33.46   33.46   36.02   35.25   35.25   34.87   34.87   35.25   34.87   35.25   34.87   34.87   32.32   32.70   32.32   32.70   32.32   32.70   32.70   32.70   31.56   31.56   31.94   32.32   32.32   36.68   35.91   44.83   53.96   91.32   97.36   96.98  100.00   98.11   98.49   98.49   98.49   98.87   31.78   33.59   33.59   33.59   33.59   33.59   32.82   33.20   33.20   32.82   32.82   33.20   33.20   33.20   33.59   33.20   33.20   33.98   33.98   33.98   33.98   33.59   33.59   33.98   33.98   33.98   33.59   33.98   32.82   33.20   33.20   32.82   33.20   33.59   33.59   33.20   33.59   33.59   33.98   33.20   33.59   33.59   33.59   33.20   33.59   33.59   33.20   33.59   33.20   33.20   33.20   33.20   33.59   33.20   33.59   33.20   33.20   33.20   33.20   32.82   32.82   32.81   33.20   32.82   33.20   33.20   33.20   33.20

    49: AFU91598.1   32.58   32.95   32.95   32.95   32.43   32.05   32.05   31.66   32.56   33.72   33.33   33.72   31.42   31.42   34.22   33.84   33.84   36.78   36.02   36.02   35.63   35.63   36.02   35.63   36.02   35.63   35.63   32.70   33.08   32.70   33.08   32.70   33.08   33.08   33.08   31.94   31.94   32.32   32.32   32.70   37.45   36.68   45.59   54.34   91.70   97.74   97.36   98.11  100.00   98.87   98.87   98.87   99.25   32.17   33.98   33.98   33.98   33.98   33.98   33.59   33.98   33.98   33.59   33.59   33.98   33.98   33.59   33.98   33.59   33.59   34.36   34.36   34.36   34.36   33.98   33.98   34.36   34.36   34.36   33.98   34.36   33.59   33.98   33.98   33.59   33.98   34.36   34.36   33.98   33.98   33.98   34.75   33.98   34.36   34.36   34.36   33.98   34.36   34.36   33.98   34.36   33.98   33.98   33.98   33.98   34.36   33.59   33.98   33.59   33.59   33.59   33.59   33.59   33.59   33.20   33.59   33.20   33.59   33.59   33.59   33.59

    50: ADG27454.1   32.58   32.95   32.95   32.95   32.43   32.05   32.05   31.66   32.56   33.72   33.33   33.72   31.80   31.80   34.60   34.22   34.22   36.78   36.02   36.02   35.63   35.63   36.02   35.63   36.02   35.63   35.63   32.70   33.08   32.70   33.08   32.70   33.08   33.08   33.08   31.94   31.94   32.32   32.32   32.70   37.45   36.68   45.21   54.34   92.08   98.11   97.74   98.49   98.87  100.00   99.25   99.25   99.62   32.56   34.36   34.36   34.36   34.36   34.36   33.59   33.98   33.98   33.59   33.59   33.98   33.98   33.98   34.36   33.98   33.98   34.75   34.75   34.75   34.75   34.36   34.36   34.75   34.75   34.75   34.36   34.75   33.59   33.98   33.98   33.59   33.98   34.36   34.36   33.98   34.36   34.36   34.75   33.98   34.36   34.36   34.36   33.98   34.36   34.36   33.98   34.36   33.98   33.98   33.98   33.98   34.36   33.98   34.36   33.98   33.98   33.98   33.98   33.59   33.59   33.60   33.98   33.59   33.98   33.98   33.98   33.98

    51: AGC60012.1   32.58   32.95   32.95   32.95   32.43   32.05   32.05   31.66   32.56   33.72   33.33   33.72   31.80   31.80   34.60   34.22   34.22   36.78   36.02   36.02   35.63   35.63   36.02   35.63   36.02   35.63   35.63   33.08   33.08   33.08   33.46   33.08   33.46   33.46   33.46   31.94   31.94   32.32   32.32   32.70   37.45   36.68   45.59   53.96   92.08   98.11   98.11   98.49   98.87   99.25  100.00   99.25   99.62   32.56   34.36   34.36   34.36   34.36   34.36   33.59   33.98   33.98   33.59   33.59   33.98   33.98   33.98   34.36   33.98   33.98   34.75   34.75   34.75   34.75   34.36   34.36   34.75   34.75   34.75   34.36   34.75   33.59   33.98   33.98   33.59   33.98   34.36   34.36   33.98   34.36   34.36   34.75   33.98   34.36   34.36   34.36   33.98   34.36   34.36   33.98   34.36   33.98   33.98   33.98   33.98   34.36   33.98   34.36   33.98   33.98   33.98   33.98   33.59   33.59   33.60   33.98   33.59   33.98   33.98   33.98   33.98

    52: AGC60013.1   32.20   32.58   32.58   32.58   32.05   31.66   31.66   31.27   32.17   33.33   32.95   33.33   31.80   31.80   34.22   33.84   33.84   36.40   35.63   35.63   35.25   35.25   35.63   35.25   35.63   35.25   35.25   32.32   32.70   32.32   32.70   32.32   32.70   32.70   32.70   31.56   31.56   32.32   31.94   32.32   37.45   36.68   45.59   54.34   92.08   98.11   97.74   98.49   98.87   99.25   99.25  100.00   99.62   32.17   34.36   34.36   34.36   34.36   34.36   33.59   33.98   33.98   33.59   33.59   33.98   33.98   33.98   34.36   33.98   33.98   34.75   34.75   34.75   34.75   34.36   34.36   34.75   34.75   34.75   34.36   34.75   33.59   33.98   33.98   33.59   33.98   34.36   34.36   33.98   34.36   34.36   34.75   33.98   34.36   34.36   34.36   33.98   34.36   34.36   33.98   34.36   33.98   33.98   33.98   33.98   34.36   33.98   34.36   33.98   33.98   33.98   33.98   33.59   33.59   33.60   33.98   33.59   33.98   33.98   33.98   33.98

    53: AAP70012.1   32.58   32.95   32.95   32.95   32.43   32.05   32.05   31.66   32.56   33.72   33.33   33.72   31.80   31.80   34.60   34.22   34.22   36.78   36.02   36.02   35.63   35.63   36.02   35.63   36.02   35.63   35.63   32.70   33.08   32.70   33.08   32.70   33.08   33.08   33.08   31.94   31.94   32.32   32.32   32.70   37.45   36.68   45.59   54.34   92.45   98.49   98.11   98.87   99.25   99.62   99.62   99.62  100.00   32.56   34.36   34.36   34.36   34.36   34.36   33.59   33.98   33.98   33.59   33.59   33.98   33.98   33.98   34.36   33.98   33.98   34.75   34.75   34.75   34.75   34.36   34.36   34.75   34.75   34.75   34.36   34.75   33.59   33.98   33.98   33.59   33.98   34.36   34.36   33.98   34.36   34.36   34.75   33.98   34.36   34.36   34.36   33.98   34.36   34.36   33.98   34.36   33.98   33.98   33.98   33.98   34.36   33.98   34.36   33.98   33.98   33.98   33.98   33.59   33.59   33.60   33.98   33.59   33.98   33.98   33.98   33.98

    54: AEV91552.1   46.30   46.67   46.30   46.67   59.02   59.40   59.02   59.02   61.36   58.43   58.05   57.68   56.88   56.51   57.46   57.46   58.21   56.13   57.62   57.25   57.25   57.99   57.25   57.25   57.62   57.25   57.62   63.20   63.57   62.83   63.20   62.83   62.83   63.20   63.20   65.06   65.43   64.31   65.43   66.17   26.52   26.52   32.05   31.00   32.56   32.95   32.95   31.78   32.17   32.56   32.56   32.17   32.56  100.00   77.66   77.29   78.39   78.39   78.39   77.29   77.66   77.66   77.66   77.66   77.66   78.02   78.75   78.39   79.12   79.12   78.02   77.66   77.66   77.66   77.66   77.66   78.02   78.75   78.02   78.02   78.39   77.66   77.66   78.02   78.39   78.02   77.66   78.02   77.66   78.02   78.39   77.66   77.66   78.39   78.39   78.39   78.02   78.02   78.02   77.66   78.75   78.02   78.02   78.02   78.02   78.39   76.56   78.02   77.29   77.66   77.66   78.02   77.29   77.66   77.39   78.02   77.66   78.02   77.66   77.66   78.02

    55: AAZ78361.1   49.45   49.82   49.45   49.82   57.30   56.93   57.30   57.30   59.62   57.09   56.72   56.34   55.56   55.56   58.36   58.36   59.11   56.30   57.41   57.04   57.04   57.78   57.41   57.04   57.41   57.04   57.41   62.96   63.70   62.96   63.33   62.96   62.96   63.33   63.33   63.70   64.07   63.70   64.44   64.81   29.43   29.43   33.46   34.19   33.98   34.75   34.75   33.59   33.98   34.36   34.36   34.36   34.36   77.66  100.00   99.64   98.91   99.27   97.08   95.26   95.62   95.62   95.62   95.62   95.62   95.99   96.35   95.99   96.72   96.35   97.45   97.08   97.08   97.08   97.45   97.45   97.81   97.45   96.72   97.08   97.45   95.99   96.72   96.35   95.62   95.99   95.99   96.72   96.35   97.08   97.45   95.99   96.72   97.08   97.45   97.08   96.35   96.35   96.35   95.99   96.72   96.35   96.35   96.35   96.35   96.72   94.53   97.08   95.99   95.62   95.62   95.99   96.35   96.72   96.18   95.62   95.99   96.72   95.99   95.99   96.35

    56: ABC84263.1   49.08   49.45   49.08   49.45   56.93   56.55   56.93   56.93   59.25   56.72   56.34   55.97   55.56   55.56   57.99   57.99   58.74   55.93   57.04   56.67   56.67   57.41   57.04   56.67   57.04   56.67   57.04   62.96   63.70   62.96   63.33   62.96   62.96   63.33   63.33   63.70   64.07   63.70   64.44   64.81   29.43   29.43   33.46   34.19   33.98   34.75   34.75   33.59   33.98   34.36   34.36   34.36   34.36   77.29   99.64  100.00   98.54   98.91   96.72   94.89   95.26   95.26   95.26   95.26   95.26   95.62   95.99   95.62   96.35   95.99   97.08   96.72   96.72   96.72   97.08   97.08   97.45   97.08   96.35   96.72   97.08   95.62   96.35   95.99   95.26   95.62   95.62   96.35   95.99   96.72   97.08   95.62   96.35   96.72   97.08   96.72   95.99   95.99   95.99   95.62   96.35   95.99   95.99   95.99   95.99   96.35   94.16   96.72   95.62   95.26   95.26   95.62   95.99   96.35   95.80   95.26   95.62   96.35   95.62   95.62   95.99

    57: CAJ77817.2   49.82   50.18   49.82   50.18   57.68   57.30   57.68   57.68   60.00   57.46   56.72   56.34   55.93   55.93   58.36   58.36   59.11   56.67   57.78   57.41   57.41   58.15   57.78   57.41   57.78   57.41   57.78   62.59   63.33   62.59   62.96   62.59   62.59   62.96   62.96   63.70   64.07   63.70   64.44   64.81   29.81   29.81   33.46   34.19   33.98   34.75   34.75   33.59   33.98   34.36   34.36   34.36   34.36   78.39   98.91   98.54  100.00   99.64   98.18   96.35   96.72   96.72   96.72   96.72   96.72   97.08   97.45   97.08   97.81   97.45   97.45   97.45   97.08   97.08   97.45   97.45   97.81   98.18   97.45   97.81   98.18   97.08   97.08   97.45   96.72   97.08   97.08   97.81   97.45   98.18   98.54   97.08   97.81   98.18   98.54   98.18   97.45   97.45   97.45   97.08   97.81   97.45   97.45   97.45   97.45   97.81   95.62   98.18   96.35   96.72   96.72   97.08   97.45   97.81   96.95   96.72   97.08   97.81   97.08   97.08   97.45

    58: ABF50983.1   49.82   50.18   49.82   50.18   57.68   57.30   57.68   57.68   60.00   57.46   56.72   56.34   55.93   55.93   58.36   58.36   59.11   56.67   57.78   57.41   57.41   58.15   57.78   57.41   57.78   57.41   57.78   62.96   63.70   62.96   63.33   62.96   62.96   63.33   63.33   64.07   64.44   64.07   64.81   65.19   29.81   29.81   33.46   34.19   33.98   34.75   34.75   33.59   33.98   34.36   34.36   34.36   34.36   78.39   99.27   98.91   99.64  100.00   97.81   95.99   96.35   96.35   96.35   96.35   96.35   96.72   97.08   96.72   97.45   97.08   97.45   97.08   97.08   97.08   97.45   97.45   97.81   98.18   97.45   97.81   98.18   96.72   96.72   97.08   96.35   96.72   96.72   97.45   97.08   97.81   98.18   96.72   97.45   97.81   98.18   97.81   97.08   97.08   97.08   96.72   97.45   97.08   97.08   97.08   97.08   97.45   95.26   97.81   95.99   96.35   96.35   96.72   97.08   97.45   96.56   96.35   96.72   97.45   96.72   96.72   97.08

    59: CCJ32595.1   49.45   49.82   49.45   49.82   57.30   56.93   57.30   57.30   59.62   57.09   56.34   55.97   56.30   56.30   57.99   57.99   58.74   56.30   57.41   57.04   57.04   57.78   57.41   57.04   57.41   57.04   57.41   62.59   63.33   62.59   62.96   62.59   62.59   62.96   62.96   63.70   64.07   63.70   64.44   64.81   30.19   30.19   33.85   33.46   33.98   34.75   34.75   33.59   33.98   34.36   34.36   34.36   34.36   78.39   97.08   96.72   98.18   97.81  100.00   98.18   98.54   98.54   98.54   98.54   98.54   98.91   98.54   97.08   97.81   97.45   97.08   97.81   97.08   97.45   97.08   97.08   97.45   97.81   97.08   97.45   97.81   97.81   97.81   98.18   97.45   97.81   97.45   97.45   97.08   97.81   98.18   97.81   97.45   97.81   98.18   98.54   98.18   98.18   98.18   97.81   98.54   98.18   98.18   98.18   98.18   98.54   95.99   97.81   96.72   97.08   97.08   97.45   97.08   97.45   97.33   97.08   97.45   97.45   97.45   97.45   97.81

    60: CCJ32598.1   48.34   48.71   48.34   48.71   57.30   56.93   57.30   57.30   58.49   55.97   55.22   54.85   55.56   55.56   57.25   57.25   57.99   55.56   56.67   56.30   56.30   57.04   56.67   56.30   56.67   56.30   56.67   61.48   62.22   61.48   61.85   61.48   61.48   61.85   61.85   62.59   62.96   62.59   63.33   63.70   29.43   29.43   33.46   32.72   33.20   33.98   33.98   32.82   33.59   33.59   33.59   33.59   33.59   77.29   95.26   94.89   96.35   95.99   98.18  100.00   98.91   98.91   98.91   98.91   98.91   99.27   97.45   95.99   96.72   96.35   95.99   96.72   95.99   96.35   95.99   95.99   96.35   96.72   95.99   96.35   96.72   97.81   97.08   97.45   96.72   97.08   96.72   96.72   96.35   96.72   97.08   97.81   98.18   97.08   97.45   97.81   97.45   97.45   97.81   97.45   97.81   97.81   97.81   97.81   98.18   97.81   95.62   96.72   96.35   96.72   96.72   97.08   97.08   97.45   96.95   96.72   97.08   97.08   97.08   97.08   97.45

    61: ABV31690.1   48.71   49.08   48.71   49.08   57.68   57.30   57.68   57.68   58.87   56.34   55.60   55.22   55.93   55.93   57.62   57.62   58.36   55.93   57.04   56.67   56.67   57.41   57.04   56.67   57.04   56.67   57.04   61.85   62.59   61.85   62.22   61.85   61.85   62.22   62.22   62.96   63.33   62.96   63.70   64.07   30.19   30.19   33.85   33.09   33.59   34.36   34.36   33.20   33.98   33.98   33.98   33.98   33.98   77.66   95.62   95.26   96.72   96.35   98.54   98.91  100.00   99.64   99.27   99.27   99.27   99.64   97.81   96.35   97.08   96.72   96.35   97.08   96.35   96.72   96.35   96.35   96.72   97.08   96.35   96.72   97.08   97.45   97.45   97.81   97.08   97.45   97.08   97.08   96.72   97.08   97.45   97.81   97.08   97.45   97.81   98.18   97.81   98.54   97.81   97.45   98.18   97.81   97.81   97.81   97.81   98.18   95.99   97.08   96.72   97.08   97.08   97.45   97.45   97.81   97.33   97.08   97.45   97.45   97.45   97.45   97.81

    62: CCJ32596.1   48.71   49.08   48.71   49.08   57.68   57.30   57.68   57.68   58.87   56.34   55.60   55.22   55.93   55.93   57.62   57.62   58.36   55.93   57.04   56.67   56.67   57.41   57.04   56.67   57.04   56.67   57.04   61.85   62.59   61.85   62.22   61.85   61.85   62.22   62.22   62.96   63.33   62.96   63.70   64.07   29.81   29.81   33.85   33.09   33.59   34.36   34.36   33.20   33.98   33.98   33.98   33.98   33.98   77.66   95.62   95.26   96.72   96.35   98.54   98.91   99.64  100.00   99.27   99.27   99.27   99.64   97.81   96.35   97.08   96.72   96.35   97.08   96.35   96.72   96.35   96.35   96.72   97.08   96.35   96.72   97.08   97.45   97.45   97.81   97.08   97.45   97.08   97.08   96.72   97.08   97.45   97.81   97.08   97.45   97.81   98.18   97.81   98.18   97.81   97.45   98.18   97.81   97.81   97.81   97.81   98.18   95.99   97.08   96.72   97.08   97.08   97.45   97.45   97.81   97.33   97.08   97.45   97.45   97.45   97.45   97.81

    63: ABC61637.1   48.71   49.08   48.71   49.08   57.30   56.93   57.30   57.30   58.49   55.97   55.22   54.85   55.56   55.56   57.25   57.25   57.99   55.56   56.67   56.30   56.30   57.04   56.67   56.30   56.67   56.30   56.67   61.48   62.22   61.48   61.85   61.48   61.48   61.85   61.85   62.59   62.96   62.59   63.33   63.70   29.43   29.43   33.46   32.72   33.20   33.98   33.98   32.82   33.59   33.59   33.59   33.59   33.59   77.66   95.62   95.26   96.72   96.35   98.54   98.91   99.27   99.27  100.00   99.27   99.27   99.64   97.81   96.35   97.08   96.72   96.35   97.08   96.35   96.72   96.35   96.35   96.72   97.08   96.35   96.72   97.08   97.45   97.45   97.81   97.08   97.45   97.08   97.08   96.72   97.08   97.45   97.45   97.08   97.45   97.81   98.18   97.81   97.81   97.81   97.45   98.18   97.81   97.81   97.81   97.81   98.18   95.99   97.08   96.72   97.08   97.08   97.45   97.45   97.81   97.33   97.08   97.45   97.45   97.45   97.45   97.81

