#

#

#  Percent Identity  Matrix - created by Clustal2.1

#

#

 

     1: BAP28835.1  100.00   99.29   59.93   59.93   60.29   47.79   49.45   49.82   49.08   50.18   50.55   49.45   48.71   50.18   50.18   49.45   49.45   50.55   49.82   50.18   49.82   49.45   49.82   49.45   49.08   49.45   49.45   49.45   49.45   49.45   49.82   49.82   49.08   49.45   49.82   49.82   49.45   49.82   49.82   50.18   49.82   49.08   49.82   49.45   49.08   49.45   49.08   49.45   49.45   49.82   49.82   49.82   47.04   46.30   46.67   47.41   47.04   46.67   47.04   47.41   46.67   46.30   46.30   46.67   46.67   46.30   47.04   47.04   46.67   47.78   47.04   47.41   47.41   47.41   54.61   53.87   47.78   48.15   48.15   48.15   48.15   48.15   47.78   48.15   47.78   48.15   48.15   47.78   48.15   48.50   52.77   51.66   52.99   52.40   53.14   53.14   53.51   32.83   31.54   30.92   31.56   31.52   30.74   30.74   32.94   32.95   30.59   30.20   33.33   33.86   33.07   36.96   33.59   33.98   33.98   34.77   23.26   23.26   22.09   24.00   23.60   23.60   23.60   24.00   23.60

     2: AIT76118.1   99.29  100.00   60.66   60.66   61.03   48.16   49.82   50.18   49.45   50.55   50.92   49.82   49.08   50.55   50.55   49.82   49.82   50.92   50.18   50.55   50.18   49.82   50.18   49.82   49.45   49.82   49.82   49.82   49.82   49.82   50.18   50.18   49.45   49.82   50.18   50.18   49.82   50.18   50.18   50.55   50.18   49.45   50.18   49.82   49.45   49.82   49.45   49.82   49.82   50.18   50.18   50.18   47.41   46.67   47.04   47.78   47.41   47.04   47.41   47.78   47.04   46.67   46.67   47.04   47.04   46.67   47.41   47.41   47.04   48.15   47.41   47.78   47.78   47.78   54.98   54.24   48.15   48.52   48.52   48.52   48.52   48.52   48.15   48.52   48.15   48.52   48.52   48.15   48.52   48.87   53.14   52.03   53.36   52.77   53.51   53.51   53.87   32.45   31.54   30.92   31.56   31.52   30.74   30.74   32.94   32.95   30.20   29.80   33.33   33.86   33.07   37.35   33.98   34.38   34.38   35.16   23.26   23.26   22.09   24.00   23.60   23.60   23.60   24.00   23.60

     3: AIN56719.1   59.93   60.66  100.00   99.28   98.91   55.19   56.88   57.25   56.51   56.88   57.62   56.88   56.88   57.25   57.25   57.62   57.25   57.62   57.25   57.62   57.25   56.88   57.25   57.25   57.25   57.62   57.62   57.25   57.25   56.88   56.88   56.88   56.88   56.88   57.25   57.25   56.88   57.62   57.25   57.62   57.62   56.51   57.25   56.88   56.51   56.88   56.51   57.25   56.88   57.25   57.25   57.25   55.97   57.84   57.46   57.84   57.46   55.97   57.09   58.21   58.21   58.21   58.21   57.84   57.84   57.46   57.84   58.58   57.84   58.21   58.21   58.21   57.84   57.84   55.39   56.13   56.34   56.72   56.34   56.34   56.72   56.72   56.34   56.34   56.34   56.72   56.72   56.34   56.72   57.20   58.89   57.41   58.43   57.78   59.26   59.63   59.63   31.72   29.39   29.55   27.92   30.89   29.34   29.34   32.56   34.87   27.41   27.03   31.42   31.91   31.13   33.85   32.43   33.20   33.59   33.59   23.37   23.37   21.12   20.63   20.63   21.03   21.03   21.43   20.63

     4: AGW83453.1   59.93   60.66   99.28  100.00   99.64   55.19   56.88   57.25   56.51   56.88   57.62   56.88   56.88   57.25   57.25   57.62   57.25   57.62   57.25   57.62   57.25   56.88   57.25   57.25   57.25   57.62   57.62   57.25   57.25   56.88   56.88   56.88   56.88   56.88   57.25   57.25   56.88   57.62   57.25   57.62   57.62   56.51   57.25   56.88   56.51   56.88   56.51   57.25   56.88   57.25   57.25   57.25   56.34   58.21   57.84   58.21   57.84   56.34   57.46   58.58   58.58   58.58   58.58   58.21   58.21   57.84   58.21   58.96   58.21   58.58   58.58   58.58   58.21   58.21   56.13   56.88   55.60   55.97   55.60   55.60   55.97   55.97   55.60   55.60   55.60   55.97   55.97   55.60   55.97   56.44   59.26   57.78   58.80   58.15   59.63   60.00   60.00   31.72   29.01   29.17   27.55   30.12   28.57   28.57   32.17   35.25   27.80   27.41   31.80   31.91   31.13   33.85   32.43   33.20   33.59   33.59   22.99   22.99   20.72   20.63   20.24   20.63   20.63   21.03   20.24