    64: ABV31687.1   48.34   48.71   48.34   48.71   57.30   56.93   57.30   57.30   58.49   55.97   55.22   54.85   55.56   55.56   57.25   57.25   57.99   55.56   56.67   56.30   56.30   57.04   56.67   56.30   56.67   56.30   56.67   61.48   62.22   61.48   61.85   61.48   61.48   61.85   61.85   62.59   62.96   62.59   63.33   63.70   30.19   30.19   33.46   32.72   33.20   33.98   33.98   32.82   33.59   33.59   33.59   33.59   33.59   77.66   95.62   95.26   96.72   96.35   98.54   98.91   99.27   99.27   99.27  100.00   99.27   99.64   97.81   96.35   97.08   96.72   96.35   97.08   96.35   96.72   96.35   97.08   96.72   97.08   96.35   97.45   97.08   98.18   98.18   98.54   97.81   98.18   97.08   97.08   97.45   97.08   97.45   97.45   97.08   97.45   97.81   98.18   97.81   97.81   97.81   97.45   98.18   97.81   97.81   97.81   97.81   98.18   95.99   97.08   96.72   97.08   97.08   97.45   97.45   97.81   97.33   97.08   97.45   97.45   97.45   97.45   97.81

    65: ABV31692.1   48.71   49.08   48.71   49.08   57.68   57.30   57.68   57.68   58.49   55.97   55.22   54.85   55.56   55.56   57.62   57.62   58.36   55.93   57.04   56.67   56.67   57.41   57.04   56.67   57.04   56.67   57.04   61.48   62.22   61.48   61.85   61.48   61.48   61.85   61.85   62.59   62.96   62.59   63.33   63.70   29.81   29.81   33.85   33.09   33.59   34.36   34.36   33.20   33.98   33.98   33.98   33.98   33.98   77.66   95.62   95.26   96.72   96.35   98.54   98.91   99.27   99.27   99.27   99.27  100.00   99.64   97.81   96.35   97.08   96.72   96.35   97.08   96.35   96.72   96.35   96.35   96.72   97.08   96.35   96.72   97.08   97.45   97.45   97.81   97.08   97.45   97.08   97.08   96.72   97.08   97.45   97.45   97.08   97.45   97.81   98.18   97.81   97.81   97.81   97.45   98.18   97.81   97.81   97.81   97.81   98.18   95.99   97.08   96.72   97.08   97.08   97.45   97.45   97.81   97.33   97.08   97.45   97.45   97.45   97.45   97.81

    66: AAW81340.1   48.71   49.08   48.71   49.08   57.68   57.30   57.68   57.68   58.87   56.34   55.60   55.22   55.93   55.93   57.62   57.62   58.36   55.93   57.04   56.67   56.67   57.41   57.04   56.67   57.04   56.67   57.04   61.85   62.59   61.85   62.22   61.85   61.85   62.22   62.22   62.96   63.33   62.96   63.70   64.07   29.81   29.81   33.85   33.09   33.59   34.36   34.36   33.20   33.98   33.98   33.98   33.98   33.98   78.02   95.99   95.62   97.08   96.72   98.91   99.27   99.64   99.64   99.64   99.64   99.64  100.00   98.18   96.72   97.45   97.08   96.72   97.45   96.72   97.08   96.72   96.72   97.08   97.45   96.72   97.08   97.45   97.81   97.81   98.18   97.45   97.81   97.45   97.45   97.08   97.45   97.81   97.81   97.45   97.81   98.18   98.54   98.18   98.18   98.18   97.81   98.54   98.18   98.18   98.18   98.18   98.54   96.35   97.45   97.08   97.45   97.45   97.81   97.81   98.18   97.71   97.45   97.81   97.81   97.81   97.81   98.18

    67: CCA94644.1   49.08   49.45   49.08   49.45   58.05   57.68   58.05   58.05   58.87   56.34   55.60   55.22   55.93   55.93   57.62   57.62   58.36   55.56   56.67   56.30   56.30   57.04   56.67   56.30   56.67   56.30   56.67   61.48   62.22   61.48   61.85   61.48   61.48   61.85   61.85   62.59   62.96   62.59   63.33   63.70   29.43   29.43   33.08   33.09   33.59   34.36   34.36   33.20   33.59   33.98   33.98   33.98   33.98   78.75   96.35   95.99   97.45   97.08   98.54   97.45   97.81   97.81   97.81   97.81   97.81   98.18  100.00   98.54   99.27   98.91   97.08   97.08   97.08   96.72   97.08   97.08   97.45   97.81   97.08   97.45   97.81   97.08   97.08   97.45   96.72   97.08   96.72   97.45   97.08   97.81   98.18   97.08   97.45   97.81   98.18   97.81   97.45   97.45   97.45   97.08   97.81   97.45   97.45   97.45   97.45   97.81   95.99   97.81   96.72   97.08   97.08   97.45   97.81   98.18   97.33   97.08   97.45   98.18   97.45   97.45   97.81

    68: ACX31140.1   49.08   49.45   49.08   49.45   58.05   57.68   58.05   58.05   59.25   56.72   55.97   55.60   55.93   55.93   56.88   56.88   57.62   56.30   57.41   57.04   57.04   57.78   57.41   57.04   57.41   57.04   57.41   61.11   62.22   61.48   61.85   61.48   61.48   61.85   61.85   62.59   62.96   62.96   63.33   63.70   29.43   29.43   33.46   33.46   33.98   34.75   34.75   33.59   33.98   34.36   34.36   34.36   34.36   78.39   95.99   95.62   97.08   96.72   97.08   95.99   96.35   96.35   96.35   96.35   96.35   96.72   98.54  100.00   99.27   98.91   96.72   96.72   96.35   96.35   96.72   96.72   97.08   97.45   96.72   97.08   97.45   96.72   96.72   97.08   96.35   96.72   96.35   97.08   96.72   97.45   97.81   96.72   97.08   97.45   97.81   97.45   97.08   97.08   97.08   96.72   97.81   97.08   97.08   97.08   97.08   97.45   95.62   97.45   96.35   96.72   96.72   97.08   97.45   97.81   96.95   96.72   97.08   97.81   97.08   97.08   97.45

    69: ABV31686.1   49.08   49.45   49.08   49.45   58.05   57.68   58.05   58.05   59.25   56.72   55.97   55.60   55.56   55.56   57.62   57.62   58.36   55.93   57.04   56.67   56.67   57.41   57.04   56.67   57.04   56.67   57.04   61.48   62.22   61.48   61.85   61.48   61.48   61.85   61.85   62.59   62.96   62.96   63.33   63.70   29.43   29.43   33.08   33.09   33.59   34.36   34.36   33.20   33.59   33.98   33.98   33.98   33.98   79.12   96.72   96.35   97.81   97.45   97.81   96.72   97.08   97.08   97.08   97.08   97.08   97.45   99.27   99.27  100.00   99.64   97.45   97.45   97.08   97.08   97.45   97.45   97.81   98.18   97.45   97.81   98.18   97.45   97.45   97.81   97.08   97.45   97.08   97.81   97.45   98.18   98.54   97.45   97.81   98.18   98.54   98.18   97.81   97.81   97.81   97.45   98.54   97.81   97.81   97.81   97.81   98.18   96.35   98.18   97.08   97.45   97.45   97.81   98.18   98.54   97.71   97.45   97.81   98.54   97.81   97.81   98.18

    70: AAW81341.1   49.08   49.45   49.08   49.45   58.05   57.68   58.05   58.05   59.25   56.72   55.97   55.60   55.56   55.56   57.99   57.99   58.74   55.93   57.04   56.67   56.67   57.41   57.04   56.67   57.04   56.67   57.04   61.48   62.22   61.48   61.85   61.48   61.48   61.85   61.85   62.59   62.96   62.96   63.33   63.70   29.06   29.06   33.08   33.09   33.59   34.36   34.36   33.20   33.59   33.98   33.98   33.98   33.98   79.12   96.35   95.99   97.45   97.08   97.45   96.35   96.72   96.72   96.72   96.72   96.72   97.08   98.91   98.91   99.64  100.00   97.08   97.08   96.72   96.72   97.08   97.08   97.45   97.81   97.08   97.45   97.81   97.08   97.08   97.45   96.72   97.08   96.72   97.45   97.08   97.81   98.18   97.08   97.45   97.81   98.18   97.81   97.45   97.45   97.45   97.08   98.18   97.45   97.45   97.45   97.45   97.81   95.99   97.81   96.72   97.08   97.08   97.45   97.81   98.18   97.33   97.08   97.45   98.18   97.45   97.45   97.81

    71: ABV31691.1   50.18   50.55   50.18   50.55   58.05   57.68   58.05   58.05   60.38   57.46   57.09   56.72   56.67   56.67   59.11   59.11   59.85   56.30   57.41   57.04   57.04   57.78   57.41   57.04   57.41   57.04   57.41   62.22   62.96   62.22   62.59   62.22   62.22   62.59   62.59   63.33   63.70   63.33   64.07   64.44   29.43   29.43   33.85   33.46   34.36   35.14   35.14   33.98   34.36   34.75   34.75   34.75   34.75   78.02   97.45   97.08   97.45   97.45   97.08   95.99   96.35   96.35   96.35   96.35   96.35   96.72   97.08   96.72   97.45   97.08  100.00   97.81   98.91   98.18   98.54   98.54   98.91   98.54   98.18   98.18   98.54   96.72   97.45   97.08   96.35   96.72   97.45   97.45   97.08   97.81   98.18   96.72   97.45   97.81   98.18   97.81   97.08   97.08   97.08   96.72   97.45   97.08   97.08   97.08   97.08   97.45   95.26   97.08   97.45   97.08   97.08   97.45   97.08   97.45   97.71   97.08   97.45   98.18   97.45   97.45   97.81

    72: AFO55202.1   48.71   49.08   48.71   49.08   57.30   56.93   57.30   57.30   59.25   56.72   56.34   55.97   56.30   56.30   58.36   58.36   59.48   55.93   57.04   56.67   56.67   57.41   57.04   56.67   57.04   56.67   57.04   61.48   62.22   61.48   61.85   61.48   61.48   61.85   61.85   62.59   62.96   62.59   63.33   63.70   29.06   29.06   34.23   33.09   34.36   35.14   35.14   33.98   34.36   34.75   34.75   34.75   34.75   77.66   97.08   96.72   97.45   97.08   97.81   96.72   97.08   97.08   97.08   97.08   97.08   97.45   97.08   96.72   97.45   97.08   97.81  100.00   98.18   98.91   98.54   98.54   98.91   97.81   97.08   97.45   97.81   97.45   98.18   97.81   97.08   97.45   97.45   97.45   97.08   97.81   98.18   97.45   97.45   97.81   98.18   98.54   97.81   97.81   97.81   97.45   98.18   97.81   97.81   97.81   97.81   98.18   95.99   97.81   97.45   97.08   97.08   97.45   97.81   97.45   97.71   97.08   97.45   97.45   97.45   97.45   97.81

    73: ABI53716.1   49.82   50.18   49.82   50.18   57.68   57.30   57.68   57.68   59.25   56.72   56.34   55.97   57.04   57.04   58.74   58.74   59.48   55.93   57.04   56.67   56.67   57.41   57.04   56.67   57.04   56.67   57.04   61.85   62.59   61.85   62.22   61.85   61.85   62.22   62.22   62.96   63.33   62.96   63.70   64.07   29.43   29.43   33.85   33.09   34.36   35.14   35.14   33.98   34.36   34.75   34.75   34.75   34.75   77.66   97.08   96.72   97.08   97.08   97.08   95.99   96.35   96.35   96.35   96.35   96.35   96.72   97.08   96.35   97.08   96.72   98.91   98.18  100.00   98.54   98.91   98.91   99.27   98.18   97.45   97.81   98.18   96.35   97.08   96.72   95.99   96.35   96.35   97.08   96.72   97.45   97.81   96.35   97.08   97.45   97.81   97.45   96.72   96.72   96.72   96.35   97.08   96.72   96.72   96.72   96.72   97.08   94.89   96.72   96.35   95.99   95.99   96.35   97.45   97.08   96.56   95.99   96.35   97.08   96.35   96.35   96.72

    74: AEL88491.1   49.45   49.82   49.45   49.82   57.68   57.30   57.68   57.68   59.25   56.72   56.34   55.97   56.67   56.67   58.74   58.74   59.48   56.30   57.41   57.04   57.04   57.78   57.41   57.04   57.41   57.04   57.41   61.85   62.59   61.85   62.22   61.85   61.85   62.22   62.22   62.96   63.33   62.96   63.70   64.07   29.43   29.43   34.23   33.09   34.36   35.14   35.14   33.98   34.36   34.75   34.75   34.75   34.75   77.66   97.08   96.72   97.08   97.08   97.45   96.35   96.72   96.72   96.72   96.72   96.72   97.08   96.72   96.35   97.08   96.72   98.18   98.91   98.54  100.00   98.91   98.91   99.27   98.18   97.45   97.81   98.18   97.08   97.81   97.45   96.72   97.08   97.08   97.08   96.72   97.45   97.81   97.08   97.08   97.45   97.81   98.18   97.45   97.45   97.45   97.08   97.81   97.45   97.45   97.45   97.45   97.81   95.62   97.45   97.08   96.72   96.72   97.08   97.45   97.08   97.33   96.72   97.08   97.08   97.08   97.08   97.45

    75: ACD84990.1   49.82   50.18   49.82   50.18   57.68   57.30   57.68   57.68   59.25   56.72   56.34   55.97   56.67   56.67   59.11   59.11   59.85   56.30   57.41   57.04   57.04   57.78   57.41   57.04   57.41   57.04   57.41   61.48   62.22   61.48   61.85   61.48   61.48   61.85   61.85   62.59   62.96   62.59   63.33   63.70   29.06   29.06   33.46   33.09   33.98   34.75   34.75   33.59   33.98   34.36   34.36   34.36   34.36   77.66   97.45   97.08   97.45   97.45   97.08   95.99   96.35   96.35   96.35   96.35   96.35   96.72   97.08   96.72   97.45   97.08   98.54   98.54   98.91   98.91  100.00   99.27   99.64   98.54   97.81   98.18   98.54   96.72   97.45   97.08   96.35   96.72   96.72   97.45   97.08   97.81   98.18   96.72   97.45   97.81   98.18   97.81   97.08   97.08   97.08   96.72   97.45   97.08   97.08   97.08   97.08   97.45   95.26   97.08   96.72   96.35   96.35   96.72   97.81   97.45   96.95   96.35   96.72   97.45   96.72   96.72   97.08

    76: AEL17179.1   49.45   49.82   49.45   49.82   57.30   56.93   57.30   57.30   59.25   56.72   56.34   55.97   56.67   56.67   58.74   58.74   59.48   55.93   57.04   56.67   56.67   57.41   57.04   56.67   57.04   56.67   57.04   61.48   62.22   61.48   61.85   61.48   61.48   61.85   61.85   62.59   62.96   62.59   63.33   63.70   29.81   29.81   33.46   32.72   33.98   34.75   34.75   33.59   33.98   34.36   34.36   34.36   34.36   77.66   97.45   97.08   97.45   97.45   97.08   95.99   96.35   96.35   96.35   97.08   96.35   96.72   97.08   96.72   97.45   97.08   98.54   98.54   98.91   98.91   99.27  100.00   99.64   98.54   97.81   98.91   98.54   97.45   98.18   97.81   97.08   97.45   96.72   97.45   97.81   97.81   98.18   96.72   97.45   97.81   98.18   97.81   97.08   97.08   97.08   96.72   97.45   97.08   97.08   97.08   97.08   97.45   95.26   97.08   96.72   96.35   96.35   96.72   97.81   97.45   96.95   96.35   96.72   97.45   96.72   96.72   97.08

    77: CAC83905.2   49.82   50.18   49.82   50.18   57.68   57.30   57.68   57.68   59.62   57.09   56.72   56.34   57.04   57.04   59.11   59.11   59.85   56.30   57.41   57.04   57.04   57.78   57.41   57.04   57.41   57.04   57.41   61.85   62.59   61.85   62.22   61.85   61.85   62.22   62.22   62.96   63.33   62.96   63.70   64.07   29.43   29.43   33.85   33.09   34.36   35.14   35.14   33.98   34.36   34.75   34.75   34.75   34.75   78.02   97.81   97.45   97.81   97.81   97.45   96.35   96.72   96.72   96.72   96.72   96.72   97.08   97.45   97.08   97.81   97.45   98.91   98.91   99.27   99.27   99.64   99.64  100.00   98.91   98.18   98.54   98.91   97.08   97.81   97.45   96.72   97.08   97.08   97.81   97.45   98.18   98.54   97.08   97.81   98.18   98.54   98.18   97.45   97.45   97.45   97.08   97.81   97.45   97.45   97.45   97.45   97.81   95.62   97.45   97.08   96.72   96.72   97.08   98.18   97.81   97.33   96.72   97.08   97.81   97.08   97.08   97.45

    78: AAW81336.1   49.82   50.18   49.82   50.18   58.05   57.68   58.05   58.05   60.00   57.46   56.72   56.34   56.67   56.67   58.74   58.74   59.48   56.30   57.41   57.04   57.04   57.78   57.41   57.04   57.41   57.04   57.41   62.22   62.96   62.22   62.59   62.22   62.22   62.59   62.59   63.33   63.70   63.33   64.07   64.81   29.81   29.81   33.85   33.46   34.36   35.14   35.14   33.98   34.36   34.75   34.75   34.75   34.75   78.75   97.45   97.08   98.18   98.18   97.81   96.72   97.08   97.08   97.08   97.08   97.08   97.45   97.81   97.45   98.18   97.81   98.54   97.81   98.18   98.18   98.54   98.54   98.91  100.00   98.54   98.91   99.27   97.45   97.45   97.81   97.08   97.45   97.45   98.18   97.81   98.54   98.91   97.45   98.18   98.54   98.91   98.54   97.81   97.81   97.81   97.45   98.18   97.81   97.81   97.81   97.81   98.18   95.99   97.81   96.72   97.08   97.08   97.45   97.81   98.18   97.33   97.08   97.45   98.18   97.45   97.45   97.81

    79: AFO55201.1   49.08   49.45   49.08   49.45   57.30   56.93   57.30   57.30   59.25   56.72   55.97   55.60   56.67   56.67   57.99   57.99   58.74   56.30   57.41   57.04   57.04   57.78   57.41   57.04   57.41   57.04   56.67   61.48   62.22   61.48   61.85   61.48   61.48   61.85   61.85   62.59   62.96   62.59   63.33   63.70   29.43   29.43   33.46   33.09   34.36   35.14   35.14   33.98   34.36   34.75   34.75   34.75   34.75   78.02   96.72   96.35   97.45   97.45   97.08   95.99   96.35   96.35   96.35   96.35   96.35   96.72   97.08   96.72   97.45   97.08   98.18   97.08   97.45   97.45   97.81   97.81   98.18   98.54  100.00   98.91   99.27   96.72   96.72   97.08   96.35   96.72   97.08   97.45   97.08   97.81   98.18   96.72   97.45   97.81   98.18   97.81   97.08   97.08   97.08   96.72   97.45   97.08   97.08   97.08   97.08   97.45   95.26   97.08   96.35   96.72   96.72   97.08   97.08   97.45   96.95   96.72   97.08   97.81   97.08   97.08   97.45

    80: ABW70410.1   49.08   49.45   49.08   49.45   57.30   56.93   57.30   57.30   59.25   56.72   55.97   55.60   56.67   56.67   57.99   57.99   58.74   56.30   57.41   57.04   57.04   57.78   57.41   57.04   57.41   57.04   56.67   61.48   62.22   61.48   61.85   61.48   61.48   61.85   61.85   62.59   62.96   62.59   63.33   63.70   30.19   30.19   33.46   33.09   33.98   34.75   34.75   33.59   33.98   34.36   34.36   34.36   34.36   78.02   97.08   96.72   97.81   97.81   97.45   96.35   96.72   96.72   96.72   97.45   96.72   97.08   97.45   97.08   97.81   97.45   98.18   97.45   97.81   97.81   98.18   98.91   98.54   98.91   98.91  100.00   99.64   97.81   97.81   98.18   97.45   97.81   97.08   97.81   98.18   98.18   98.54   97.08   97.81   98.18   98.54   98.18   97.45   97.45   97.45   97.08   97.81   97.45   97.45   97.45   97.45   97.81   95.62   97.45   96.35   96.72   96.72   97.08   97.45   97.81   96.95   96.72   97.08   97.81   97.08   97.08   97.45

    81: AAW81342.1   49.45   49.82   49.45   49.82   57.68   57.30   57.68   57.68   59.62   57.09   56.34   55.97   57.04   57.04   58.36   58.36   59.11   56.67   57.78   57.41   57.41   58.15   57.78   57.41   57.78   57.41   57.04   61.85   62.59   61.85   62.22   61.85   61.85   62.22   62.22   62.96   63.33   62.96   63.70   64.07   29.81   29.81   33.85   33.46   34.36   35.14   35.14   33.98   34.36   34.75   34.75   34.75   34.75   78.39   97.45   97.08   98.18   98.18   97.81   96.72   97.08   97.08   97.08   97.08   97.08   97.45   97.81   97.45   98.18   97.81   98.54   97.81   98.18   98.18   98.54   98.54   98.91   99.27   99.27   99.64  100.00   97.45   97.45   97.81   97.08   97.45   97.45   98.18   97.81   98.54   98.91   97.45   98.18   98.54   98.91   98.54   97.81   97.81   97.81   97.45   98.18   97.81   97.81   97.81   97.81   98.18   95.99   97.81   96.72   97.08   97.08   97.45   97.81   98.18   97.33   97.08   97.45   98.18   97.45   97.45   97.81

    82: ABS71123.1   48.71   49.08   48.71   49.08   56.93   56.55   56.93   56.93   59.25   56.72   55.97   55.60   55.19   55.19   57.25   57.25   57.99   55.56   56.67   56.30   56.30   57.04   56.67   56.30   56.67   56.30   56.67   61.85   62.59   61.85   62.22   61.85   61.85   62.22   62.22   62.96   63.33   62.96   63.70   64.07   30.19   30.19   33.85   33.09   33.20   33.98   33.98   32.82   33.59   33.59   33.59   33.59   33.59   77.66   95.99   95.62   97.08   96.72   97.81   97.81   97.45   97.45   97.45   98.18   97.45   97.81   97.08   96.72   97.45   97.08   96.72   97.45   96.35   97.08   96.72   97.45   97.08   97.45   96.72   97.81   97.45  100.00   99.27   99.64   98.91   99.27   97.81   97.81   98.18   97.45   97.81   98.54   98.54   98.18   98.54   98.91   98.91   98.91   98.91   98.91   98.91   99.27   99.27   99.27   99.64   99.27   95.62   97.45   96.35   96.72   96.72   97.08   97.45   97.81   96.95   96.72   97.08   97.08   97.08   97.08   97.45

    83: ACD45467.1   49.08   49.45   49.08   49.45   57.30   56.93   57.30   57.30   59.62   57.09   56.72   56.34   55.56   55.56   57.99   57.99   58.74   55.93   57.04   56.67   56.67   57.41   57.04   56.67   57.04   56.67   57.04   62.22   62.96   62.22   62.59   62.22   62.22   62.59   62.59   63.33   63.70   63.33   64.07   64.44   30.19   30.19   34.23   33.46   33.59   34.36   34.36   33.20   33.98   33.98   33.98   33.98   33.98   77.66   96.72   96.35   97.08   96.72   97.81   97.08   97.45   97.45   97.45   98.18   97.45   97.81   97.08   96.72   97.45   97.08   97.45   98.18   97.08   97.81   97.45   98.18   97.81   97.45   96.72   97.81   97.45   99.27  100.00   99.64   98.91   99.27   97.81   97.81   98.18   97.45   97.81   98.54   97.81   98.18   98.54   98.91   98.91   98.91   98.91   98.54   98.91   98.91   98.91   98.91   98.91   99.27   95.62   97.45   97.08   96.72   96.72   97.08   97.45   97.81   97.33   96.72   97.08   97.08   97.08   97.08   97.45

    84: ABV71248.1   49.08   49.45   49.08   49.45   57.30   56.93   57.30   57.30   59.62   57.09   56.34   55.97   55.56   55.56   57.62   57.62   58.36   55.93   57.04   56.67   56.67   57.41   57.04   56.67   57.04   56.67   57.04   62.22   62.96   62.22   62.59   62.22   62.22   62.59   62.59   63.33   63.70   63.33   64.07   64.44   30.57   30.57   34.23   33.46   33.59   34.36   34.36   33.20   33.98   33.98   33.98   33.98   33.98   78.02   96.35   95.99   97.45   97.08   98.18   97.45   97.81   97.81   97.81   98.54   97.81   98.18   97.45   97.08   97.81   97.45   97.08   97.81   96.72   97.45   97.08   97.81   97.45   97.81   97.08   98.18   97.81   99.64   99.64  100.00   99.27   99.64   98.18   98.18   98.54   97.81   98.18   98.91   98.18   98.54   98.91   99.27   99.27   99.27   99.27   98.91   99.27   99.27   99.27   99.27   99.27   99.64   95.99   97.81   96.72   97.08   97.08   97.45   97.81   98.18   97.33   97.08   97.45   97.45   97.45   97.45   97.81

    85: AEB98923.1   49.08   49.45   49.08   49.45   56.55   56.18   56.55   56.55   59.62   57.09   56.34   55.97   55.56   55.56   57.25   57.25   57.99   56.30   57.41   57.04   57.04   57.78   57.41   57.04   57.41   57.04   57.41   61.85   62.59   61.85   62.22   61.85   61.85   62.22   62.22   62.96   63.33   62.96   63.70   64.07   30.57   30.57   34.23   33.09   33.20   33.98   33.98   32.82   33.59   33.59   33.59   33.59   33.59   78.39   95.62   95.26   96.72   96.35   97.45   96.72   97.08   97.08   97.08   97.81   97.08   97.45   96.72   96.35   97.08   96.72   96.35   97.08   95.99   96.72   96.35   97.08   96.72   97.08   96.35   97.45   97.08   98.91   98.91   99.27  100.00   99.64   97.45   97.45   97.81   97.08   97.45   98.18   97.45   98.54   98.18   98.54   98.54   98.54   98.54   98.18   98.54   98.54   98.54   98.54   98.54   98.91   95.26   97.08   95.99   96.35   96.35   96.72   97.08   97.45   96.56   96.35   96.72   96.72   96.72   96.72   97.08

    86: AEB98920.1   49.08   49.45   49.08   49.45   56.93   56.55   56.93   56.93   59.62   57.09   56.34   55.97   55.56   55.56   57.25   57.25   57.99   56.30   57.41   57.04   57.04   57.78   57.41   57.04   57.41   57.04   57.41   62.22   62.96   62.22   62.59   62.22   62.22   62.59   62.59   63.33   63.70   63.33   64.07   64.44   30.57   30.57   34.23   33.09   33.59   34.36   34.36   33.20   33.98   33.98   33.98   33.98   33.98   78.02   95.99   95.62   97.08   96.72   97.81   97.08   97.45   97.45   97.45   98.18   97.45   97.81   97.08   96.72   97.45   97.08   96.72   97.45   96.35   97.08   96.72   97.45   97.08   97.45   96.72   97.81   97.45   99.27   99.27   99.64   99.64  100.00   97.81   97.81   98.18   97.45   97.81   98.54   97.81   98.91   98.54   98.91   98.91   98.91   98.91   98.54   98.91   98.91   98.91   98.91   98.91   99.27   95.62   97.45   96.35   96.72   96.72   97.08   97.45   97.81   96.95   96.72   97.08   97.08   97.08   97.08   97.45

    87: ABF47917.1   49.45   49.82   49.45   49.82   57.68   57.30   57.68   57.68   59.62   56.72   55.97   55.60   55.93   55.93   57.99   57.99   58.74   56.30   57.41   57.04   57.04   57.78   57.41   57.04   57.41   57.04   57.41   62.22   62.96   62.22   62.59   62.22   62.22   62.59   62.59   63.33   63.70   63.33   64.07   64.44   30.19   30.19   34.62   33.46   33.98   34.75   34.75   33.59   34.36   34.36   34.36   34.36   34.36   77.66   95.99   95.62   97.08   96.72   97.45   96.72   97.08   97.08   97.08   97.08   97.08   97.45   96.72   96.35   97.08   96.72   97.45   97.45   96.35   97.08   96.72   96.72   97.08   97.45   97.08   97.08   97.45   97.81   97.81   98.18   97.45   97.81  100.00   97.81   97.45   97.45   97.81   97.81   97.81   98.18   98.54   98.91   98.18   98.18   98.18   97.81   98.54   98.18   98.18   98.18   98.18   98.54   96.35   97.45   97.08   97.45   97.45   97.81   97.45   97.81   98.09   97.45   97.81   97.81   97.81   97.81   98.18

    88: ACD84988.1   49.82   50.18   49.82   50.18   57.68   57.30   57.68   57.68   60.00   57.46   56.72   56.34   56.30   56.30   57.99   57.99   58.74   55.93   57.04   56.67   56.67   57.41   57.04   56.67   57.04   56.67   57.04   62.96   63.70   62.96   63.33   62.96   62.96   63.33   63.33   63.70   64.07   63.70   64.44   64.81   30.19   30.19   34.23   33.82   33.98   34.75   34.75   33.59   34.36   34.36   34.36   34.36   34.36   78.02   96.72   96.35   97.81   97.45   97.45   96.72   97.08   97.08   97.08   97.08   97.08   97.45   97.45   97.08   97.81   97.45   97.45   97.45   97.08   97.08   97.45   97.45   97.81   98.18   97.45   97.81   98.18   97.81   97.81   98.18   97.45   97.81   97.81  100.00   99.64   98.18   98.54   97.81   98.54   98.91   99.27   98.91   98.18   98.18   98.18   97.81   98.54   98.18   98.18   98.18   98.18   98.54   95.62   97.45   96.35   96.72   96.72   97.08   98.18   98.54   96.95   96.72   97.08   97.81   97.08   97.08   97.45

    89: ABV31688.1   49.45   49.82   49.45   49.82   57.30   56.93   57.30   57.30   59.62   57.09   56.34   55.97   55.93   55.93   57.62   57.62   58.36   55.56   56.67   56.30   56.30   57.04   56.67   56.30   56.67   56.30   56.67   62.59   63.33   62.59   62.96   62.59   62.59   62.96   62.96   63.33   63.70   63.33   64.07   64.44   30.57   30.57   33.85   33.46   33.59   34.36   34.36   33.20   33.98   33.98   33.98   33.98   33.98   77.66   96.35   95.99   97.45   97.08   97.08   96.35   96.72   96.72   96.72   97.45   96.72   97.08   97.08   96.72   97.45   97.08   97.08   97.08   96.72   96.72   97.08   97.81   97.45   97.81   97.08   98.18   97.81   98.18   98.18   98.54   97.81   98.18   97.45   99.64  100.00   97.81   98.18   97.45   98.18   98.54   98.91   98.54   97.81   97.81   97.81   97.45   98.18   97.81   97.81   97.81   97.81   98.18   95.26   97.08   95.99   96.35   96.35   96.72   97.81   98.18   96.56   96.35   96.72   97.45   96.72   96.72   97.08

    90: CCA94649.1   49.45   49.82   49.45   49.82   57.68   57.30   57.68   57.68   59.25   57.09   56.34   55.97   56.30   56.30   57.62   57.62   58.36   55.56   56.67   56.30   56.30   57.04   56.67   56.30   56.67   56.30   56.67   62.22   62.96   62.22   62.59   62.22   62.22   62.59   62.59   63.33   63.70   63.33   64.07   64.44   29.81   29.81   34.23   33.09   33.98   34.75   34.75   33.59   33.98   34.36   34.36   34.36   34.36   78.02   97.08   96.72   98.18   97.81   97.81   96.72   97.08   97.08   97.08   97.08   97.08   97.45   97.81   97.45   98.18   97.81   97.81   97.81   97.45   97.45   97.81   97.81   98.18   98.54   97.81   98.18   98.54   97.45   97.45   97.81   97.08   97.45   97.45   98.18   97.81  100.00   99.64   97.45   98.18   98.54   98.91   98.54   97.81   97.81   97.81   97.45   98.18   97.81   97.81   97.81   97.81   98.18   95.99   97.81   96.72   97.08   97.08   97.45   97.81   98.18   97.33   97.08   97.45   98.18   97.45   97.45   97.81

    91: ADM26745.1   49.08   49.45   49.08   49.45   57.68   57.30   57.68   57.68   59.25   56.72   55.97   55.60   55.93   55.93   57.99   57.99   58.74   55.93   57.04   56.67   56.67   57.41   57.04   56.67   57.04   56.67   57.04   61.85   62.59   61.85   62.22   61.85   61.85   62.22   62.22   62.96   63.33   62.96   63.70   64.07   29.81   29.81   34.23   33.09   33.98   34.75   34.75   33.59   33.98   34.36   34.36   34.36   34.36   78.39   97.45   97.08   98.54   98.18   98.18   97.08   97.45   97.45   97.45   97.45   97.45   97.81   98.18   97.81   98.54   98.18   98.18   98.18   97.81   97.81   98.18   98.18   98.54   98.91   98.18   98.54   98.91   97.81   97.81   98.18   97.45   97.81   97.81   98.54   98.18   99.64  100.00   97.81   98.54   98.91   99.27   98.91   98.18   98.18   98.18   97.81   98.54   98.18   98.18   98.18   98.18   98.54   96.35   98.18   97.08   97.45   97.45   97.81   98.18   98.54   97.71   97.45   97.81   98.54   97.81   97.81   98.18

    92: ADI58616.1   49.82   50.18   49.82   50.18   58.05   57.68   58.05   58.05   60.38   57.84   57.09   56.72   56.30   56.30   58.36   58.36   59.11   56.67   57.78   57.41   57.41   58.15   57.78   57.41   57.78   57.41   57.78   62.96   63.70   62.96   63.33   62.96   62.96   63.33   63.33   64.07   64.44   64.07   64.81   65.19   30.19   30.19   34.62   34.19   34.36   35.14   35.14   33.98   34.75   34.75   34.75   34.75   34.75   77.66   95.99   95.62   97.08   96.72   97.81   97.81   97.81   97.81   97.45   97.45   97.45   97.81   97.08   96.72   97.45   97.08   96.72   97.45   96.35   97.08   96.72   96.72   97.08   97.45   96.72   97.08   97.45   98.54   98.54   98.91   98.18   98.54   97.81   97.81   97.45   97.45   97.81  100.00   98.54   98.18   98.54   98.91   98.91   99.27   99.27   98.54   98.91   98.91   98.91   98.91   98.91   99.27   95.62   97.45   96.35   96.72   96.72   97.08   97.45   97.81   96.95   96.72   97.08   97.08   97.08   97.08   97.45

    93: ADX07745.1   49.45   49.82   49.45   49.82   57.68   57.30   57.68   57.68   59.62   57.09   56.34   55.97   55.56   55.56   57.62   57.62   58.36   55.93   57.04   56.67   56.67   57.41   57.04   56.67   57.04   56.67   57.04   62.22   62.96   62.22   62.59   62.22   62.22   62.59   62.59   63.33   63.70   63.33   64.07   64.44   29.81   29.81   33.85   33.46   33.59   34.36   34.36   33.20   33.98   33.98   33.98   33.98   33.98   77.66   96.72   96.35   97.81   97.45   97.45   98.18   97.08   97.08   97.08   97.08   97.08   97.45   97.45   97.08   97.81   97.45   97.45   97.45   97.08   97.08   97.45   97.45   97.81   98.18   97.45   97.81   98.18   98.54   97.81   98.18   97.45   97.81   97.81   98.54   98.18   98.18   98.54   98.54  100.00   98.91   99.27   98.91   98.18   98.18   98.54   98.18   98.54   98.54   98.54   98.54   98.91   98.54   95.62   97.45   96.35   96.72   96.72   97.08   98.18   98.54   96.95   96.72   97.08   97.81   97.08   97.08   97.45

    94: ABF47918.1   49.82   50.18   49.82   50.18   57.68   57.30   57.68   57.68   60.00   57.46   56.72   56.34   55.93   55.93   57.62   57.62   58.36   56.67   57.78   57.41   57.41   58.15   57.78   57.41   57.78   57.41   57.78   62.59   63.33   62.59   62.96   62.59   62.59   62.96   62.96   63.70   64.07   63.70   64.44   64.81   30.19   30.19   34.23   33.46   33.98   34.75   34.75   33.59   34.36   34.36   34.36   34.36   34.36   78.39   97.08   96.72   98.18   97.81   97.81   97.08   97.45   97.45   97.45   97.45   97.45   97.81   97.81   97.45   98.18   97.81   97.81   97.81   97.45   97.45   97.81   97.81   98.18   98.54   97.81   98.18   98.54   98.18   98.18   98.54   98.54   98.91   98.18   98.91   98.54   98.54   98.91   98.18   98.91  100.00   99.64   99.27   98.54   98.54   98.54   98.18   98.91   98.54   98.54   98.54   98.54   98.91   95.99   97.81   96.72   97.08   97.08   97.45   98.54   98.91   97.33   97.08   97.45   98.18   97.45   97.45   97.81

    95: CAJ77809.1   49.82   50.18   49.82   50.18   58.05   57.68   58.05   58.05   60.00   57.46   56.72   56.34   55.93   55.93   57.99   57.99   58.74   56.30   57.41   57.04   57.04   57.78   57.41   57.04   57.41   57.04   57.41   62.59   63.33   62.59   62.96   62.59   62.59   62.96   62.96   63.70   64.07   63.70   64.44   64.81   30.19   30.19   34.23   33.82   33.98   34.75   34.75   33.59   34.36   34.36   34.36   34.36   34.36   78.39   97.45   97.08   98.54   98.18   98.18   97.45   97.81   97.81   97.81   97.81   97.81   98.18   98.18   97.81   98.54   98.18   98.18   98.18   97.81   97.81   98.18   98.18   98.54   98.91   98.18   98.54   98.91   98.54   98.54   98.91   98.18   98.54   98.54   99.27   98.91   98.91   99.27   98.54   99.27   99.64  100.00   99.64   98.91   98.91   98.91   98.54   99.27   98.91   98.91   98.91   98.91   99.27   96.35   98.18   97.08   97.45   97.45   97.81   98.91   99.27   97.71   97.45   97.81   98.54   97.81   97.81   98.18