     5: AGW83454.1   60.29   61.03   98.91   99.64  100.00   55.56   56.51   56.88   56.13   57.25   57.25   56.51   56.51   56.88   56.88   57.25   56.88   57.25   56.88   57.25   56.88   56.51   56.88   56.88   56.88   57.25   57.25   56.88   56.88   56.51   56.51   56.51   56.51   56.51   56.88   56.88   56.51   57.25   56.88   57.25   57.25   56.13   56.88   56.51   56.13   56.51   56.13   56.88   56.51   56.88   56.88   56.88   55.97   57.84   57.46   57.84   57.46   55.97   57.09   58.21   58.21   58.21   58.21   57.84   57.84   57.46   57.84   58.58   57.84   58.21   58.21   58.21   57.84   57.84   55.76   56.51   55.97   56.34   55.97   55.97   56.34   56.34   55.97   55.97   55.97   56.34   56.34   55.97   56.34   56.82   59.63   58.15   59.18   58.52   60.00   60.37   60.37   32.09   29.39   29.55   27.92   29.73   28.19   28.19   31.78   34.87   28.19   27.80   31.42   31.52   30.74   33.46   32.05   32.82   33.20   33.20   22.99   22.99   20.72   20.63   20.24   20.63   20.63   21.03   20.24

     6: AKL59536.1   47.79   48.16   55.19   55.19   55.56  100.00   61.90   61.54   61.90   63.00   61.54   61.54   61.54   61.90   61.90   61.90   61.54   62.64   61.90   62.27   61.90   61.54   61.90   60.81   61.54   61.54   61.54   60.81   61.17   60.81   61.17   61.17   61.17   61.54   61.90   61.54   61.17   61.54   62.27   62.64   61.54   61.90   62.27   61.90   61.90   61.90   61.90   62.64   62.27   62.64   62.64   62.64   60.81   60.44   62.27   61.54   61.17   61.54   61.54   61.90   61.17   61.54   61.54   61.90   61.54   61.54   61.90   62.27   62.64   61.90   62.64   61.90   62.27   62.64   55.31   54.95   59.19   59.56   59.19   59.19   59.56   59.19   59.19   59.56   59.19   59.56   59.56   59.19   59.56   58.96   55.93   56.67   56.55   57.41   57.04   58.52   57.78   28.95   28.74   26.62   27.27   26.74   25.19   25.19   31.25   32.82   27.56   27.17   32.43   32.94   32.16   35.55   35.94   36.33   36.72   36.72   23.64   23.64   18.62   19.35   18.15   18.95   18.95   18.95   18.55

     7: AJG01375.1   49.45   49.82   56.88   56.88   56.51   61.90  100.00   97.45   98.54   97.81   97.08   97.08   97.08   97.45   97.45   98.18   98.18   98.18   98.18   98.54   97.81   97.81   97.81   97.08   97.45   97.45   97.81   97.81   98.18   95.99   97.08   96.72   97.08   96.72   97.45   97.45   96.72   97.08   96.72   96.72   97.08   97.45   97.81   97.45   97.45   97.45   97.45   97.81   97.45   97.81   97.45   97.08   76.56   77.66   77.29   77.29   77.29   76.92   77.29   78.02   77.29   77.29   76.92   77.29   75.82   78.02   76.92   77.29   77.66   77.66   79.12   78.02   78.75   78.39   57.88   57.51   57.51   57.88   57.51   57.51   57.88   57.51   57.51   57.88   57.88   57.88   57.88   57.51   57.88   57.62   55.35   55.35   60.07   58.30   58.30   58.30   57.20   28.30   29.73   29.77   29.01   30.47   27.34   26.95   31.10   33.07   28.17   27.78   34.75   35.29   34.51   34.38   32.81   33.98   34.38   34.38   23.83   23.83   21.05   22.18   20.56   21.37   21.37   21.37   20.97

     8: AHL30287.1   49.82   50.18   57.25   57.25   56.88   61.54   97.45  100.00   97.45   97.08   97.45   96.35   96.35   98.54   98.54   97.81   97.81   97.81   97.81   98.18   97.45   97.45   97.45   96.72   96.72   96.72   97.08   96.72   97.81   95.62   96.72   96.35   98.18   96.35   97.08   97.08   96.35   96.72   96.35   96.35   96.72   96.72   96.72   96.72   96.72   97.08   96.72   97.08   96.72   97.08   96.72   96.35   76.92   77.29   76.92   76.92   76.92   76.56   76.92   77.66   76.92   76.92   76.56   76.92   76.19   77.66   77.29   76.92   77.29   77.66   78.75   77.66   78.39   78.02   57.88   57.51   57.51   57.88   57.51   57.51   57.88   57.51   57.51   57.88   57.88   57.88   57.88   57.51   57.88   57.62   55.35   55.35   59.33   58.30   58.30   58.30   57.20   28.68   29.73   29.39   28.63   30.47   27.34   26.95   31.10   33.07   28.17   27.78   35.14   35.69   34.90   34.77   33.20   34.38   34.77   34.77   23.83   23.83   21.46   22.58   20.97   21.77   21.77   21.77   21.37