    96: AAW81337.1   49.45   49.82   49.45   49.82   58.05   57.68   58.05   58.05   60.00   57.46   56.72   56.34   55.93   55.93   57.99   57.99   58.74   56.30   57.41   57.04   57.04   57.78   57.41   57.04   57.41   57.04   57.41   62.59   63.33   62.59   62.96   62.59   62.59   62.96   62.96   63.70   64.07   63.70   64.44   64.81   30.19   30.19   34.62   33.82   33.98   34.75   34.75   33.59   34.36   34.36   34.36   34.36   34.36   78.39   97.08   96.72   98.18   97.81   98.54   97.81   98.18   98.18   98.18   98.18   98.18   98.54   97.81   97.45   98.18   97.81   97.81   98.54   97.45   98.18   97.81   97.81   98.18   98.54   97.81   98.18   98.54   98.91   98.91   99.27   98.54   98.91   98.91   98.91   98.54   98.54   98.91   98.91   98.91   99.27   99.64  100.00   99.27   99.27   99.27   98.91   99.64   99.27   99.27   99.27   99.27   99.64   96.72   98.54   97.45   97.81   97.81   98.18   98.54   98.91   98.09   97.81   98.18   98.18   98.18   98.18   98.54

    97: AAX51234.1   49.82   50.18   49.82   50.18   58.05   57.68   58.05   58.05   60.00   57.46   56.72   56.34   55.56   55.56   57.99   57.99   58.74   55.93   57.04   56.67   56.67   57.41   57.04   56.67   57.04   56.67   57.04   62.59   63.33   62.59   62.96   62.59   62.59   62.96   62.96   63.70   64.07   63.70   64.44   64.81   30.19   30.19   34.62   33.46   33.59   34.36   34.36   33.20   33.98   33.98   33.98   33.98   33.98   78.02   96.35   95.99   97.45   97.08   98.18   97.45   97.81   97.81   97.81   97.81   97.81   98.18   97.45   97.08   97.81   97.45   97.08   97.81   96.72   97.45   97.08   97.08   97.45   97.81   97.08   97.45   97.81   98.91   98.91   99.27   98.54   98.91   98.18   98.18   97.81   97.81   98.18   98.91   98.18   98.54   98.91   99.27  100.00   99.27   99.27   98.91   99.27   99.27   99.27   99.27   99.27   99.64   95.99   97.81   96.72   97.08   97.08   97.45   97.81   98.18   97.71   97.08   97.45   97.45   97.45   97.45   97.81

    98: ABC26007.1   49.45   49.82   49.45   49.82   57.68   57.30   57.68   57.68   60.00   57.46   56.72   56.34   55.93   55.93   57.99   57.99   58.74   56.30   57.41   57.04   57.04   57.78   57.41   57.04   57.41   57.04   57.41   62.59   63.33   62.59   62.96   62.59   62.59   62.96   62.96   63.70   64.07   63.70   64.44   64.81   30.57   30.57   34.62   33.82   33.98   34.75   34.75   33.59   34.36   34.36   34.36   34.36   34.36   78.02   96.35   95.99   97.45   97.08   98.18   97.45   98.54   98.18   97.81   97.81   97.81   98.18   97.45   97.08   97.81   97.45   97.08   97.81   96.72   97.45   97.08   97.08   97.45   97.81   97.08   97.45   97.81   98.91   98.91   99.27   98.54   98.91   98.18   98.18   97.81   97.81   98.18   99.27   98.18   98.54   98.91   99.27   99.27  100.00   99.27   98.91   99.27   99.27   99.27   99.27   99.27   99.64   95.99   97.81   96.72   97.08   97.08   97.45   97.81   98.18   97.33   97.08   97.45   97.45   97.45   97.45   97.81

    99: ABV71246.1   49.45   49.82   49.45   49.82   57.68   57.30   57.68   57.68   60.00   57.46   56.72   56.34   55.93   55.93   57.99   57.99   58.74   56.30   57.41   57.04   57.04   57.78   57.41   57.04   57.41   57.04   57.41   62.59   63.33   62.59   62.96   62.59   62.59   62.96   62.96   63.70   64.07   63.70   64.44   64.81   30.19   30.19   34.62   33.82   33.98   34.75   34.75   33.59   34.36   34.36   34.36   34.36   34.36   78.02   96.35   95.99   97.45   97.08   98.18   97.81   97.81   97.81   97.81   97.81   97.81   98.18   97.45   97.08   97.81   97.45   97.08   97.81   96.72   97.45   97.08   97.08   97.45   97.81   97.08   97.45   97.81   98.91   98.91   99.27   98.54   98.91   98.18   98.18   97.81   97.81   98.18   99.27   98.54   98.54   98.91   99.27   99.27   99.27  100.00   98.91   99.27   99.27   99.27   99.27   99.27   99.64   95.99   97.81   96.72   97.08   97.08   97.45   97.81   98.18   97.33   97.08   97.45   97.45   97.45   97.45   97.81

   100: ABC26006.1   49.08   49.45   49.08   49.45   56.93   56.55   56.93   56.93   59.25   56.72   55.97   55.60   55.56   55.56   57.25   57.25   57.99   55.93   56.67   56.30   56.30   57.04   56.67   56.30   56.67   56.30   56.67   61.85   62.59   61.85   62.22   61.85   61.85   62.22   62.22   62.96   63.33   63.33   63.70   64.07   29.81   29.81   34.23   33.46   33.59   34.36   34.36   33.20   33.98   33.98   33.98   33.98   33.98   77.66   95.99   95.62   97.08   96.72   97.81   97.45   97.45   97.45   97.45   97.45   97.45   97.81   97.08   96.72   97.45   97.08   96.72   97.45   96.35   97.08   96.72   96.72   97.08   97.45   96.72   97.08   97.45   98.91   98.54   98.91   98.18   98.54   97.81   97.81   97.45   97.45   97.81   98.54   98.18   98.18   98.54   98.91   98.91   98.91   98.91  100.00   98.91   99.64   99.27   99.27   99.27   99.27   95.62   97.45   96.35   96.72   96.72   97.08   97.45   97.81   96.95   96.72   97.08   97.08   97.08   97.08   97.45

   101: ABD48715.1   49.45   49.82   49.45   49.82   57.68   57.30   57.68   57.68   60.00   57.46   56.72   56.34   55.93   55.93   57.99   57.99   58.74   56.30   57.41   57.04   57.04   57.78   57.41   57.04   57.41   57.04   57.41   62.59   63.33   62.59   62.96   62.59   62.59   62.96   62.96   63.70   64.07   64.07   64.44   64.81   30.19   30.19   34.62   33.82   33.98   34.75   34.75   33.59   34.36   34.36   34.36   34.36   34.36   78.75   96.72   96.35   97.81   97.45   98.54   97.81   98.18   98.18   98.18   98.18   98.18   98.54   97.81   97.81   98.54   98.18   97.45   98.18   97.08   97.81   97.45   97.45   97.81   98.18   97.45   97.81   98.18   98.91   98.91   99.27   98.54   98.91   98.54   98.54   98.18   98.18   98.54   98.91   98.54   98.91   99.27   99.64   99.27   99.27   99.27   98.91  100.00   99.27   99.27   99.27   99.27   99.64   96.35   98.18   97.08   97.45   97.45   97.81   98.18   98.54   97.71   97.45   97.81   97.81   97.81   97.81   98.18

   102: BAL15076.1   49.08   49.45   49.08   49.45   57.30   56.93   57.30   57.30   59.62   57.09   56.34   55.97   55.56   55.56   57.62   57.62   58.36   55.93   57.04   56.67   56.67   57.41   57.04   56.67   57.04   56.67   57.04   62.22   62.96   62.22   62.59   62.22   62.22   62.59   62.59   63.33   63.70   63.33   64.07   64.44   29.81   29.81   34.23   33.46   33.59   34.36   34.36   33.20   33.98   33.98   33.98   33.98   33.98   78.02   96.35   95.99   97.45   97.08   98.18   97.81   97.81   97.81   97.81   97.81   97.81   98.18   97.45   97.08   97.81   97.45   97.08   97.81   96.72   97.45   97.08   97.08   97.45   97.81   97.08   97.45   97.81   99.27   98.91   99.27   98.54   98.91   98.18   98.18   97.81   97.81   98.18   98.91   98.54   98.54   98.91   99.27   99.27   99.27   99.27   99.64   99.27  100.00   99.64   99.64   99.64   99.64   95.99   97.81   96.72   97.08   97.08   97.45   97.81   98.18   97.33   97.08   97.45   97.45   97.45   97.45   97.81

   103: ABV31689.1   49.08   49.45   49.08   49.45   57.30   56.93   57.30   57.30   59.62   57.09   56.34   55.97   55.56   55.56   57.62   57.62   58.36   55.93   57.04   56.67   56.67   57.41   57.04   56.67   57.04   56.67   57.04   62.22   62.96   62.22   62.59   62.22   62.22   62.59   62.59   63.33   63.70   63.33   64.07   64.44   29.81   29.81   34.23   33.46   33.59   34.36   34.36   33.20   33.98   33.98   33.98   33.98   33.98   78.02   96.35   95.99   97.45   97.08   98.18   97.81   97.81   97.81   97.81   97.81   97.81   98.18   97.45   97.08   97.81   97.45   97.08   97.81   96.72   97.45   97.08   97.08   97.45   97.81   97.08   97.45   97.81   99.27   98.91   99.27   98.54   98.91   98.18   98.18   97.81   97.81   98.18   98.91   98.54   98.54   98.91   99.27   99.27   99.27   99.27   99.27   99.27   99.64  100.00   99.64   99.64   99.64   95.99   97.81   96.72   97.08   97.08   97.45   97.81   98.18   97.33   97.08   97.45   97.45   97.45   97.45   97.81

   104: BAN10684.1   49.08   49.45   49.08   49.45   57.30   56.93   57.30   57.30   59.62   57.09   56.34   55.97   55.56   55.56   57.62   57.62   58.36   55.93   57.04   56.67   56.67   57.41   57.04   56.67   57.04   56.67   57.04   62.22   62.96   62.22   62.59   62.22   62.22   62.59   62.59   63.33   63.70   63.33   64.07   64.44   29.81   29.81   34.23   33.46   33.59   34.36   34.36   33.20   33.98   33.98   33.98   33.98   33.98   78.02   96.35   95.99   97.45   97.08   98.18   97.81   97.81   97.81   97.81   97.81   97.81   98.18   97.45   97.08   97.81   97.45   97.08   97.81   96.72   97.45   97.08   97.08   97.45   97.81   97.08   97.45   97.81   99.27   98.91   99.27   98.54   98.91   98.18   98.18   97.81   97.81   98.18   98.91   98.54   98.54   98.91   99.27   99.27   99.27   99.27   99.27   99.27   99.64   99.64  100.00   99.64   99.64   95.99   97.81   96.72   97.08   97.08   97.45   97.81   98.18   97.33   97.08   97.45   97.45   97.45   97.45   97.81

   105: ABV71247.1   49.08   49.45   49.08   49.45   57.30   56.93   57.30   57.30   59.62   57.09   56.34   55.97   55.56   55.56   57.62   57.62   58.36   55.93   57.04   56.67   56.67   57.41   57.04   56.67   57.04   56.67   57.04   62.22   62.96   62.22   62.59   62.22   62.22   62.59   62.59   63.33   63.70   63.33   64.07   64.44   29.81   29.81   34.23   33.46   33.59   34.36   34.36   33.20   33.98   33.98   33.98   33.98   33.98   78.02   96.35   95.99   97.45   97.08   98.18   98.18   97.81   97.81   97.81   97.81   97.81   98.18   97.45   97.08   97.81   97.45   97.08   97.81   96.72   97.45   97.08   97.08   97.45   97.81   97.08   97.45   97.81   99.64   98.91   99.27   98.54   98.91   98.18   98.18   97.81   97.81   98.18   98.91   98.91   98.54   98.91   99.27   99.27   99.27   99.27   99.27   99.27   99.64   99.64   99.64  100.00   99.64   95.99   97.81   96.72   97.08   97.08   97.45   97.81   98.18   97.33   97.08   97.45   97.45   97.45   97.45   97.81

   106: AAW81338.1   49.45   49.82   49.45   49.82   57.68   57.30   57.68   57.68   60.00   57.46   56.72   56.34   55.93   55.93   57.99   57.99   58.74   56.30   57.41   57.04   57.04   57.78   57.41   57.04   57.41   57.04   57.41   62.59   63.33   62.59   62.96   62.59   62.59   62.96   62.96   63.70   64.07   63.70   64.44   64.81   30.19   30.19   34.62   33.82   33.98   34.75   34.75   33.59   34.36   34.36   34.36   34.36   34.36   78.39   96.72   96.35   97.81   97.45   98.54   97.81   98.18   98.18   98.18   98.18   98.18   98.54   97.81   97.45   98.18   97.81   97.45   98.18   97.08   97.81   97.45   97.45   97.81   98.18   97.45   97.81   98.18   99.27   99.27   99.64   98.91   99.27   98.54   98.54   98.18   98.18   98.54   99.27   98.54   98.91   99.27   99.64   99.64   99.64   99.64   99.27   99.64   99.64   99.64   99.64   99.64  100.00   96.35   98.18   97.08   97.45   97.45   97.81   98.18   98.54   97.71   97.45   97.81   97.81   97.81   97.81   98.18

   107: AAW51373.1   48.71   49.08   48.71   49.08   56.93   56.55   56.93   56.93   59.25   56.72   55.97   55.60   55.19   55.19   57.62   57.62   58.36   54.81   55.93   55.56   55.56   56.30   55.93   55.56   55.93   55.56   55.93   60.74   61.11   60.37   60.37   60.37   60.37   60.74   60.74   60.74   61.11   61.48   62.22   62.59   29.43   29.43   33.08   32.72   33.59   34.36   34.36   33.20   33.59   33.98   33.98   33.98   33.98   76.56   94.53   94.16   95.62   95.26   95.99   95.62   95.99   95.99   95.99   95.99   95.99   96.35   95.99   95.62   96.35   95.99   95.26   95.99   94.89   95.62   95.26   95.26   95.62   95.99   95.26   95.62   95.99   95.62   95.62   95.99   95.26   95.62   96.35   95.62   95.26   95.99   96.35   95.62   95.62   95.99   96.35   96.72   95.99   95.99   95.99   95.62   96.35   95.99   95.99   95.99   95.99   96.35  100.00   96.72   96.35   96.72   96.72   97.08   96.72   97.08   97.33   96.72   97.08   97.08   97.08   97.08   97.45

   108: ABF47916.1   48.71   49.08   48.71   49.08   57.68   57.30   57.68   57.68   59.25   56.72   55.97   55.60   55.56   55.56   57.99   57.99   58.74   55.56   56.67   56.30   56.30   57.04   56.67   56.30   56.67   56.30   56.67   61.48   62.22   61.48   61.85   61.48   61.48   61.85   61.85   62.59   62.96   62.59   63.33   63.70   29.81   29.81   33.46   33.82   33.98   34.75   34.75   33.59   33.98   34.36   34.36   34.36   34.36   78.02   97.08   96.72   98.18   97.81   97.81   96.72   97.08   97.08   97.08   97.08   97.08   97.45   97.81   97.45   98.18   97.81   97.08   97.81   96.72   97.45   97.08   97.08   97.45   97.81   97.08   97.45   97.81   97.45   97.45   97.81   97.08   97.45   97.45   97.45   97.08   97.81   98.18   97.45   97.45   97.81   98.18   98.54   97.81   97.81   97.81   97.45   98.18   97.81   97.81   97.81   97.81   98.18   96.72  100.00   97.45   97.81   97.81   98.18   97.81   98.18   98.09   97.81   98.18   98.18   98.18   98.18   98.54

   109: ABE03012.1   49.08   49.45   49.08   49.45   57.30   56.93   57.30   57.30   59.62   56.72   55.97   55.60   55.56   55.56   58.36   58.36   59.11   55.56   56.67   56.30   56.30   57.04   56.67   56.30   56.67   56.30   56.67   61.11   61.85   61.11   61.48   61.11   61.11   61.48   61.48   62.22   62.59   62.22   62.96   63.33   29.43   29.43   33.46   33.09   33.59   34.36   34.36   33.20   33.59   33.98   33.98   33.98   33.98   77.29   95.99   95.62   96.35   95.99   96.72   96.35   96.72   96.72   96.72   96.72   96.72   97.08   96.72   96.35   97.08   96.72   97.45   97.45   96.35   97.08   96.72   96.72   97.08   96.72   96.35   96.35   96.72   96.35   97.08   96.72   95.99   96.35   97.08   96.35   95.99   96.72   97.08   96.35   96.35   96.72   97.08   97.45   96.72   96.72   96.72   96.35   97.08   96.72   96.72   96.72   96.72   97.08   96.35   97.45  100.00   98.18   98.18   98.54   97.45   97.81   98.85   98.18   98.54   98.54   98.54   98.54   98.91

   110: ABY77907.1   49.45   49.82   49.45   49.82   57.30   56.93   57.30   57.30   59.25   56.34   55.60   55.22   54.81   54.81   57.62   57.62   58.36   55.19   56.30   55.93   55.93   56.67   56.30   55.93   56.30   55.93   56.30   61.85   62.59   61.85   62.22   61.85   61.85   62.22   62.22   62.96   63.33   62.96   63.70   64.07   29.43   29.43   33.46   33.09   33.59   34.36   34.36   33.20   33.59   33.98   33.98   33.98   33.98   77.66   95.62   95.26   96.72   96.35   97.08   96.72   97.08   97.08   97.08   97.08   97.08   97.45   97.08   96.72   97.45   97.08   97.08   97.08   95.99   96.72   96.35   96.35   96.72   97.08   96.72   96.72   97.08   96.72   96.72   97.08   96.35   96.72   97.45   96.72   96.35   97.08   97.45   96.72   96.72   97.08   97.45   97.81   97.08   97.08   97.08   96.72   97.45   97.08   97.08   97.08   97.08   97.45   96.72   97.81   98.18  100.00   99.27   99.64   97.81   98.18   98.85   98.54   98.91   98.91   98.91   98.91   99.27

   111: ACY56711.1   49.08   49.45   49.08   49.45   57.30   56.93   57.30   57.30   59.25   56.34   55.60   55.22   54.81   54.81   57.62   57.62   58.36   54.81   55.93   55.56   55.56   56.30   55.93   55.56   55.93   55.56   55.93   61.48   62.22   61.48   61.85   61.48   61.48   61.85   61.85   62.59   62.96   62.59   63.33   63.70   29.43   29.43   33.85   32.72   33.59   34.36   34.36   33.20   33.59   33.98   33.98   33.98   33.98   77.66   95.62   95.26   96.72   96.35   97.08   96.72   97.08   97.08   97.08   97.08   97.08   97.45   97.08   96.72   97.45   97.08   97.08   97.08   95.99   96.72   96.35   96.35   96.72   97.08   96.72   96.72   97.08   96.72   96.72   97.08   96.35   96.72   97.45   96.72   96.35   97.08   97.45   96.72   96.72   97.08   97.45   97.81   97.08   97.08   97.08   96.72   97.45   97.08   97.08   97.08   97.08   97.45   96.72   97.81   98.18   99.27  100.00   99.64   97.81   98.18   98.85   98.54   98.91   98.91   98.91   98.91   99.27