     9: AHL30285.1   49.08   49.45   56.51   56.51   56.13   61.90   98.54   97.45  100.00   97.81   97.08   97.08   97.08   97.45   97.45   98.18   98.18   98.18   98.18   98.54   97.81   97.81   97.81   97.08   97.45   97.45   97.81   97.81   98.18   95.99   97.08   96.72   97.08   96.72   97.45   97.45   96.72   97.08   96.72   96.72   97.08   97.45   97.45   97.45   97.45   97.45   97.45   97.81   97.45   97.81   97.45   97.08   76.56   77.66   77.29   77.29   77.29   76.92   77.29   78.02   77.29   77.29   76.92   77.29   75.82   78.02   76.92   77.29   77.66   77.66   79.12   78.02   78.75   78.39   57.14   56.78   57.14   57.51   57.14   57.14   57.51   57.14   57.14   57.51   57.51   57.51   57.51   57.14   57.51   57.25   54.98   54.98   58.96   57.93   57.93   57.93   56.83   28.68   30.12   29.77   29.39   30.86   27.73   27.34   31.10   32.68   27.78   27.38   34.75   35.29   34.51   34.38   32.81   33.98   34.38   34.38   24.22   24.22   21.05   22.18   20.56   21.37   21.37   21.37   20.97

    10: AHL30280.1   50.18   50.55   56.88   56.88   57.25   63.00   97.81   97.08   97.81  100.00   97.08   97.81   97.81   97.45   97.45   97.81   97.81   98.18   98.18   98.54   97.81   97.81   97.81   96.72   98.18   98.18   98.54   97.08   97.45   95.62   96.72   96.35   96.72   96.35   97.08   97.08   96.72   96.72   96.35   96.35   96.72   97.08   97.08   97.08   97.08   97.08   97.08   97.45   97.08   97.45   97.08   96.72   76.56   77.66   77.29   77.29   77.29   76.92   77.29   78.02   77.29   77.29   76.92   77.29   75.82   77.66   76.92   77.29   77.66   77.29   78.75   77.66   78.39   78.39   57.51   57.14   57.51   57.88   57.51   57.51   57.88   57.51   57.51   57.88   57.88   57.88   57.88   57.51   57.88   57.62   55.72   55.72   59.70   58.67   58.67   58.67   57.56   29.06   30.50   30.15   29.39   30.47   27.34   26.95   30.71   32.68   28.57   28.17   34.75   35.29   34.51   33.98   32.42   33.59   33.98   33.98   23.83   23.83   21.05   22.18   20.56   21.37   21.37   21.37   20.97

    11: AHI63011.1   50.55   50.92   57.62   57.62   57.25   61.54   97.08   97.45   97.08   97.08  100.00   95.99   95.99   98.18   98.18   97.45   97.45   98.18   98.18   98.54   97.81   97.81   97.81   97.08   97.08   97.08   97.08   97.08   97.45   95.99   97.08   96.72   97.81   97.45   98.18   98.18   98.18   97.81   96.72   96.72   97.08   96.35   96.35   96.35   96.35   96.35   96.35   96.72   96.35   96.72   96.35   95.99   76.56   76.92   76.56   76.56   76.56   76.19   76.56   77.29   76.56   76.56   76.19   76.56   75.82   76.92   76.92   76.56   76.56   76.92   78.39   76.92   77.66   77.66   58.24   57.88   57.14   57.51   57.14   57.14   57.51   57.14   57.14   57.51   57.51   57.51   57.51   57.14   57.51   57.25   55.72   55.72   59.70   58.67   58.67   58.67   57.56   28.68   29.34   29.01   28.24   30.08   26.95   26.56   31.50   32.68   27.78   27.38   34.36   34.90   34.12   33.98   32.42   33.59   33.98   33.98   24.22   24.22   21.46   22.98   20.97   21.77   21.77   21.77   21.37

    12: BAO09635.1   49.45   49.82   56.88   56.88   56.51   61.54   97.08   96.35   97.08   97.81   95.99  100.00   99.27   96.35   96.35   98.54   97.08   97.45   97.08   97.45   96.72   96.72   96.72   95.99   97.45   97.45   97.81   96.35   96.72   96.35   96.72   96.35   97.45   97.08   97.08   97.08   97.08   97.45   96.72   96.72   97.08   97.45   97.45   97.45   97.45   97.45   97.45   97.81   97.45   97.81   97.45   97.08   75.82   76.92   76.56   76.56   76.56   76.19   76.56   77.29   76.56   76.56   76.19   76.56   75.09   77.29   76.19   76.56   76.92   76.92   78.39   77.29   78.02   77.66   57.14   56.78   56.78   57.14   56.78   56.78   57.14   56.78   56.78   57.14   57.14   57.14   57.14   56.78   57.14   56.88   54.98   54.98   58.96   57.93   57.93   57.93   56.83   28.68   30.12   29.77   29.01   30.86   27.73   27.34   30.71   33.07   27.78   27.38   34.36   34.90   34.12   34.38   32.81   33.98   34.38   34.38   24.22   24.22   20.65   21.37   20.16   20.97   20.97   20.97   20.56

    13: AJG01376.1   48.71   49.08   56.88   56.88   56.51   61.54   97.08   96.35   97.08   97.81   95.99   99.27  100.00   96.35   96.35   98.54   97.81   97.45   97.08   97.45   96.72   96.72   96.72   95.99   97.45   97.45   97.81   96.35   96.72   96.35   96.72   96.35   97.45   97.08   97.08   97.08   97.08   97.45   96.72   96.72   97.08   97.45   97.45   97.45   97.45   97.45   97.45   97.81   97.45   97.81   97.45   97.08   75.82   76.92   76.56   76.56   76.56   76.19   76.56   77.29   76.56   76.56   76.19   76.56   75.09   77.29   76.19   76.56   76.92   76.92   78.39   77.29   78.02   77.66   56.78   56.41   56.78   57.14   56.78   56.78   57.14   56.78   56.78   57.14   57.14   57.14   57.14   56.78   57.14   56.88   54.61   54.61   58.58   57.56   57.56   57.56   56.46   28.68   30.12   29.77   29.01   30.86   27.73   27.34   31.10   32.68   27.78   27.38   34.36   34.90   34.12   33.98   32.42   33.59   33.98   33.98   24.22   24.22   20.24   20.97   19.76   20.56   20.56   20.56   20.16

    14: AHL30276.1   50.18   50.55   57.25   57.25   56.88   61.90   97.45   98.54   97.45   97.45   98.18   96.35   96.35  100.00   99.27   97.81   97.81   98.54   98.54   98.91   98.18   98.18   98.18   96.72   96.72   96.72   97.08   96.72   97.81   95.62   96.72   96.35   98.18   96.35   97.08   97.08   97.08   96.72   96.35   96.35   96.72   96.72   96.72   96.72   96.72   96.72   96.72   97.08   96.72   97.08   96.72   96.35   76.56   76.92   76.56   76.56   76.56   76.19   76.56   77.29   76.56   76.56   76.19   76.56   75.82   76.92   76.92   76.56   76.92   76.92   78.02   76.92   77.66   77.66   57.88   57.51   57.51   57.88   57.51   57.51   57.88   57.51   57.51   57.88   57.88   57.88   57.88   57.51   57.88   57.62   55.35   55.35   59.33   58.30   58.30   58.30   57.20   28.68   29.73   29.39   28.63   30.47   27.34   26.95   31.10   33.07   28.17   27.78   35.14   35.69   34.90   34.77   33.20   34.38   34.77   34.77   23.83   23.83   21.46   22.98   20.97   21.77   21.77   21.77   21.37

    15: AHL30277.1   50.18   50.55   57.25   57.25   56.88   61.90   97.45   98.54   97.45   97.45   98.18   96.35   96.35   99.27  100.00   97.81   97.81   98.54   98.54   98.91   98.18   98.18   98.18   96.72   96.72   96.72   97.08   96.72   97.81   95.62   96.72   96.35   98.18   96.35   97.08   97.08   97.08   96.72   96.35   96.35   96.72   96.72   96.72   96.72   96.72   96.72   96.72   97.08   96.72   97.08   96.72   96.35   76.56   76.92   76.56   76.56   76.56   76.19   76.56   77.29   76.56   76.56   76.19   76.56   75.82   76.92   76.92   76.56   76.92   76.92   78.02   76.92   77.66   77.66   57.88   57.51   57.51   57.88   57.51   57.51   57.88   57.51   57.51   57.88   57.88   57.88   57.88   57.51   57.88   57.62   55.72   55.72   59.70   58.67   58.67   58.67   57.56   29.06   30.12   29.77   29.01   30.86   27.73   27.34   31.10   33.07   28.57   28.17   35.14   35.69   34.90   34.77   33.20   34.38   34.77   34.77   23.83   23.83   21.46   22.98   20.97   21.77   21.77   21.77   21.37

    16: AJA32742.1   49.45   49.82   57.62   57.62   57.25   61.90   98.18   97.81   98.18   97.81   97.45   98.54   98.54   97.81   97.81  100.00   98.54   98.91   98.54   98.91   98.18   98.18   98.18   97.45   97.45   97.45   97.81   97.45   97.81   97.08   98.18   97.81   98.18   97.81   98.54   98.54   97.81   98.18   97.45   97.45   97.81   97.81   97.81   97.81   97.81   97.81   97.81   98.18   97.81   98.18   97.81   97.45   76.19   77.29   76.92   76.92   76.92   76.56   76.92   77.66   76.92   76.92   76.56   76.92   75.46   77.66   76.56   76.92   77.29   77.29   78.75   77.66   78.39   78.02   57.14   56.78   57.51   57.88   57.51   57.51   57.88   57.51   57.51   57.88   57.88   57.88   57.88   57.51   57.88   57.62   55.35   55.35   59.33   58.30   58.30   58.30   57.20   28.68   30.12   29.77   29.01   30.86   27.73   27.34   30.71   33.07   27.78   27.38   34.36   34.90   34.12   33.98   32.42   33.59   33.98   33.98   24.22   24.22   20.65   21.77   20.16   20.97   20.97   20.97   20.56