   112: AAW81339.1   49.45   49.82   49.45   49.82   57.68   57.30   57.68   57.68   59.62   56.72   55.97   55.60   55.19   55.19   57.99   57.99   58.74   55.19   56.30   55.93   55.93   56.67   56.30   55.93   56.30   55.93   56.30   61.85   62.59   61.85   62.22   61.85   61.85   62.22   62.22   62.96   63.33   62.96   63.70   64.07   29.81   29.81   33.85   33.09   33.59   34.36   34.36   33.20   33.59   33.98   33.98   33.98   33.98   78.02   95.99   95.62   97.08   96.72   97.45   97.08   97.45   97.45   97.45   97.45   97.45   97.81   97.45   97.08   97.81   97.45   97.45   97.45   96.35   97.08   96.72   96.72   97.08   97.45   97.08   97.08   97.45   97.08   97.08   97.45   96.72   97.08   97.81   97.08   96.72   97.45   97.81   97.08   97.08   97.45   97.81   98.18   97.45   97.45   97.45   97.08   97.81   97.45   97.45   97.45   97.45   97.81   97.08   98.18   98.54   99.64   99.64  100.00   98.18   98.54   99.24   98.91   99.27   99.27   99.27   99.27   99.64

   113: ADX07748.1   49.45   49.82   49.45   49.82   57.30   56.93   57.30   57.30   59.25   56.72   55.97   55.60   55.56   55.56   57.25   57.25   57.99   55.56   56.67   56.30   56.30   57.04   56.67   56.30   56.67   56.30   56.67   61.48   62.22   61.48   61.85   61.48   61.48   61.85   61.85   62.59   62.96   62.59   63.33   63.70   30.19   30.19   33.46   33.09   33.20   33.98   33.98   32.82   33.59   33.59   33.59   33.59   33.59   77.29   96.35   95.99   97.45   97.08   97.08   97.08   97.45   97.45   97.45   97.45   97.45   97.81   97.81   97.45   98.18   97.81   97.08   97.81   97.45   97.45   97.81   97.81   98.18   97.81   97.08   97.45   97.81   97.45   97.45   97.81   97.08   97.45   97.45   98.18   97.81   97.81   98.18   97.45   98.18   98.54   98.91   98.54   97.81   97.81   97.81   97.45   98.18   97.81   97.81   97.81   97.81   98.18   96.72   97.81   97.45   97.81   97.81   98.18  100.00   99.64   98.09   97.81   98.18   98.91   98.18   98.18   98.54

   114: ABQ52429.1   49.45   49.82   49.45   49.82   57.68   57.30   57.68   57.68   59.62   57.09   56.34   55.97   55.19   55.19   57.25   57.25   57.99   55.56   56.67   56.30   56.30   57.04   56.67   56.30   56.67   56.30   56.67   61.85   62.59   61.85   62.22   61.85   61.85   62.22   62.22   62.96   63.33   62.96   63.70   64.07   30.19   30.19   33.46   33.46   33.20   33.98   33.98   32.82   33.59   33.59   33.59   33.59   33.59   77.66   96.72   96.35   97.81   97.45   97.45   97.45   97.81   97.81   97.81   97.81   97.81   98.18   98.18   97.81   98.54   98.18   97.45   97.45   97.08   97.08   97.45   97.45   97.81   98.18   97.45   97.81   98.18   97.81   97.81   98.18   97.45   97.81   97.81   98.54   98.18   98.18   98.54   97.81   98.54   98.91   99.27   98.91   98.18   98.18   98.18   97.81   98.54   98.18   98.18   98.18   98.18   98.54   97.08   98.18   97.81   98.18   98.18   98.54   99.64  100.00   98.47   98.18   98.54   99.27   98.54   98.54   98.91

   115: ABW95048.1   49.04   49.43   49.04   49.43   58.59   58.20   58.59   58.59   60.00   56.98   56.59   56.20   55.81   55.81   58.08   58.08   58.85   56.15   57.31   56.92   56.92   57.69   57.31   56.92   57.31   56.92   57.31   61.54   62.31   61.54   61.92   61.54   61.54   61.92   61.92   62.69   63.08   62.69   63.46   63.85   29.92   29.92   32.68   32.69   33.20   33.99   33.99   32.81   33.20   33.60   33.60   33.60   33.60   77.39   96.18   95.80   96.95   96.56   97.33   96.95   97.33   97.33   97.33   97.33   97.33   97.71   97.33   96.95   97.71   97.33   97.71   97.71   96.56   97.33   96.95   96.95   97.33   97.33   96.95   96.95   97.33   96.95   97.33   97.33   96.56   96.95   98.09   96.95   96.56   97.33   97.71   96.95   96.95   97.33   97.71   98.09   97.71   97.33   97.33   96.95   97.71   97.33   97.33   97.33   97.33   97.71   97.33   98.09   98.85   98.85   98.85   99.24   98.09   98.47  100.00   98.85   99.24   99.24   99.24   99.24   99.62

   116: AAW81358.1   48.71   49.08   48.71   49.08   57.30   56.93   57.30   57.30   58.87   56.34   55.60   55.22   55.56   55.19   57.25   57.25   57.99   55.19   56.30   55.93   55.93   56.67   56.30   55.93   56.30   55.93   56.30   61.11   61.85   61.11   61.48   61.11   61.11   61.48   61.48   62.22   62.59   62.22   62.96   63.33   30.19   30.19   33.46   33.09   33.59   34.36   34.36   33.20   33.59   33.98   33.98   33.98   33.98   78.02   95.62   95.26   96.72   96.35   97.08   96.72   97.08   97.08   97.08   97.08   97.08   97.45   97.08   96.72   97.45   97.08   97.08   97.08   95.99   96.72   96.35   96.35   96.72   97.08   96.72   96.72   97.08   96.72   96.72   97.08   96.35   96.72   97.45   96.72   96.35   97.08   97.45   96.72   96.72   97.08   97.45   97.81   97.08   97.08   97.08   96.72   97.45   97.08   97.08   97.08   97.08   97.45   96.72   97.81   98.18   98.54   98.54   98.91   97.81   98.18   98.85  100.00   98.91   98.91   98.91   99.64   99.27

   117: AAX51233.1   48.71   49.08   48.71   49.08   57.30   56.93   57.30   57.30   59.25   56.34   55.60   55.22   55.19   55.19   57.62   57.62   58.36   55.19   56.30   55.93   55.93   56.67   56.30   55.93   56.30   55.93   56.30   61.11   61.85   61.11   61.48   61.11   61.11   61.48   61.48   62.22   62.59   62.22   62.96   63.33   29.81   29.81   33.08   32.72   33.20   33.98   33.98   32.82   33.20   33.59   33.59   33.59   33.59   77.66   95.99   95.62   97.08   96.72   97.45   97.08   97.45   97.45   97.45   97.45   97.45   97.81   97.45   97.08   97.81   97.45   97.45   97.45   96.35   97.08   96.72   96.72   97.08   97.45   97.08   97.08   97.45   97.08   97.08   97.45   96.72   97.08   97.81   97.08   96.72   97.45   97.81   97.08   97.08   97.45   97.81   98.18   97.45   97.45   97.45   97.08   97.81   97.45   97.45   97.45   97.45   97.81   97.08   98.18   98.54   98.91   98.91   99.27   98.18   98.54   99.24   98.91  100.00   99.27   99.27   99.27   99.64

   118: ABF47914.1   49.45   49.82   49.45   49.82   57.68   57.30   57.68   57.68   59.62   56.72   55.97   55.60   55.56   55.56   57.99   57.99   58.74   55.56   56.67   56.30   56.30   57.04   56.67   56.30   56.67   56.30   56.67   61.48   62.22   61.48   61.85   61.48   61.48   61.85   61.85   62.59   62.96   62.59   63.33   63.70   29.81   29.81   33.08   33.09   33.59   34.36   34.36   33.20   33.59   33.98   33.98   33.98   33.98   78.02   96.72   96.35   97.81   97.45   97.45   97.08   97.45   97.45   97.45   97.45   97.45   97.81   98.18   97.81   98.54   98.18   98.18   97.45   97.08   97.08   97.45   97.45   97.81   98.18   97.81   97.81   98.18   97.08   97.08   97.45   96.72   97.08   97.81   97.81   97.45   98.18   98.54   97.08   97.81   98.18   98.54   98.18   97.45   97.45   97.45   97.08   97.81   97.45   97.45   97.45   97.45   97.81   97.08   98.18   98.54   98.91   98.91   99.27   98.91   99.27   99.24   98.91   99.27  100.00   99.27   99.27   99.64

   119: ACX31142.1   48.71   49.08   48.71   49.08   57.30   56.93   57.30   57.30   59.25   56.34   55.60   55.22   55.19   55.19   57.62   57.62   58.36   55.19   56.30   55.93   55.93   56.67   56.30   55.93   56.30   55.93   56.30   61.11   61.85   61.11   61.48   61.11   61.11   61.48   61.48   62.22   62.59   62.22   62.96   63.33   29.81   29.81   33.46   33.09   33.59   34.36   34.36   33.20   33.59   33.98   33.98   33.98   33.98   77.66   95.99   95.62   97.08   96.72   97.45   97.08   97.45   97.45   97.45   97.45   97.45   97.81   97.45   97.08   97.81   97.45   97.45   97.45   96.35   97.08   96.72   96.72   97.08   97.45   97.08   97.08   97.45   97.08   97.08   97.45   96.72   97.08   97.81   97.08   96.72   97.45   97.81   97.08   97.08   97.45   97.81   98.18   97.45   97.45   97.45   97.08   97.81   97.45   97.45   97.45   97.45   97.81   97.08   98.18   98.54   98.91   98.91   99.27   98.18   98.54   99.24   98.91   99.27   99.27  100.00   99.27   99.64

   120: AEO44980.1   48.71   49.08   48.71   49.08   57.30   56.93   57.30   57.30   59.25   56.34   55.60   55.22   55.19   55.19   57.62   57.62   58.36   55.19   56.30   55.93   55.93   56.67   56.30   55.93   56.30   55.93   56.30   61.11   61.85   61.11   61.48   61.11   61.11   61.48   61.48   62.22   62.59   62.22   62.96   63.33   30.19   30.19   33.46   33.09   33.59   34.36   34.36   33.20   33.59   33.98   33.98   33.98   33.98   77.66   95.99   95.62   97.08   96.72   97.45   97.08   97.45   97.45   97.45   97.45   97.45   97.81   97.45   97.08   97.81   97.45   97.45   97.45   96.35   97.08   96.72   96.72   97.08   97.45   97.08   97.08   97.45   97.08   97.08   97.45   96.72   97.08   97.81   97.08   96.72   97.45   97.81   97.08   97.08   97.45   97.81   98.18   97.45   97.45   97.45   97.08   97.81   97.45   97.45   97.45   97.45   97.81   97.08   98.18   98.54   98.91   98.91   99.27   98.18   98.54   99.24   99.64   99.27   99.27   99.27  100.00   99.64

   121: CAK50801.1   49.08   49.45   49.08   49.45   57.68   57.30   57.68   57.68   59.62   56.72   55.97   55.60   55.56   55.56   57.99   57.99   58.74   55.56   56.67   56.30   56.30   57.04   56.67   56.30   56.67   56.30   56.67   61.48   62.22   61.48   61.85   61.48   61.48   61.85   61.85   62.59   62.96   62.59   63.33   63.70   29.81   29.81   33.46   33.09   33.59   34.36   34.36   33.20   33.59   33.98   33.98   33.98   33.98   78.02   96.35   95.99   97.45   97.08   97.81   97.45   97.81   97.81   97.81   97.81   97.81   98.18   97.81   97.45   98.18   97.81   97.81   97.81   96.72   97.45   97.08   97.08   97.45   97.81   97.45   97.45   97.81   97.45   97.45   97.81   97.08   97.45   98.18   97.45   97.08   97.81   98.18   97.45   97.45   97.81   98.18   98.54   97.81   97.81   97.81   97.45   98.18   97.81   97.81   97.81   97.81   98.18   97.45   98.54   98.91   99.27   99.27   99.64   98.54   98.91   99.62   99.27   99.64   99.64   99.64   99.64  100.00

 

CLUSTAL O(1.2.4) multiple sequence alignment

 

 