    17: AHL30272.1   49.45   49.82   57.25   57.25   56.88   61.54   98.18   97.81   98.18   97.81   97.45   97.08   97.81   97.81   97.81   98.54  100.00   98.54   98.54   98.91   98.18   98.18   98.18   97.45   97.45   97.45   97.81   97.45   97.81   96.35   97.45   97.08   97.45   97.08   97.81   97.81   97.08   97.45   97.08   97.08   97.45   97.45   97.45   97.45   97.45   97.45   97.45   97.81   97.45   97.81   97.45   97.08   76.56   77.29   76.92   76.92   76.92   76.56   76.92   77.66   77.29   76.92   76.56   77.66   75.46   77.66   77.29   76.92   77.29   77.29   78.75   77.66   78.75   78.02   57.51   57.14   57.14   57.51   57.14   57.14   57.51   57.14   57.14   57.51   57.51   57.51   57.51   57.14   57.51   57.25   54.98   54.98   58.96   57.93   57.93   57.93   56.83   28.68   30.12   29.77   29.01   30.86   27.73   27.34   31.50   32.68   28.17   27.78   35.14   35.69   34.90   33.98   32.42   33.59   33.98   33.98   23.83   23.83   20.65   21.77   20.16   20.97   20.97   20.97   20.56

    18: AGU69252.1   50.55   50.92   57.62   57.62   57.25   62.64   98.18   97.81   98.18   98.18   98.18   97.45   97.45   98.54   98.54   98.91   98.54  100.00   99.27   99.64   98.91   98.91   98.91   97.45   97.45   97.45   97.81   97.45   97.81   96.35   97.45   97.08   97.45   97.08   97.81   97.81   97.81   97.45   97.81   97.81   98.18   98.18   98.18   98.18   98.18   98.18   98.18   98.54   98.18   98.54   98.18   97.81   76.56   77.66   77.29   77.29   77.29   76.92   77.29   78.02   77.29   77.29   76.92   77.29   75.82   77.66   76.92   77.29   77.66   77.29   78.75   77.66   78.39   78.39   57.88   57.51   57.51   57.88   57.51   57.51   57.88   57.51   57.51   57.88   57.88   57.88   57.88   57.51   57.88   57.62   56.46   56.46   60.45   59.41   59.41   59.41   58.30   28.68   30.50   30.15   29.39   31.25   28.12   27.73   31.10   33.07   28.17   27.78   34.75   35.29   34.51   34.77   33.20   34.38   34.77   34.77   23.83   23.83   20.65   22.18   20.16   20.97   20.97   20.97   20.56

    19: ADM26744.1   49.82   50.18   57.25   57.25   56.88   61.90   98.18   97.81   98.18   98.18   98.18   97.08   97.08   98.54   98.54   98.54   98.54   99.27  100.00   99.64   98.91   99.27   98.91   97.45   97.45   97.45   97.81   97.45   97.81   96.35   97.45   97.08   97.45   97.08   97.81   97.81   97.81   97.45   97.08   97.08   97.45   97.81   97.45   97.45   97.45   97.45   97.81   97.81   97.45   97.81   97.45   97.08   76.56   77.66   77.29   77.29   77.29   76.92   77.29   78.02   77.29   77.29   76.92   77.29   75.82   77.66   76.92   77.29   77.66   77.29   78.75   77.66   78.39   78.39   57.88   57.51   57.14   57.51   57.14   57.14   57.51   57.14   57.14   57.51   57.51   57.51   57.51   57.14   57.51   57.25   55.72   55.72   59.70   58.67   58.67   58.67   57.56   28.30   29.73   29.39   28.63   30.47   27.34   26.95   31.10   32.68   28.17   27.78   34.75   35.29   34.51   33.98   32.42   33.59   33.98   33.98   23.83   23.83   21.05   22.58   20.56   21.37   21.37   21.37   20.97

    20: AHN07454.1   50.18   50.55   57.62   57.62   57.25   62.27   98.54   98.18   98.54   98.54   98.54   97.45   97.45   98.91   98.91   98.91   98.91   99.64   99.64  100.00   99.27   99.27   99.27   97.81   97.81   97.81   98.18   97.81   98.18   96.72   97.81   97.45   97.81   97.45   98.18   98.18   98.18   97.81   97.45   97.45   97.81   97.81   97.81   97.81   97.81   97.81   97.81   98.18   97.81   98.18   97.81   97.45   76.92   78.02   77.66   77.66   77.66   77.29   77.66   78.39   77.66   77.66   77.29   77.66   76.19   78.02   77.29   77.66   78.02   77.66   79.12   78.02   78.75   78.75   58.24   57.88   57.51   57.88   57.51   57.51   57.88   57.51   57.51   57.88   57.88   57.88   57.88   57.51   57.88   57.62   56.09   56.09   60.07   59.04   59.04   59.04   57.93   28.68   30.12   29.77   29.01   30.86   27.73   27.34   31.10   33.07   28.17   27.78   35.14   35.69   34.90   34.38   32.81   33.98   34.38   34.38   23.83   23.83   21.05   22.58   20.56   21.37   21.37   21.37   20.97

    21: AGU69250.1   49.82   50.18   57.25   57.25   56.88   61.90   97.81   97.45   97.81   97.81   97.81   96.72   96.72   98.18   98.18   98.18   98.18   98.91   98.91   99.27  100.00   99.27   99.27   97.08   97.08   97.08   97.45   97.08   97.45   95.99   97.08   96.72   97.08   96.72   97.45   97.45   97.45   97.08   96.72   96.72   97.08   97.08   97.08   97.08   97.08   97.08   97.08   97.45   97.81   97.81   97.45   97.08   76.19   77.66   77.29   76.92   76.92   76.56   76.92   77.66   76.92   76.92   76.56   76.92   75.46   77.29   76.56   76.92   77.29   76.92   78.39   77.29   78.02   78.02   57.88   57.51   57.88   58.24   57.88   57.88   58.24   57.88   57.88   58.24   58.24   58.24   58.24   57.88   58.24   57.99   55.72   55.72   59.70   58.67   58.67   58.67   57.56   28.68   30.50   30.15   29.39   31.25   28.12   27.73   31.10   33.07   28.17   27.78   35.14   35.69   34.90   34.38   32.81   33.98   34.38   34.38   23.83   23.83   21.05   22.58   20.56   21.37   21.37   21.37   20.97

    22: AGU69251.1   49.45   49.82   56.88   56.88   56.51   61.54   97.81   97.45   97.81   97.81   97.81   96.72   96.72   98.18   98.18   98.18   98.18   98.91   99.27   99.27   99.27  100.00   99.27   97.08   97.08   97.08   97.45   97.08   97.45   95.99   97.08   96.72   97.08   96.72   97.45   97.45   97.45   97.08   96.72   96.72   97.08   97.45   97.08   97.08   97.08   97.08   97.81   97.45   97.08   97.45   97.08   96.72   76.19   77.66   77.29   76.92   76.92   76.56   76.92   77.66   76.92   76.92   76.56   76.92   75.46   77.29   76.56   76.92   77.29   76.92   78.39   77.29   78.02   78.02   57.51   57.14   57.51   57.88   57.51   57.51   57.88   57.51   57.51   57.88   57.88   57.88   57.88   57.51   57.88   57.62   55.35   55.35   59.33   58.30   58.30   58.30   57.20   28.30   29.73   29.39   28.63   30.47   27.34   26.95   31.10   32.68   28.17   27.78   34.75   35.29   34.51   33.98   32.42   33.59   33.98   33.98   23.83   23.83   21.05   22.58   20.56   21.37   21.37   21.37   20.97

    23: AHL30274.1   49.82   50.18   57.25   57.25   56.88   61.90   97.81   97.45   97.81   97.81   97.81   96.72   96.72   98.18   98.18   98.18   98.18   98.91   98.91   99.27   99.27   99.27  100.00   97.08   97.08   97.08   97.45   97.08   97.45   95.99   97.08   96.72   97.08   96.72   97.45   97.45   97.45   97.08   97.08   97.08   97.08   97.08   97.08   97.08   97.08   97.08   97.08   97.45   97.08   97.45   97.08   96.72   76.19   77.66   77.29   76.92   76.92   76.56   76.92   77.66   76.92   76.92   76.56   76.92   75.46   77.29   76.56   76.92   77.29   76.92   78.39   77.29   78.02   78.02   57.88   57.51   57.88   58.24   57.88   57.88   58.24   57.88   57.88   58.24   58.24   58.24   58.24   57.88   58.24   57.99   55.35   55.35   59.33   58.30   58.30   58.30   57.20   29.06   30.12   29.77   29.01   30.86   27.73   27.34   31.10   33.07   28.17   27.78   35.14   35.69   34.90   34.38   32.81   33.98   34.38   34.38   23.83   23.83   21.05   22.58   20.56   21.37   21.37   21.37   20.97