ABF47919.1      ------------------MKLLKILS-LVCL---SISIGACAEHSMSRAKTSTIPQVNNS

ABO33299.1      ------------------MKLLKILS-LVCL---SISIGACAEHSMSRAKTSTIPQVNNS

ADK34116.1      ------------------MKLLKILS-LVCL---SISIGACAEHSMSRAKTSTIPQVNNS

AAW57529.1      ------------------MKLLKILS-LVCL---SISIGACAEHSMSRAKTSTIPQVNNS

AGK07370.1      --------------MKFKMKG-LFYV-I-LS---SLAFSGCVYDSKLQ-----RP--VIS

AFM55000.1      --------------MKFKMKG-LFCV-I-LS---SLAFSGCVYDSKLQ-----RP--VIS

AFM55002.1      --------------MKFKMKG-LFCV-I-LS---SLAFSGCVYDSKLQ-----RP--VIS

AFM55001.1      --------------MKFKMKG-LFCV-I-LS---SLAFSGCVYDSKLQ-----RP--VIS

ADM47435.1      ------------------MKILIFLP-L-LS---CLGLTACSLPVSSL-----PSQSIST

AGI65307.1      ------------------MKILILWP-L-LS---YLSLTACSFPVSNS-----PSQITST

AFH36331.1      ------------------MKTLILLP-L-LS---CLSLTACSLPVSNS-----SSQITST

AFH36330.1      ------------------MKTLILLP-L-LS---CLSLTACSLPVSNS-----SSQITST

AEV91554.1      ----------------MKLSKLYTLTVLIGF---GLSGVACQHIHT--PV---SFNQIEN

AEV91553.1      ----------------MKLSKLYTLTVLIGF---GLSGVACQHIHT--PV---SFNQIEN

AEV91551.1      ------------------MKT-LQSGLIALI---TTFGSACTTISPSVET---AKNQQQQ

CCW28916.1      ------------------MKT-LQLALIALI---TTFGSACTTISPSVET---AKNHQQQ

AEV91550.1      ------------------MKT-LQLALIALI---TTFGSACTTIPPSVET---AKNHQQQ

ACE63186.1      ------------------MNKYFTCYVVA-----SLFFSGCTVQHNLINE---TQSQIVQ

ACI28281.1      ------------------MNKYFTCYVVA-----SLFLSGCTVQHNLINE---TPSQIVQ

AAP40270.1      ------------------MNKYFTCYVVA-----SLFLSGCTVQHNLINE---TPSQIVQ

AFN65709.1      ------------------MNKYFTCYVVA-----SLFLSGCTVQHNLINE---TPSQIVQ

ADK35869.1      ------------------MNKYFTCYVVA-----SLFLSGCTVQHNLINE---TPSQIVQ

ADK35875.1      ------------------MNKYFTCYVVA-----SLFLSGCTVQHNLINE---TPSQIVQ

AEP43731.1      ------------------MNKYFTCYVVA-----SLFLSGCTVQHNLINE---TPSQIVQ

CAB69042.1      ------------------MNKYFTCYVVA-----SLFLSGCTVQHNLINE---TPSQIVQ

AAW22056.1      ------------------MNKYFTCYVVA-----SLFLSGCTVQHNLINE---TPSQIVQ

AAG35609.2      ------------------MNKYFTCYVVA-----SLFLSGCTVQHNLINE---TPSQIVQ

AAG35607.1      ------------------MKKFILPIFSISI---LVSLSACSSIKTKSED---NFHISSQ

ABP87779.2      ------------------MKKFILPIFSISI---LVSLSACSSIKTKSED---NFHISSQ

CAQ51348.1      ------------------MKKFILPIFSISI---LVSLSACSSIKTKSED---NFHISSQ

AAG35608.1      ------------------MKKFILPIFSISI---LVSLSACSSIKTKSED---NFHISSQ

ADB28891.1      ------------------MKKFILPIFSISI---LVSLSACSSIKTKSED---NFHISSQ

AFK28473.1      ------------------MKKFILPIFSISI---LVSLSACSSIKTKSED---NFHISSQ

CAB92323.2      ------------------MKKFILPIFSISI---LVSLSACSSIKTKSED---NFHISSQ

AAM34291.1      ------------------MKKFILPIFSISI---LVSLSACSSIKTKSED---NFHISSQ

AFG29918.1      ------------------MKKFILPILSIST---LLSVSACSSIQTKFED---TFHTSNQ

ACX70402.1      ------------------MKKFILPILSIST---LLSVSACSSIQTKFED---TFHTSNQ

ADK92148.1      ------------------MKKFILPIFSISI---LLSLSACSSIQTKFED---TFHISNQ

AGK07369.1      ------------------MKKFILPIFSIST---LLSLSACSTIQNKFEK---TSDISDQ

AGK07368.1      ------------------MKKFILPIFSISI---LLSLSACSSIQTKFED---TSDISDQ

ALA99185.1      MNTIISRRWRAGLWRRL-VGAVVLPATLA-------ATPAAY---AADVP---KAAPGRI

AAR32134.1      MNTIISRRWRAGLWRRL-VGAVVLPATLA-------ATPAAY---AADVP---KAALGRI

AID67109.1      -----------------------------------MKTFAAYVIIACLSS---TALAGSI

AAR03105.1      --------MNKGLHRKRLSKRLLLPMLLCLLAQQTQAVAAEQTKVSDVCS---EVTAEGW

AAR89917.1      ---------------------------MRVL-----ALSAVLVVASIVGM---PAMANEW

AEP16366.1      ---------------------------MRVL-----ALSAVFLVASIIGM---PAVAKEW

AGD91915.1      ---------------------------MRVL-----ALSAVFLVASIIGM---PAVAKEW

AFC95894.1      ---------------------------MRVL-----ALSAVFLVASIIGM---PAVAKEW

AFU91598.1      ---------------------------MRVL-----ALSAVFLVASIIGM---PAVAKEW

ADG27454.1      ---------------------------MRVL-----ALSAVFLVASIIGM---PAVAKEW

AGC60012.1      ---------------------------MRVL-----ALSAVFLVASIIGM---PAVAKEW

AGC60013.1      ---------------------------MRVL-----ALSAVFLVASIIGM---PAVAKEW

AAP70012.1      ---------------------------MRVL-----ALSAVFLVASIIGM---PAVAKEW

AEV91552.1      ----------------MYKKALIVAT-------SILFLSACSSNMVKQHQI--HSISA-N

AAZ78361.1      ----------------MNIKTLLLIT-------STIFISACSPYIVTANPN--HSTSKSD

ABC84263.1      ----------------MNIKTLLLIT-------STIFISACSPYIVTANPN--HSTSKSD

CAJ77817.2      ----------------MNIKALLLIT-------STIFISACSPYIVTANPN--HSTSKSD

ABF50983.1      ----------------MNIKALLLIT-------STIFISACSPYIVTANPN--HSTSKSD

CCJ32595.1      ----------------MNIKALLLIT-------SAIFISACSPYIVTANPN--HSASKSD

CCJ32598.1      ----------------MNIKALLLIT-------SAIFISACSPYIVTANPN--HSASKSD

ABV31690.1      ----------------MNIKALLLIT-------SAIFISACSPYIVTANPN--HSASKSD

CCJ32596.1      ----------------MNIKALLLIT-------SAIFISACSPYIVTANPN--HSASKSD

ABC61637.1      ----------------MNIKALLLIT-------SAIFISACSPYIVTANPN--HSASKSD

ABV31687.1      ----------------MNIKALLLIT-------SAIFISACSPYIVTANPN--HSASKSD

ABV31692.1      ----------------MNIKALLLIT-------SAIFISACSPYIVTANPN--HSASKSD

AAW81340.1      ----------------MNIKALLLIT-------SAIFISACSPYIVTANPN--HSASKSD

CCA94644.1      ----------------MNIKALLLIT-------SAIFISACSPYIVTANPN--HSASKSD

ACX31140.1      ----------------MNIKALLLIT-------SAIFISACSPYIVTANPN--HSASKSD

ABV31686.1      ----------------MNIKALLLIT-------SAIFISACSPYIVTANPN--HSASKSD

AAW81341.1      ----------------MNIKALLLIT-------SAIFISACSPYIVTANPN--HSASKSD

ABV31691.1      ----------------MNIKTLLLIT-------SAIFISACSPYIVSANPN--HSASKSD

AFO55202.1      ----------------MNIKTLLLIT-------SAIFISACSPYIVTANPN--HSASKSD

ABI53716.1      ----------------MNIKTLLLIT-------SAIFISACSPYIVTANPN--HSASKSD

AEL88491.1      ----------------MNIKTLLLIT-------SAIFISACSPYIVTANPN--HSASKSD

ACD84990.1      ----------------MNIKTLLLIT-------SAIFISACSPYIVTANPN--HSASKSD

AEL17179.1      ----------------MNIKTLLLIT-------SAIFISACSPYIVTANPN--HSASKSD

CAC83905.2      ----------------MNIKTLLLIT-------SAIFISACSPYIVTANPN--HSASKSD

AAW81336.1      ----------------MNIKALLLIT-------SAIFISACSPYIVTANPN--HSASKSD

AFO55201.1      ----------------MNIKALLLIT-------SAIFISACSPYIVIANPN--HSASKSD

ABW70410.1      ----------------MNIKALLLIT-------SAIFISACSPYIVTANPN--HSASKSD

AAW81342.1      ----------------MNIKALLLIT-------SAIFISACSPYIVTANPN--HSASKSD

ABS71123.1      ----------------MNIKALLLIT-------SAIFISACSPYIVTANPN--HSASKSD

ACD45467.1      ----------------MNIKTLLLIT-------SAIFISACSPYIVTANPN--HSASKSD

ABV71248.1      ----------------MNIKALLLIT-------SAIFISACSPYIVTANPN--HSASKSD

AEB98923.1      ----------------MNIKALFLIT-------SAIFISACSPYIVTANPN--HSASKSD

AEB98920.1      ----------------MNIKALFLIT-------SAIFISACSPYIVTANPN--HSASKSD

ABF47917.1      ----------------MNIQALLLIT-------SAIFISACSPYIVSANPN--HSASKSD

ACD84988.1      ----------------MNIKALLLIT-------SAIFISACSPYIVTTNPN--HSASKSD

ABV31688.1      ----------------MNIKALLLIT-------SAIFISACSPYIVTTNPN--HSASKSD

CCA94649.1      ----------------MNIKALLLIT-------SAISISACSPYIVTANPN--HSASKSD

ADM26745.1      ----------------MNIKALLLIT-------SAIFISACSPYIVTANPN--HSASKSD

ADI58616.1      ----------------MNIKALLLIT-------SAIFISACSPYIVTANPN--HSASKSD

ADX07745.1      ----------------MNIKALLLIT-------SAIFISACSPYIVTANPN--HSASKSD

ABF47918.1      ----------------MNIKALFLIT-------SAIFISACSPYIVTANPN--HSASKSD

CAJ77809.1      ----------------MNIKALLLIT-------SAIFISACSPYIVTANPN--HSASKSD

AAW81337.1      ----------------MNIKALLLIT-------SAIFISACSPYIVTANPN--HSASKSD

AAX51234.1      ----------------MNIKALLLIT-------SAIFISACSPYIVTANPN--HSASKSD

ABC26007.1      ----------------MNIKALLLIT-------SAIFISACSPYIVTANPN--HSASKSD

ABV71246.1      ----------------MNIKALLLIT-------SAIFISACSPYIVTANPN--HSASKSD

ABC26006.1      ----------------MNIKALLLIT-------SAIFISACSPYIVTANPN--HSASKSD

ABD48715.1      ----------------MNIKALLLIT-------SAIFISACSPYIVTANPN--HSASKSD

BAL15076.1      ----------------MNIKALLLIT-------SAIFISACSPYIVTANPN--HSASKSD

ABV31689.1      ----------------MNIKALLLIT-------SAIFISACSPYIVTANPN--HSASKSD

BAN10684.1      ----------------MNIKALLLIT-------SAIFISACSPYIVTANPN--HSASKSD

ABV71247.1      ----------------MNIKALLLIT-------SAIFISACSPYIVTANPN--HSASKSD

AAW81338.1      ----------------MNIKALLLIT-------SAIFISACSPYIVTANPN--HSASKSD

AAW51373.1      ----------------MNIQALLLIT-------SAIFISACSPYIVTANPN--YSASKSD

ABF47916.1      ----------------MNIKALLLIT-------STIFISACSPYIVTANPN--HSASKSD

ABE03012.1      ----------------MNIKTLLLIT-------SAIFISACSHYIVSANPN--HSASKSD

ABY77907.1      ----------------MNIKALLLIT-------SAIFISACSPYIVSANPN--HSASKSD

ACY56711.1      ----------------MNIKALLLIT-------SAIFISACSPYIVSANPN--HSASKSD

AAW81339.1      ----------------MNIKALLLIT-------SAIFISACSPYIVSANPN--HSASKSD

ADX07748.1      ----------------MNIKALLLIT-------SAIFISACSPYIVTANPN--HSASKSD

ABQ52429.1      ----------------MNIKALLLIT-------SAIFISACSPYIVTANPN--HSASKSD

ABW95048.1      ----------------------LLIT-------SAIFISACSPYIVSANPN--HSASKSD

AAW81358.1      ----------------MNIKALLLIT-------SAIFISACSPYIVSANPN--HSASKSD

AAX51233.1      ----------------MNIKALLLIT-------SAIFISACSPYIVSANPN--HSASKSD

ABF47914.1      ----------------MNIKALLLIT-------SAIFISACSPYIVSANPN--HSASKSD

ACX31142.1      ----------------MNIKALLLIT-------SAIFISACSPYIVSANPN--HSASKSD

AEO44980.1      ----------------MNIKALLLIT-------SAIFISACSPYIVSANPN--HSASKSD

CAK50801.1      ----------------MNIKALLLIT-------SAIFISACSPYIVSANPN--HSASKSD

                                                       .                   

 

ABF47919.1      IIDQNVQALFNEISADAVFVTYDGQNIKKYGTHLDRAKTAYIPASTFKIANALIGLENHK

ABO33299.1      IIDQNVQALFNEISGDAVFVTYDGQNIKKYGTHLDRAKTAYIPASTFKIANALIGLENHK

ADK34116.1      IIDQNVQALFNEISADAVFVTYDGQNIKKYGTHLDRAKTAYIPASTFKIANALIGLENHK

AAW57529.1      IIDQNVQALFNEISADAVFVTYDGQNIKKYGTHLDRAKTAYIPASTFKIANALIGLENHK

AGK07370.1      ERETEIPLLFNQAQTQAVFVTYDGIHLKSYGNDLSRAKTEYIPASTFKMLNALIGLQNAK

AFM55000.1      ERETEIPLLFDQAQTQAVFVTYDGIHLKSYGNDLSRAKTEYIPASTFKMLNALIGLQNAK

AFM55002.1      ERETEIPLLFNQAQTQAVFVTYDGIHLKSYGNDLSRAKTEYIPASTFKMLNALIGLQNGK

AFM55001.1      ERVTEIPLLFNQAQTQAVFVTYDGIHLKSYGNDLSRAKTEYIPASTFKMLNALIGLQNAK

ADM47435.1      ---QAIASLFDQAQSSGVLVIQRDQQVQVYGNDLNRANTEYVPASTFKMLNALIGLQHGK

AGI65307.1      QSIQAIAKLFDQAQSSGVLVIQRGPHLQVYGNDLSRAHTEYVPASTFKIFNALIGLQHGK

AFH36331.1      QSIQTIAKLFDQAQSSGVLVIQRGPHLQVYGNDLSRAHTEYIPASTFKILNALIGLQHGK

AFH36330.1      QSIQTIAKLFDQAQSSGVLVIQRGPHLQVYGNDLSRAHTEYIPASTFKILNALIGLQHGK

AEV91554.1      DQTKQIASLFENVQTTGVLITFDGQAYKAYGNDLNRAKTAYIPASTFKILNALIGIEHDK

AEV91553.1      DQTKQIASLFENVQTTGVLITFDGQAYKAYGNDLNRAKTAYIPASTFKILNALIGIEHDK

AEV91551.1      SAQQQIQQAFDQLQTTGVIVVKDKHSLHSYGNDLSRAQTPYIPASTFKMLNALIGLEHGK

CCW28916.1      SAQQQIQQAFDQLQTTGVIVIKDKHGLHSYGNDLSRAQTPYVPASTFKMLNALIGLEHGK

AEV91550.1      SAQQQIQQAFDQLQTTGVIVIKDKHGLHSYGNDLSRAQTPYVPASTFKMLNALIGLEHGK

ACE63186.1      GHNQVIHQYFDEKNTSGVLVIQTDKKINLYGNALSRANTEYVPASTFKMLNALIGLENQK

ACI28281.1      GHNQVIHQYFDEKNTSGVLVIQTDKKINLYGNALSRANTEYVPASTFKMLNALIGLENQK

AAP40270.1      GHNQVIHQYFDEKNTSGVLVIQTDKKINLYGNALSRANTEYVPASTFKMLNALIGLENQK

AFN65709.1      GHNQVIHQYFDEKNTSGVLVIQTDKKINLYGNALSRANTEYVPASTFKMLNALIGLENQK

ADK35869.1      GHNQVIHQYFDEKNTSGVLVIQTDKKINLYGNALSRANTEYVPASTFKMLNALIGLENQK

ADK35875.1      GHNQVIHQYFDEKNTSGVLVIQTDKKINLYGNALSRANTEYVPASTFKMLNALIGLENQK

AEP43731.1      GHNQVIHQYFDEKNTSGVLVIQTDKKINLYGNALSRANTEYVPASTFKMLNALIGLENQK

CAB69042.1      GHNQVIHQYFDEKNTSGVLVIQTDKKINLYGNALSRANTEYVPASTFKMLNALIGLENQK

AAW22056.1      GHNQVIHQYFDEKNTSGVLVIQTDKKINLYGNALSRANTEYVPASTFKMLNALIGLENQK

AAG35609.2      GHNQVIHQYFDEKNTSGVLVIQTDKKINLYGNALSRANTEYVPASTFKMLNALIGLENQK

AAG35607.1      QHEKAIKSYFDEAQTQGVIIIKEGKNLSTYGNALARANKEYVPASTFKMLNALIGLENHK

ABP87779.2      QHEKAIKSYFDEAQTQGVIIIKEGKNLSTYGNALARANKEYVPASTFKMLNALIGLENHK

CAQ51348.1      QHEKAIKSYFDEAQTQGVIIIKEGKNLSTYGNALARANKEYVPASTFKMLIALIGLENHK

AAG35608.1      QHEKAIKSYFDEAQTQGVIIIKEGKNLSTYGNALARANKEYVPASTFKMLNALIGLENHK

ADB28891.1      QHEKAIKSYFDEAQTQGVIIIKEGKNLSTYGNALARANKEYVPASTFKMLNALIGLENHK

AFK28473.1      QHEKAIKSYFDEAQTQGVIIIKEGKNLSTYGNALARANKEYVPASTFKMLNALIGLENHK

CAB92323.2      QHEKAIKSYFDEAQTQGVIIIKEGKNLSTYGNALARANKEYVPASTFKMLNALIGLENHK

AAM34291.1      QHEKAIKSYFDEAQTQGVIIIKEGKNLSTYGNALARANKEYVPASTFKMLNALIGLENHK

AFG29918.1      QHEKAIKSYFDEAQTQGVIIIKKGKNISTYGNNLTRAHTEYVPASTFKMLNALIGLENHK

ACX70402.1      QHEKAIKSYFDEAQTQGVIIIKKGKNISTYGNNLTRAHTEYVPASTFKMLNALIGLENHK

ADK92148.1      KHEKAIKSYFDEAQTQGVIIIKEGKNISSYGNNLVRAHTEYVPASTFKMLNALIGLENHK

AGK07369.1      QHEKAIKSYFDEAQTQGVIIIKEGKNIRIYGNNLVRAHTEYVPASTFKMLNALIGLENHK

AGK07368.1      QQGKAIKSYFDEAQTQGVIIIKEGKNISTYGNNLARAHTEYVPASTFKMLNALIGLENHK

ALA99185.1      TERADWGKLFTAEGVKGTIVVLDARTQTYQAYDAARAEKRMSPASTYKIFNSLLALDSGA

AAR32134.1      TERADWGKLFAAEGVKGTIVVLDARTQTYQAYDAARAEKRMSPASTYKIFNSLLALDSGA

AID67109.1      TENTSWNKEFSAEAVNGVFVLCKSSSKSCATNDLARASKEYLPASTFKIPSAIIGLETGV

AAR03105.1      QEVRRWDKLFESAGVKGSLLLWDQKRSLGLSNNLSRAAEGFIPASTFKLPSSLIALETGA

AAR89917.1      QEKPSWNTHFSEHKAQGVIVLWNENKQQGFTNNLKRANQAFLPASTFKIPNSLIALDLGV

AEP16366.1      QENKSWNAHFTEHKSQGVVVLWNENKQQGFTNNLKRANQAFLPASTFKIPNSLIALDLGV

AGD91915.1      QENKSWNAHFTEHKSQGVVVLWNENKQQGFTNNLKRANQAFLPASTFKIPNSLIALDLGV

AFC95894.1      QENKSWNAHFTEYKSQGVVALWNENKQQGFTNNLKRANQAFLPASTFKIPNSLIALDLGV

AFU91598.1      QENKSWNAHFTEHKSQGVVVLWNENKQQGFTNNLKRANQAFLPASTFKIPNSLIALDLGV

ADG27454.1      QENKSWNAHFTEHKSQGVVVLWNENKQQGFTNNLKRANQAFLPASTFKIPNSLIALDLGV

AGC60012.1      QENKSWNAHFTEHKSQGVVVLWNENKQQGFTNNLKRANQAFLPASTFKIPNSLIALDLGV

AGC60013.1      QENKSWNAHFTEHKSQGVVVLWNENKQQGFTNNLKRANQAFLPASTFKIPNSLIALDLGV

AAP70012.1      QENKSWNAHFTEHKSQGVVVLWNENKQQGFTNNLKRANQAFLPASTFKIPNSLIALDLGV

AEV91552.1      KNSEEIKSLFDQAQTTGVLVIKRGQTEEIYGNDFKRASTDYVPASTFKMLNALIGLEHHK

AAZ78361.1      EKAEKIKNLFNEAHTTGVLVIQQGQTQQSYGNDLARASIEYVPASTFKMLNALIGLEHHK

ABC84263.1      EKAEKIKNLFNEAHTTGVLVIQQGQTQQSYGNDLARASIEYVPASTFKMLNALIGLEHHK

CAJ77817.2      EKAEKIKNLFNEAHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHK

ABF50983.1      EKAEKIKNLFNEAHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHK

CCJ32595.1      DKAEKIKNLFNEAHTTGVLVIHQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHK

CCJ32598.1      DKAEKIKNLFNEAHTTGVLVIHQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHK

ABV31690.1      DKAEKIKNLFNEAHTTGVLVIHQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHK

CCJ32596.1      DKAEKIKNLFNEAHTTGVLVIHQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHK

ABC61637.1      DKAEKIKNLFNEAHTTGVLVIHQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHK

ABV31687.1      DKAEKIKNLFNEAHTTGVLVIHQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHK

ABV31692.1      DKAEKIKNLFNEAHTTGVLVIHQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHK

AAW81340.1      DKAEKIKNLFNEAHTTGVLVIHQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHK

CCA94644.1      DKAEKIKNLFNEAHTTGVLVIHQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHK

ACX31140.1      KKAEKIKNLFNEAHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHK

ABV31686.1      KKAEKIKNLFNEAHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHK

AAW81341.1      KKAEKIKNLFNEAHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHK

ABV31691.1      EKAEKIKNLFNEAHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHK

AFO55202.1      EKAEKIKNLFNEVHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHK

ABI53716.1      EKAEKIKNLFNEVHTTGVLVIRQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHK

AEL88491.1      EKAEKIKNLFNEVHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEYHK

ACD84990.1      EKAEKIKNLFNEVHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHK

AEL17179.1      EKAEKIKNLFNEVHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHK

CAC83905.2      EKAEKIKNLFNEVHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHK

AAW81336.1      EKGEKIKNLFNEAHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHK

AFO55201.1      EKAEKIKNLFNEAHTTGVLVIQQGQTQQSYGNDLAHASTEYVPASTFKMLNALIGLEHHK

ABW70410.1      EKAEKIKNLFNEAHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHK

AAW81342.1      EKAEKIKNLFNEAHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHK

ABS71123.1      VKAEKIKNLFNEAHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHK

ACD45467.1      VKAEKIKNLFNEAHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHK

ABV71248.1      VKAEKIKNLFNEAHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHK

AEB98923.1      VKAEKIKNLFNEAHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHK

AEB98920.1      VKAEKIKNLFNEAHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHK

ABF47917.1      EKAEKIKNLFNEAHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHK

ACD84988.1      EKAEKIKNLFNEAHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHK

ABV31688.1      EKAEKIKNLFNEAHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHK

CCA94649.1      EKAEKIKNLFNEAHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHK

ADM26745.1      EKAEKIKNLFNEAHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHK

ADI58616.1      VKAEKIKNLFNEAHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHK

ADX07745.1      EKAEKIKNLFNEAHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHK

ABF47918.1      EKAEKIKNLFNEAHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHK

CAJ77809.1      EKAEKIKNLFNEAHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHK

AAW81337.1      EKAEKIKNLFNEAHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHK

AAX51234.1      VKAEKIKNLFNEAHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHK

ABC26007.1      VKAEKIKNLFNEAHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHK

ABV71246.1      VKAEKIKNLFNEAHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHK

ABC26006.1      VKAEKIKNLFNEAHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHK

ABD48715.1      KKAEKIKNLFNEAHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHK

BAL15076.1      VKAEKIKNLFNEAHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHK

ABV31689.1      VKAEKIKNLFNEAHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHK

BAN10684.1      VKAEKIKNLFNEAHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHK

ABV71247.1      VKAEKIKNLFNEAHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHK

AAW81338.1      VKAEKIKNLFNEAHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHK

AAW51373.1      EKAEKIKNLFNEAHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHK

ABF47916.1      EKAEKIKNLFNEAHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFKMLNALISLEHHK

ABE03012.1      EKAEKIKNLFNEAHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHK

ABY77907.1      EKAEKIKNLFNEAHTTGVLVIQQGQTQQSYGNVLARASTEYVPASTFKMLNALIGLEHHK

ACY56711.1      EKAEKIKNLFNEAHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHK

AAW81339.1      EKAEKIKNLFNEAHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHK

ADX07748.1      EKAEKIKNLFNEVHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHK

ABQ52429.1      EKAEKIKNLFNEAHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHK

ABW95048.1      EKAEKIKNLFNEAHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHK

AAW81358.1      EKAEKIKNLFNEAHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHK

AAX51233.1      EKAEKIKNLFNEAHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHK

ABF47914.1      EKAEKIKNLFNEAHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHK

ACX31142.1      EKAEKIKNLFNEAHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHK

AEO44980.1      EKAEKIKNLFNEAHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHK

CAK50801.1      EKAEKIKNLFNEAHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHK

                         *      . .                :*     ****:*:  :::.::  

 

ABF47919.1      AT-STEIFKWDGKPRFFKAWDKDFTLGEAMQASTVPVYQELARRIGPSLMQSELQRIGYG

ABO33299.1      AT-STEIFKWDGKPRFFKAWDKDFTLGEAMQASTVPVYQELARRIGPSLMQSELQRIGYG

ADK34116.1      AT-STEIFKWDGKPRFLKAWDKDFTLGEAMQASTVPVYQELARRIGPSLMQSELQRIGYG

AAW57529.1      AT-STEIFKWDGKPRFFKAWDKDFTLGEAMQASTVPVYQELARRIGPSLMQSELQRIGYG

AGK07370.1      AT-NTEVFHWNGEKRAFSAWEKDMTLAEAMQASAVPVYQELARRIGLELMREEVKRVGFG

AFM55000.1      AT-NTEVFHWNGEKRAFSAWEKDMTLAEAMQASAVPVYQELARRIGLELMREEVKRVGFG

AFM55002.1      AT-NTEVFQWNGEKRAFSAWEKDMTLAEAMQASAVPVYQELARRIGLELMREEVKRVGFG

AFM55001.1      AT-NTEVFHWNGEKRAFSAWEKDMTLAEAMQASAVPVYQELARRIGLELMREEVKRVGFG

ADM47435.1      AT-TNEIFKWDGKKRSFTAWEKDMTLGQAMQASAVPVYQELARRIGLELMQQEVQRIQFG

AGI65307.1      AT-TNEIFKWDGKKRSFAAWEKDMTLGQAMQASAVPVYQELARRIGLELMEQEVRRIQFG

AFH36331.1      AT-TNEIFKWDGKKRSFAAWEKDMTLGQAMQASAVPVYQELARRIGLELMQQEVQRIRFG

AFH36330.1      AT-TNEIFKWDGKKRSFAAWEKDMTLGQAMQASAVPVYQELARRIGLELMQQEVQRIRFG

AEV91554.1      TS-PNEVFKWDGQKRAFESWEKDLTLAEAMQASAVPVYQALAQRIGLDLMAKEVKRVGFG

AEV91553.1      TS-PNEVFKWDGQKRAFESWEKDLTLAEAMQASAVPVYQALAQRIGLDLMAKEVKRVGFG

AEV91551.1      AT-STEVFKWDGQKRSFPTWEKDMTLGQAMQASAVPVYQELARRIGLDLMKKEVQRIGYG

CCW28916.1      AT-RTEVFKWDGQKRSFPAWEKDMTLGQAMQASAVPVYQELARRIGVDLMQKEVQRIGYG

AEV91550.1      AT-STEVFKWDGQKRSFPAWEKDMTLGQAMQASAVPVYQELARRIGLDLMKKEVQRIGYG

ACE63186.1      TD-INEIFKWKGEKRSFTTWEKDMTLGEAMKLSAVPVYQELARRIGLDLMQKEVERIDFG

ACI28281.1      TD-INEIFKWKGEKRSFTAWEKDMTLGEAMKLSAVPVYQELARRIGLDLMQKEVKRIGFG

AAP40270.1      TD-INEIFKWKGEKRSFTAWEKDMTLGEAMKLSAVPVYQELARRIGLDLMQKEVERIGFG

AFN65709.1      TD-INEIFKWKGEKRLFTAWEKDMTLGEAMKLSAVPVYQELARRIGLDLMQKEVKRIGFG

ADK35869.1      TD-INEIFKWKGEKRSFTAWEKDMTLGEAMKLSAVPVYQELARRIGLDLMQKEVKRIGFG

ADK35875.1      TD-INEIFKWKGEKRSFTAWEKDMTLGEAMKLSAVPVYQELARRIGLDLMQKEVKRIGFG

AEP43731.1      TD-INEIFKWKGEKRSFTAWEKDMTLGEAMKLSAVPVYQELARRIGLDLMQKEVKRIGFG

CAB69042.1      TD-INEIFKWKGEKRSFTAWEKDMTLGEAMKLSAVPVYQELARRIGLDLMQKEVKRIGFG

AAW22056.1      TD-INEIFKWKGEKRSFTAWEKDMTLGEAMKLSAVPVYQELARRIGLDLMQKEVKRIGFG

AAG35609.2      AD-INEIFKWKGEKRSFTAWEKDMTLGEAMKLSAVPVYQELARRIGLDLMQKEVKRIGFG

AAG35607.1      AT-TNEIFKWDGKKRTYPMWEKDMTLGEAMALSAVPVYQELARRTGLELMQKEVKRVNFG

ABP87779.2      AT-TNEIFKWDGKKRTYPMWEKDMTLGEAMALSAVPVYQELARRTGLELMQKEVKRVNFG

CAQ51348.1      AT-TNEIFKWDGKKRTYPMWEKDMTLGEAMALSAVPVYQELARRTGLELMQKEVKRVNFG

AAG35608.1      AT-TNEIFKWDGKKRTYPMWEKDMTLGEAMALSAVPVYQELARRTGLELMQKEVKRVNFG

ADB28891.1      AT-TNEIFKWDGKKRTYPMWEKDMTLGEAMALSAVPVYQELARRTGLELMQKEVKRVNFG

AFK28473.1      AT-TNEIFKWDGKKRTYPMWEKDMTLGEAMALSAVPVYQELARRTGLELMQKEVKRVNFG

CAB92323.2      AT-TNEIFKWDGKKRTYPMWEKDMTLGEAMALSAVPVYQELARRTGLELMQKEVKRVNFG

AAM34291.1      AT-TNEIFKWDGKKRTYPMWEKDMTLGEAMALSAVPVYQELARRTGLELMQKEVKRVNFG

AFG29918.1      AT-TTEIFKWDGKKRSYPMWEKDMTLGDAMALSAVPVYQELARRTGLDLMQKEVKRVGFG

ACX70402.1      AT-TTEIFKWDGKKRSYPMWEKDMTLGDAMALSAVPVYQELARRTGLDLMQKEVKRVGFG

ADK92148.1      AT-TNEIFKWDGKKRSYPMWEKDMTLGEAMALSAVPVYQDLARRIGLNLMQKEVKRVGFG

AGK07369.1      AT-TTEIFKWDGKKRSYPMWEKDMTLGDAMALSAVPVYQELARRTGLDLMQKEVKRVGFG

AGK07368.1      AT-TTEIFKWDGKKRSYPMWEKDMTLGDAMALSAVPVYQELARRTGLDLMQKEVKRVGFG

ALA99185.1      LDNERAIIPWDGKPRRIKNWNAAMDLRTAFRVSCLPCYQVVSHKIGRRYAQAKLNEVGYG

AAR32134.1      LDNERAIIPWDGKPRRIKNWNAAMDLRTAFRVSCLPCYQVVSHKIGRRYAQAKLNEVGYG

AID67109.1      IKNEHQVFKWDGKPRAMKQWERDLTLRGAIQVSAFPVFQQIAREVGEVRMQKYLKKFSYG

AAR03105.1      VRDETSRFSWDGKVREIAVWNRDQSFRTAMKYSVVPVYQQLAREIGPKVMAAMVRQLEYG

AAR89917.1      VKDEHQVFKWDGQTRDIAAWNRDHDLITAMKYSVVPVYQEFARQIGQARMSKMLHAFDYG

AEP16366.1      VKDEHQVFKWDGQTRDIAAWNRDHDLITAMKYSVVPVYQEFARQIGEARMSKMLHAFDYG

AGD91915.1      VKDEHQVFKWDGQTRDIAAWNRDHDLITAMKYSVVPVYQEFARQIGEARMSKMLHAFDYG

AFC95894.1      VKDEHQVFKWDGQTRDIATWNRDHNLITAMKYSVVPVYQEFARQIGEARMSKMLHAFDYG

AFU91598.1      VKDEHQVFKWDGHRRDIATWNRDHNLITAMKYSVVPVYQEFARQIGEARMSKMLHAFDYG

ADG27454.1      VKDEHQVFKWDGQTRDIATWNRDHNLITAMKYSVVPVYQEFARQIGEARMSKMLHAFDYG

AGC60012.1      VKDEHQVFKWDGQTRDIATWNRDHNLITAMKYSVVPVYQEFARQIGEARMSKMLHAFDYG

AGC60013.1      VKDEHQVFKWDGQTRDIATWNRDHNLITAMKYSVVPVYQYFARQIGEARMSKMLHAFDYG

AAP70012.1      VKDEHQVFKWDGQTRDIATWNRDHNLITAMKYSVVPVYQEFARQIGEARMSKMLHAFDYG

AEV91552.1      AT-TTEVFKWNGQKRLFPDWEKDMTLGDAMKASAIPVYQELARRIGLDLMSKEVKRVGFG

AAZ78361.1      AT-TTEIFKWDGQKRLFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSKEVKRVGYG

ABC84263.1      AT-TTEIFKWDGQKRLFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSKEVKRVGYG

CAJ77817.2      AT-TTEIFKWDGQKRLFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSKEVKRVGYG

ABF50983.1      AT-TTEIFKWDGQKRLFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSKEVKRVGYG

CCJ32595.1      AT-TTEIFKWDGQKRLFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSKEVKRVGYG

CCJ32598.1      AT-TTEVFKWDGEKRLFPEWEKNMTLGDAMKASAILVYQDLARRIGLELMSKEVKRVGYG

ABV31690.1      AT-TTEVFKWDGEKRLFPEWEKNMTLGDAMKASALPVYQDLARRIGLELMSKEVKRVGYG

CCJ32596.1      AT-TTEVFKWDGEKRLFPEWEKNMTLGDAMKASAMPVYQDLARRIGLELMSKEVKRVGYG

ABC61637.1      AT-TTEVFKWDGEKRLFPEWEKNMTLGDAMKASAIPVYQDLARRIGLELMSKEVKRVGYG

ABV31687.1      AT-TTEVFKWDGEKRLFPEWEKNMTLGDAMKASAIPVYQDLARRIGLELMSKEVKRVGYG

ABV31692.1      AT-TTEVFKWDGEKRLFPEWEKNMTLGDAMKASAIPVYQDLARRIGLELMSKEVKRVGYG

AAW81340.1      AT-TTEVFKWDGEKRLFPEWEKNMTLGDAMKASAIPVYQDLARRIGLELMSKEVKRVGYG

CCA94644.1      AT-TTEVFKWNGQKRLFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSNEVKRVGYG

ACX31140.1      AS-TTEVFKWNGQKRLFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSNEVKRVGYG

ABV31686.1      AT-TTEVFKWNGQKRLFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSNEVKRVGYG

AAW81341.1      AT-TTEVFKWNGQKRLFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSNEVKRVGYG

ABV31691.1      AT-TTEVFKWDGQKRLFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSKEVKRVGYG

AFO55202.1      AT-TTEVFKWDGQKRLFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSKEVKRVGYG

ABI53716.1      AT-TTEVFKWDGQKRLFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSKEVKRVGYG

AEL88491.1      AT-TTEVFKWDGQKRLFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSKEVKRVGYG

ACD84990.1      AT-TTEVFKWDGQKRLFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSKEVKRVGYG

AEL17179.1      AT-TTEVFKWDGQKRLFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSKEVKRVGYG

CAC83905.2      AT-TTEVFKWDGQKRLFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSKEVKRVGYG

AAW81336.1      AT-TTEVFKWDGQKRLFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSKEVKRVGYG

AFO55201.1      TT-TTEVFKWDGQKRLFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSKEVKRVGYG

ABW70410.1      TT-TTEVFKWDGQKRLFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSKEVKRVGYG

AAW81342.1      TT-TTEVFKWDGQKRLFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSKEVKRVGYG

ABS71123.1      AT-TTEVFKWDGKKRLFPEWEKDMTLGDAMKASAILVYQDLARRIGLELMSKEVKRVGYG

ACD45467.1      AT-TTEVFKWDGKKRLFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSKEVKRVGYG

ABV71248.1      AT-TTEVFKWDGKKRLFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSKEVKRVGYG

AEB98923.1      AT-TTEVFKWDGKKRLFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSKEVKRVGYG

AEB98920.1      AT-TTEVFKWDGKKRLFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSKEVKRVGYG

ABF47917.1      AT-TTEVFKWDGKKRLFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSKEVKRVGYG

ACD84988.1      AT-TTEVFKWDGKKRLFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSKEVKRVGYG

ABV31688.1      AT-TTEVFKWDGKKRLFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSKEVKRVGYG

CCA94649.1      AT-TTEVFKWDGQKRLFPEWEKDMTLGDAIKASAIPVYQDLARRIGLELMSKEVKRVGYG

ADM26745.1      AT-TTEVFKWDGQKRLFPEWEKDMTLGDAIKASAIPVYQDLARRIGLELMSKEVKRVGYG

ADI58616.1      AT-TTEVFKWDGKKRLFPEWEKDMTLGDAMKASAVPVYQDLARRIGLELMSKEVKRVGYG

ADX07745.1      AT-TTEVFKWDGKKRLFPEWEKDMTLGDAMKASAILVYQDLARRIGLELMSKEVKRVGYG

ABF47918.1      AT-TTEVFKWDGKKRLFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSKEVKRVGYG

CAJ77809.1      AT-TTEVFKWDGKKRLFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSKEVKRVGYG

AAW81337.1      AT-TTEVFKWDGKKRLFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSKEVKRVGYG

AAX51234.1      AT-TTEVFKWDGKKRLFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSKEVKRVGYG

ABC26007.1      AT-TTEVFKWDGKKRLFPEWEKDMTLGDAMKASALPVYQDLARRIGLELMSKEVKRVGYG

ABV71246.1      AT-TTEVFKWDGKKRLFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSKEVKRVGYG

ABC26006.1      AT-TTEVFKWDGKKRLFPEWEKDMTLGDAMKASAISVYQDLARRIGLELMSKEVKRVGYG

ABD48715.1      AT-TTEVFKWDGKKRLFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSKEVKRVGYG

BAL15076.1      AT-TTEVFKWDGKKRLFPEWEKDMTLGDAMKASAISVYQDLARRIGLELMSKEVKRVGYG

ABV31689.1      AT-TTEVFKWDGKKRLFPEWEKDMTLGDAMKASAIQVYQDLARRIGLELMSKEVKRVGYG

BAN10684.1      AT-TTEVFKWDGKKRLFPEWEKDMTLGDAMKASAITVYQDLARRIGLELMSKEVKRVGYG

ABV71247.1      AT-TTEVFKWDGKKRLFPEWEKDMTLGDAMKASAILVYQDLARRIGLELMSKEVKRVGYG

AAW81338.1      AT-TTEVFKWDGKKRLFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSKEVKRVGYG

AAW51373.1      AT-TTEVFKWDGQKRLFPEWEKNMTLGDAMKASAIPVYQDLARRIGLELMSNEVKRIGYG

ABF47916.1      AT-TTEVFKWDGQKRLFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSNEVKRVGYG

ABE03012.1      AT-TTEVFKWDGQKRLFPEWEKNMTLGDAMKASAIPVYQDLARRIGLELMSNEVKRVGYG

ABY77907.1      AT-TTEVFKWDGQKRLFPEWEKNMTLGDAMKASAIPVYQDLARRIGLELMSNEVKRVGYG

ACY56711.1      AT-TTEVFKWDGQKRLFPEWEKNMTLGDAMKASAIPVYQDLARRIGLELMSNEVKRVGYG

AAW81339.1      AT-TTEVFKWDGQKRLFPEWEKNMTLGDAMKASAIPVYQDLARRIGLELMSNEVKRVGYG

ADX07748.1      AT-TTEVFKWDGKKRLFPEWEKNMTLGDAMKASAIPVYQDLARRIGLELMSNEVKRVGYG

ABQ52429.1      AT-TTEVFKWDGKKRLFPEWEKNMTLGDAMKASAIPVYQDLARRIGLELMSNEVKRVGYG

ABW95048.1      AT-TTEVFKWDGQKRLFPEWEKNMTLGDAMKASAIPVYQDLARRIGLELMSNEVKRVGYG

AAW81358.1      AT-TTAVFKWDGQKRLFPEWEKNMTLGDAMKASAIPVYQDLARRIGLELMSNEVKRVGYG

AAX51233.1      AT-TTEVFKWDGQKRLFPEWEKNMTLGDAMKASAIPVYQDLPRRIGLELMSNEVKRVGYG

ABF47914.1      AT-TTEVFKWDGQKRLFPEWEKNMTLGDAMKASAIPVYQDLARRIGLELMSNEVKRVGYG

ACX31142.1      AT-TTEVFKWDGQKRLFPEWEKNMTLGDAMKASAIPVYQDLARRIGLELMSNEVKHVGYG

AEO44980.1      AT-TTAVFKWDGQKRLFPEWEKNMTLGDAMKASAIPVYQDLARRIGLELMSNEVKRVGYG

CAK50801.1      AT-TTEVFKWDGQKRLFPEWEKNMTLGDAMKASAIPVYQDLARRIGLELMSNEVKRVGYG

                       : *.*. *    *:    :  *:  * .  :* . :. *       :. . :*

 