    24: AHL30279.1   49.45   49.82   57.25   57.25   56.88   60.81   97.08   96.72   97.08   96.72   97.08   95.99   95.99   96.72   96.72   97.45   97.45   97.45   97.45   97.81   97.08   97.08   97.08  100.00   97.81   97.81   97.81   97.81   98.18   96.72   97.81   97.45   97.08   96.72   97.45   97.45   96.72   97.08   95.99   95.99   97.08   96.35   96.35   96.35   96.35   96.35   96.35   96.72   96.35   96.72   96.35   95.99   76.19   77.29   76.92   76.92   76.92   76.56   76.92   77.66   77.66   77.66   77.29   76.92   76.19   76.92   76.56   77.66   77.29   77.29   78.39   78.39   78.39   78.02   57.14   56.78   57.51   57.88   57.51   57.51   57.88   57.51   57.51   57.88   57.88   57.88   57.88   57.51   57.88   57.62   55.35   55.35   59.33   58.30   58.30   58.30   57.20   29.06   29.34   29.01   28.63   30.08   27.34   26.95   31.10   33.46   28.57   28.17   34.75   34.90   34.12   33.59   32.03   33.20   33.59   33.59   23.44   23.44   21.05   22.18   20.56   21.37   21.37   21.37   20.97

    25: AHL30283.1   49.08   49.45   57.25   57.25   56.88   61.54   97.45   96.72   97.45   98.18   97.08   97.45   97.45   96.72   96.72   97.45   97.45   97.45   97.45   97.81   97.08   97.08   97.08   97.81  100.00   99.27   99.27   98.18   98.54   95.99   97.08   96.72   97.08   96.72   97.45   97.45   96.72   97.08   95.99   95.99   97.08   96.72   96.72   96.72   96.72   96.72   96.72   97.08   96.72   97.08   96.72   96.35   76.19   77.29   76.92   76.92   76.92   76.56   76.92   77.66   77.66   77.66   77.29   76.92   76.19   77.66   76.56   77.66   77.29   77.29   79.12   78.39   78.39   78.02   56.78   56.41   56.78   57.14   56.78   56.78   57.14   56.78   56.78   57.14   57.14   57.14   57.14   56.78   57.14   56.88   54.98   54.98   58.96   57.93   57.93   57.93   56.83   29.06   29.73   29.39   28.63   30.47   27.34   26.95   31.10   33.85   27.78   27.38   34.75   35.29   34.51   33.59   32.03   33.20   33.59   33.59   23.83   23.83   21.46   22.58   20.97   21.77   21.77   21.77   21.37

    26: AJG01378.1   49.45   49.82   57.62   57.62   57.25   61.54   97.45   96.72   97.45   98.18   97.08   97.45   97.45   96.72   96.72   97.45   97.45   97.45   97.45   97.81   97.08   97.08   97.08   97.81   99.27  100.00   99.27   98.18   98.54   95.99   97.08   96.72   97.08   96.72   97.45   97.45   96.72   97.08   95.99   95.99   97.08   96.72   96.72   96.72   96.72   96.72   96.72   97.08   96.72   97.08   96.72   96.35   76.19   77.29   76.92   76.92   76.92   76.56   76.92   77.66   77.66   77.66   77.29   76.92   76.19   77.66   76.56   77.66   77.29   77.29   79.12   78.39   78.39   78.02   57.14   56.78   56.78   57.14   56.78   56.78   57.14   56.78   56.78   57.14   57.14   57.14   57.14   56.78   57.14   56.88   54.98   54.98   58.96   57.93   57.93   57.93   56.83   29.06   29.73   29.39   28.63   30.47   27.34   26.95   31.10   33.07   27.78   27.38   33.98   34.51   33.73   33.59   32.03   33.20   33.59   33.59   23.83   23.83   21.46   22.58   20.97   21.77   21.77   21.77   21.37

    27: AJG01379.1   49.45   49.82   57.62   57.62   57.25   61.54   97.81   97.08   97.81   98.54   97.08   97.81   97.81   97.08   97.08   97.81   97.81   97.81   97.81   98.18   97.45   97.45   97.45   97.81   99.27   99.27  100.00   98.18   98.54   95.99   97.08   96.72   97.08   96.72   97.45   97.45   96.72   97.08   96.35   96.35   97.08   97.08   97.08   97.08   97.08   97.08   97.08   97.45   97.08   97.45   97.08   96.72   76.19   77.29   76.92   76.92   76.92   76.56   76.92   77.66   77.66   77.66   77.29   76.92   76.19   77.66   76.56   77.66   77.29   77.29   79.12   78.39   78.39   78.02   57.14   56.78   56.78   57.14   56.78   56.78   57.14   56.78   56.78   57.14   57.14   57.14   57.14   56.78   57.14   56.88   54.98   54.98   58.96   57.93   57.93   57.93   56.83   29.06   29.73   29.39   28.63   30.47   27.34   26.95   30.71   33.46   27.78   27.38   34.36   34.90   34.12   33.59   32.03   33.20   33.59   33.59   23.44   23.44   21.46   22.58   20.97   21.77   21.77   21.77   21.37