ABF47919.1      NMQMGTEVDQFWLKGPLTITPIQEVKFVYDLAQGQLPFKPEVQQQVKEMLYVERRGENRL

ABO33299.1      NMQIGTEVDQFWLKGPLTITPIQEVKFVYDLAQGQLPFKPEVQQQVKEMLYVERRGENRL

ADK34116.1      NMQIGTEVDQFWLKGPLTITPIQEVKFVYDLAQGQLPFKPEVQQQVKEMLYVERRGENRL

AAW57529.1      NMQIGTEVDQFWLKGPLTITPIQEVKFVYDLAQGQLPFKPEVQQQVKEMLYVERRGENRL

AGK07370.1      NAEIGQQVDNFWLVGPLKISPEQEVQFAYQLAMKQLPFDRNVQQQVKDMLYIERRGDSKL

AFM55000.1      NAEIGQQVDNFWLVGPLKISPEQEVQFAYQLAMKQLPFDSNVQQQVKDMLYIERRGDSKL

AFM55002.1      NAEIGQQVDNFWLVGPLKISPEQEVQFAYQLAMKQLPFDRNVQQQVKDMLYIERRGDSKL

AFM55001.1      NAEIGQQVDNFWLVGPLKISPEQEVQFAYQLAMKQLPFDSNVQQQVKDMLYIERRGDSKL

ADM47435.1      NQQIGQQVDNFWLVGPLKVTPKQEVQFVSALAREQLAFDPQVQQQVKAMLFLQERKAYRL

AGI65307.1      NQHIGQQVDNFWLVGPLKITPKQEVEFVSALAQEQLAFDPQVQQQVKAMLLLQEQQAYRL

AFH36331.1      NQQIGQHIDNFWLVGPLKITPEQEVEFASALAQEQLAFDPQVQQQVKAMLLLQERQGYRL

AFH36330.1      NQQIGQHIDNFWLVGPLKITPEQEVEFASALAQEQLAFDPQVQQQVKAMLLLQERQDYRL

AEV91554.1      NTRIGTQVDNFWLIGPLKITPIEEAQFAYRLAKQELPFTPKTQQQVIDMLLVDEIRGTKV

AEV91553.1      NTRIGTQVDNFWLIGPLKITPIEEAQFAYRLAKQELPFTPKTQQQVIDMLLVDEIRGTKV

AEV91551.1      NQQIGTVVDNFWLVGPLQITPVQEVLFVEKLANTQLAFKPDVQHAVQDMLLIEQKPNYKL

CCW28916.1      NQQIGTVVDNFWLVGPLQITPVQEVLFVEKLANTQLAFKPDVQHTVQDMLLIEQKPNYKL

AEV91550.1      NQQIGTVVDNFWLVGPLQITPVQEVLFVEKLANTQLAFKPDVQHTVQDMLLIEQKPNYKL

ACE63186.1      NAEIGQQVDNFWLIGPLKVTPIQEVEFVSQLAHTQLPFSEKVQANVKNMLLLEENNGYKI

ACI28281.1      NAEIGQQVDNFWLVGPLKVTPIQEVEFVSQLAHTQLPFSEKVQANVKNMLLLEESNGYKI

AAP40270.1      NAEIGQQVDNFWLVGPLKVTPIQEVEFVSQLAHTQLPFSEKVQANVKNMLLLEESNGYKI

AFN65709.1      NAEIGQQVDNFWLVGPLKVTPIQEVEFVSQLAHTQLPFSEKVQANVKNMLLLEESNGYKI

ADK35869.1      NAEIGQQVDNFWLVGPLKVTPIQEVEFVSQLAHTQLPFSEKVQANVKNMLLLEESNGYKI

ADK35875.1      NAEIGQQVDNFWLVGPLKVTPIQEVEFVSQLAHTQLPFSEKVQANVKNMLLLEESNGYKI

AEP43731.1      NAEIGQQVDNFWLVGPLKVTPIQEVEFVSQLAHTQLPFSEKVQANVKNMLLLEESNGYKI

CAB69042.1      NAEIGQQVDNFWLVGPLKVTPIQEVEFVSQLAHTQLPFSEKVQANVKNMLLLEESNGYKI

AAW22056.1      NAEIGQQVDNFWLVGPLKVTPIQEVEFVSQLAHTQLPFSEKVQANVKNMLLLEESNGYKI

AAG35609.2      NAEIGQQVDNFWLVGPLKVTPIQEVEFVSQLAHTQLPFSEKVQANVKNMLLLEESNGYKI

AAG35607.1      NTNIGTQVDNFWLVGPLKITPVQEVNFADDLAHNRLPFKLETQEEVEKMLLIKEVNGSKI

ABP87779.2      NTNIGTQVDNFWLVGPLKITPVQEVNFADDLAHNRLPFKLETQEEVKKMLLIKEVNGSKI

CAQ51348.1      NTNIGTQVDNFWLVGPLKITPVQEVNFADDLAHNRLPFKLETQEEVKKMLLIKEVNGSKI

AAG35608.1      NTNIGTQVDNFWLVGPLKITPVQEVNFADDLAHNRLPFKLETQEEVKKMLLIKEVNGSKI

ADB28891.1      NTNIGTQVDNFWLVGPLKITPVQEVNFADDLAHNRLPFKLETQEEVKKMLLIKEVNGSKI

AFK28473.1      NTNIGTQVDNFWLVGPLKITPVQEVNFADDLAHNRLPFKLETQEEVKKMLLIKEVNGSKI

CAB92323.2      NTNIGTQVDNFWLVGPLKITPVQEVNFADDLAHNRLPFKLETQEEVKKMLLIKEVNGSKI

AAM34291.1      NTNIGTQVDNFWLVGPLKITPVQEVNFADDLAHNRLPFKLETQEEVKKMLLIKEVNGSKI

AFG29918.1      NMNIGTQVDNFWLVGPLKITPIQEVNFADDFANNRLPFKLETQEEVKKMLLIKEFNGSKI

ACX70402.1      NMNIGTQVDNFWLVGPLKITPIQEVNFADDFANNRLPFKLETQEEVKKMLLIKEFNGSKI

ADK92148.1      NMNIGTQVDNFWLIGPLKITPIQEVNFADDLANNRLPFKLETQEEVKKMLLIKEVNGSKI

AGK07369.1      NMSIGTQVNNFWLVGPLKITPIQEANFADDLANNRLPFKLETQEEVKKMLLIKEVNGSKI

AGK07368.1      NMNIGTQVDNFWLVGPLKITPIQEVNFADDLANNRLPFKLETQEEVKKMLLIKEVNGSKI

ALA99185.1      NRTIGGAPDAYWVDDSLQISAREQVDFLQRLARGTLPFSARSQDIVRQMSIVEATPDYVL

AAR32134.1      NRTIGGAPDAYWVDDSLQISAREQVDFVQRLARGTLPFSARSQDIVRQMSIVEATPDYVL

AID67109.1      NQNISGGIDKFWLEGQLRISAVNQVEFLESLYLNKLSASKENQLIVKEALVTEAAPEYLV

AAR03105.1      NQDIGGQADSFWLDGQLRITAFQQVDFLRQLHDNKLPVSERSQRIVKQMMLTEASTDYII

AAR89917.1      NEDISGNLDSFWLDGGIRISATEQVAFLRKLYHNKLHVSERSQRIVKQAMLTEANSDYII

AEP16366.1      NEDISGNVDSFWLDGGIRISATQQIAFLRKLYHNKLHVSERSQRIVKQAMLTEANGDYII

AGD91915.1      NEDISGNVDSFWLDGGIRISATQQIAFLRKLYHNKLHVSERSQRIVKQAMLTEANGDYII

AFC95894.1      NEDISGNVGSFWLDGGIRISATEQISFLRKLYHNKLHVSERSQRIVKQAMLTEANGDYII

AFU91598.1      NEDISGNVDSFWLDGGIRISATEQISFLRKLYHNKLHVSERSQRIVKQAMLTEANGDYII

ADG27454.1      NEDISGNVDSFWLDGGIRISATEQISFLRKLYHNKLHVSERSQRIVKQAMLTEANGDYII

AGC60012.1      NEDISGNVDSFWLDGGIRISATEQISFLRKLYHNKLHVSERSQRIVKQAMLTEANGDYII

AGC60013.1      NEDISGNVDSFWLDGGIRISATEQISFLRKLYHNKLHVSERSQRIVKQAMLTEANGDYII

AAP70012.1      NEDISGNVDSFWLDGGIRISATEQISFLRKLYHNKLHVSERSQRIVKQAMLTEANGDYII

AEV91552.1      NANIGSKVDNFWLVGPLKITPQQETQFAYQLAHKTLPFSKDVQEQVQSMVFIEEKNGSKI

AAZ78361.1      NADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSLKVQDEVQSMLFIEEKNGNKI

ABC84263.1      NADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSLKAQDEVQSMLFIEEKNGNKI

CAJ77817.2      NADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQDEVQSMLFIEEKNGNKI

ABF50983.1      NADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSLKVQDEVQSMLFIEEKNGNKI

CCJ32595.1      NADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQDEVQSMLFIEEKNGNKI

CCJ32598.1      NADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQDEVQSMLFIEEKNGNKI

ABV31690.1      NADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQDEVQSMLFIEEKNGNKI

CCJ32596.1      NADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQDEVQSMLFIEEKNGNKI

ABC61637.1      NADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQDEVQSMLFIEEKNGNKI

ABV31687.1      NADIGTQVDNFWVVGPLKITPQQEAQFAYKLANKTLPFSQKVQDEVQSMLFIEEKNGNKI

ABV31692.1      NADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQDEVQSMLFIEEKNGNKI

AAW81340.1      NADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQDEVQSMLFIEEKNGNKI

CCA94644.1      NADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQDEVQSMLFIEEKNGNKI

ACX31140.1      NADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQDEVKSMLFIEEKNGNKI

ABV31686.1      NADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQDEVQSMLFIEEKNGNKI

AAW81341.1      NADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQHEVQSMLFIEEKNGNKI

ABV31691.1      NADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSPKVQDEVQSMLFIEEMNGNKI

AFO55202.1      NADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQDEVQSMLFIEEKNGNKI

ABI53716.1      NADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSPKVQDEVQSMLFIEEMNGNKI

AEL88491.1      NADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSPKVQDEVQSMLFIEEKNGNKI

ACD84990.1      NADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSPKVQDEVQSMLFIEEKNGNKI

AEL17179.1      NADIGTQVDNFWVVGPLKITPQQEAQFAYKLANKTLPFSPKVQDEVQSMLFIEEKNGNKI

CAC83905.2      NADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSPKVQDEVQSMLFIEEKNGNKI

AAW81336.1      NADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSPKVQDEVQSMLFIEEKNGNKI

AFO55201.1      NADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSPKVQDEVQSMLFIEEKNGNKI

ABW70410.1      NADIGTQVDNFWVVGPLKITPQQEAQFAYKLANKTLPFSPKVQDEVQSMLFIEEKNGNKI

AAW81342.1      NADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSPKVQDEVQSMLFIEEKNGNKI

ABS71123.1      NADIGTQVDNFWVVGPLKITPQQEAQFAYKLANKTLPFSQKVQDEVQSMLFIEEKNGNKI

ACD45467.1      NADIGTQVDNFWVVGPLKITPQQEAQFAYKLANKTLPFSQKVQDEVQSMLFIEEKNGNKI

ABV71248.1      NADIGTQVDNFWVVGPLKITPQQEAQFAYKLANKTLPFSQKVQDEVQSMLFIEEKNGNKI

AEB98923.1      NADIGTQVDNFWVVGPLKITPQQEAQFAYKLANKTLPFSQKVQDEVQSMLFIEEKNGNKI

AEB98920.1      NADIGTQVDNFWVVGPLKITPQQEAQFAYKLANKTLPFSQKVQDEVQSMLFIEEKNGNKI

ABF47917.1      NADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQDEVQSMLFIEEKNGNKI

ACD84988.1      NTDIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQDEVQSMLFIEEKNGNKI

ABV31688.1      NTDIGTQVDNFWVVGPLKITPQQEAQFAYKLANKTLPFSQKVQDEVQSMLFIEEKNGNKI

CCA94649.1      NADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQDEVQSMLFIEEKNGNKI

ADM26745.1      NADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQDEVQSMLFIEEKNGNKI

ADI58616.1      NADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQDEVQSMLFIEEKNGNKI

ADX07745.1      NADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQDEVQSMLFIEEKNGNKI

ABF47918.1      NADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQDEVQSMLFIEEKNGNKI

CAJ77809.1      NADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQDEVQSMLFIEEKNGNKI

AAW81337.1      NADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQDEVQSMLFIEEKNGNKI

AAX51234.1      NADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQDEVQSMLFIEEKNGNKI

ABC26007.1      NADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQDEVQSMLFIEEKNGNKI

ABV71246.1      NADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQDEVQSMLFIEEKNGNKI

ABC26006.1      NADIGTQVDNFWLAGPLKITPQQEAQFAYKLANKTLPFSQKVQDEVQSMLFIEEKNGNKI

ABD48715.1      NADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQDEVQSMLFIEEKNGNKI

BAL15076.1      NADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQDEVQSMLFIEEKNGNKI

ABV31689.1      NADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQDEVQSMLFIEEKNGNKI

BAN10684.1      NADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQDEVQSMLFIEEKNGNKI

ABV71247.1      NADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQDEVQSMLFIEEKNGNKI

AAW81338.1      NADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQDEVQSMLFIEEKNGNKI

AAW51373.1      NADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQDEVQSMLFIEEKNGNKI

ABF47916.1      NADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQDEVQSMLFIEEKNGNKI

ABE03012.1      NADIGTQVDNFWLVGPLKITPQQEAQFTYKLANKTLPFSQKVQDEVQSMLFIEEKNGNKI

ABY77907.1      NADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQEVQDEVQSMLFIEEKNGNKI

ACY56711.1      NADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQEVQDEVQSILFIEEKNGNKI

AAW81339.1      NADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQEVQDEVQSMLFIEEKNGNKI

ADX07748.1      NADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQDEVQSMLFIEEKNGNKI

ABQ52429.1      NADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQDEVQSMLFIEEKNGNKI

ABW95048.1      NADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQDEVQSMLFIEEKNGNKI

AAW81358.1      NADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQDEVQSMLFIEEKNGNKI

AAX51233.1      NADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQDEVQSMLFIEEKNGNKI

ABF47914.1      NADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQDEVQSMLFIEEKNGNKI

ACX31142.1      NADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQDEVQSMLFIEEKNGNKI

AEO44980.1      NADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQDEVQSMLFIEEKNGNKI

CAK50801.1      NADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQDEVQSMLFIEEKNGNKI

                *  :.   . :*: . : ::  ::  *   :    *      *  *      .      :

 

ABF47919.1      YAKSGW---G-MAVDPQVGWYVGFVEKADGQVVAFALNMQMKAGDDIALRKQLSLDVLDK

ABO33299.1      YAKSGW---G-MAVDPQVGWYVGFVEKADGQVVAFALNMQMKAGDDIALRKQLSLDVLDK

ADK34116.1      YAKSGW---G-MAVDPQVGWYVGFVEKADGQVVAFALNMQMKAGDDIALRKQLSLDVLDK

AAW57529.1      YAKSGW---G-MAVDPQVGWYVGFVEKADGQVVAFALNMQMKAGDDIALRKQLSLDVLDK

AGK07370.1      YAKSGW---G-MDVEPQVGWYTGWVEQPNGKVTAFALNMKMQAGDDLAERKQLTLSILDK

AFM55000.1      YAKSGW---G-MDVEPQVGWYTGWVEQPNGKVTAFALNMNMQAGDDPTERKQLTLSILDK

AFM55002.1      YAKSGW---G-MDVEPQVGWYTGWVEQPNGKVTAFALNMNMQAGNDPAERKQLTLSILDK

AFM55001.1      YAKSGW---G-MDVEPQVGWYTGWVEQPNGKVTAFALNMNMQAGNDPAERKQLTLSILDK

ADM47435.1      YVKSGW---G-MDVEPQVGWLTGWVETPQAEIVAFSLNMQMQNGIDPAIRLEILQQALAE

AGI65307.1      YAKSGW---G-MDVEPQVGWLTGWVETPQAEIVAFSLNMQMQSNMDPAIRLKILQQALAE

AFH36331.1      YAKSGW---G-MDVEPQVGWLTGWIETPQDEIVAFSLNMQMQSNMDPAIRLKILQQALAE

AFH36330.1      YAKSGW---G-MDVEPQVGWLTGWIETPQDEIVAFSLNMQMQSNMDPAIRLKILQQALAE

AEV91554.1      YAKSGW---G-MDITPQVGWWTGWIEDPNGKVIAFSLNMEMNQPTHAAARKEIVYQALTQ

AEV91553.1      YAKSGW---G-MDITPQVGWWTGWIEDPNGKVIAFSLNMEMNQPAHAAARKEIVYQALTQ

AEV91551.1      YAKSGW---G-MDLEPQVGWWAGWVETSTGEKVYFALNMHMKTGISASVREQLVKQSLTA

CCW28916.1      YAKSGW---G-MDLEPQVGWWAGWVETSTGEKAYFALNMQMKTGISASVREQLVKQSLTA

AEV91550.1      YAKSGW---G-MDLEPQVGWWTGWVETATSEKVYFALNMHMKTGISASVREQLVKQSLTA

ACE63186.1      FGKTGW---A-MDIKPQVGWLTGWVEQPDGKIVAFALNMEMRSEMPASIRNELLMKSLKQ

ACI28281.1      FGKTGW---AAMDIKPQVGWLTGWVEQPDGKIVAFALNMEMRSEMPASIRNELLMKSLKQ

AAP40270.1      FGKTGW---AAMDIKPQVGWLTGWVEQPDGKIVAFALNMEMRSEMPASIRNELLMKSLKQ

AFN65709.1      FGKTGW---A-MNIKSQVGWLTGWVEQPDGKIVAFALNMEMRSEMPASIRNELLMKSLKQ

ADK35869.1      FGKTGW---A-MDVKPQVGWLTGWVEQPDGKIVAFALNMEMRSEMPASIRNELLMKSLKQ

ADK35875.1      FGKTGW---A-MDIKPQVGWLTGWVEQPDGKIVAFALNMEMRSEMPASTRNELLMKSLKQ

AEP43731.1      FGKTGW---A-MDIKSQVGWLTGWVEQPDGKIVAFALNMEMRSEMPASIRNELLMKSLKQ

CAB69042.1      FGKTGW---A-MDIKPQVGWLTGWVEQPDGKIVAFALNMEMRSEMPASIRNELLMKSLKQ

AAW22056.1      FGKTGW---A-MDIKPQVGWLTGWVEQPDGKIVAFALKMEMRSEMPASIRNELLMKSLKQ

AAG35609.2      FGKTGW---A-MDIKPQVGWLTGWVEQPDGKIVAFALKMEMRSEMPASIRNELLMKSLKQ

AAG35607.1      YAKSGW---G-MGVTPQVGWLTGWVEQANGKKIPFSLNLEMKEGMSGSIRNEITYKLLEN

ABP87779.2      YAKSGW---G-MDVTPQVGWLTGWVEQANGKKIPFSLNLEMKEGMSGSIRNEITYKSLEN

CAQ51348.1      YAKSGW---G-MGVTPQVGWLTGWVEQANGKKIPFSLNLEMKEGMSGSIRNEITYKSLEN

AAG35608.1      YAKSGW---G-MGVTPQVGWLTGWVEQANGKKIPFSLNLEMKEGMTGSIRNEITYKSLEN

ADB28891.1      YAKSGW---G-MGVTSQVGWLTGWVEQANGKKIPFSLNLEMKEGMSGSIRNEITYKSLEN

AFK28473.1      YAKSGW---V-MGVTPQVGWLTGWVEQANGKKIPFSLNLEMKEGMSGSIRNEITYKSLEN

CAB92323.2      YAKSGW---G-MGVTPQVGWLTGWVEQANGKKIPFSLNLEMKEGMSGSIRNEITYKSLEN

AAM34291.1      YAKSGW---G-MGVTPQVGWLTGWVEQANGKKIPFSLNLEMKEGMSGSIRNEITYKSLEN

AFG29918.1      YAKSGW---G-MAVTPQVGWLTGWVEKSNGEKVAFSLNIEMKQGMPGSIRNEITYKSLEN

ACX70402.1      YAKSGW---G-MDVTPQVGWLTGWVEKSNGEKVAFSLNIEMKQGMPGSIRNEITYKSLEN

ADK92148.1      YAKSGW---G-MDVS