    28: AHL30286.1   49.45   49.82   57.25   57.25   56.88   60.81   97.81   96.72   97.81   97.08   97.08   96.35   96.35   96.72   96.72   97.45   97.45   97.45   97.45   97.81   97.08   97.08   97.08   97.81   98.18   98.18   98.18  100.00   98.91   95.99   97.08   96.72   97.08   96.72   97.45   97.45   96.72   97.08   95.99   95.99   97.08   96.72   96.72   96.72   96.72   96.72   96.72   97.08   96.72   97.08   96.72   96.35   76.56   77.29   76.92   76.92   76.92   76.56   76.92   77.66   77.66   77.66   77.29   76.92   76.19   77.66   76.56   77.66   77.29   77.29   79.12   78.39   78.39   78.02   57.14   56.78   57.14   57.51   57.14   57.14   57.51   57.14   57.14   57.51   57.51   57.51   57.51   57.14   57.51   57.25   54.61   54.61   58.96   57.93   57.93   57.93   56.83   29.06   29.73   29.39   29.01   30.47   27.34   26.95   31.10   33.85   27.78   27.38   34.36   34.90   34.12   33.20   31.64   32.81   33.20   33.20   23.83   23.83   21.46   22.58   20.97   21.77   21.77   21.77   21.37

    29: AHN53381.1   49.45   49.82   57.25   57.25   56.88   61.17   98.18   97.81   98.18   97.45   97.45   96.72   96.72   97.81   97.81   97.81   97.81   97.81   97.81   98.18   97.45   97.45   97.45   98.18   98.54   98.54   98.54   98.91  100.00   96.35   97.45   97.08   98.18   97.08   97.81   97.81   97.08   97.45   96.35   96.35   97.45   97.08   97.08   97.08   97.08   97.08   97.08   97.45   97.08   97.45   97.08   96.72   76.19   77.29   76.92   76.92   76.92   76.56   76.92   77.66   77.66   77.66   77.29   76.92   76.19   77.66   76.56   77.66   77.29   77.29   79.12   78.39   78.39   78.02   57.14   56.78   57.14   57.51   57.14   57.14   57.51   57.14   57.14   57.51   57.51   57.51   57.51   57.14   57.51   57.25   54.98   54.98   58.96   57.93   57.93   57.93   56.83   29.06   29.73   29.39   29.01   30.47   27.34   26.95   31.10   33.46   27.78   27.38   34.36   34.90   34.12   33.59   32.03   33.20   33.59   33.59   23.83   23.83   21.46   22.58   20.97   21.77   21.77   21.77   21.37

    30: AHL30282.1   49.45   49.82   56.88   56.88   56.51   60.81   95.99   95.62   95.99   95.62   95.99   96.35   96.35   95.62   95.62   97.08   96.35   96.35   96.35   96.72   95.99   95.99   95.99   96.72   95.99   95.99   95.99   95.99   96.35  100.00   98.18   97.81   97.45   97.08   97.08   97.08   97.08   97.45   96.35   96.35   96.72   95.99   95.99   95.99   95.99   95.99   95.99   96.35   95.99   96.35   95.99   95.62   75.09   76.19   75.82   75.82   75.82   75.46   75.82   76.56   75.82   75.82   75.46   75.82   75.09   75.82   75.46   76.56   76.19   76.19   77.29   76.56   77.29   76.92   58.24   57.88   56.41   56.78   56.41   56.41   56.78   56.41   56.41   56.78   56.78   56.78   56.78   56.41   56.78   56.88   55.72   55.72   59.70   58.67   58.67   58.67   57.56   28.30   29.73   29.39   29.01   30.47   27.73   27.34   30.31   32.68   28.17   27.78   34.36   34.90   34.12   33.20   31.64   32.81   33.20   33.20   24.22   24.22   20.65   21.37   20.56   21.37   21.37   21.37   20.97

    31: AHL30278.1   49.82   50.18   56.88   56.88   56.51   61.17   97.08   96.72   97.08   96.72   97.08   96.72   96.72   96.72   96.72   98.18   97.45   97.45   97.45   97.81   97.08   97.08   97.08   97.81   97.08   97.08   97.08   97.08   97.45   98.18  100.00   99.64   97.81   97.45   98.18   98.18   97.45   97.81   96.72   96.72   97.08   96.35   96.35   96.35   96.35   96.35   96.35   96.72   96.35   96.72   96.35   95.99   75.82   76.92   76.56   76.56   76.56   76.19   76.56   77.29   76.56   76.56   76.19   76.56   75.09   76.56   76.19   76.56   76.92   76.92   78.02   77.29   78.02   77.66   57.88   57.51   57.14   57.51   57.14   57.14   57.51   57.14   57.14   57.51   57.51   57.51   57.51   57.14   57.51   57.25   55.72   55.72   59.70   58.67   58.67   58.67   57.56   28.30   29.34   29.01   28.63   30.08   27.34   26.95   30.71   32.68   28.17   27.78   34.36   34.90   34.12   33.20   31.64   32.81   33.20   33.20   24.22   24.22   21.05   22.18   20.56   21.37   21.37   21.37   20.97

    32: AHL30284.1   49.82   50.18   56.88   56.88   56.51   61.17   96.72   96.35   96.72   96.35   96.72   96.35   96.35   96.35   96.35   97.81   97.08   97.08   97.08   97.45   96.72   96.72   96.72   97.45   96.72   96.72   96.72   96.72   97.08   97.81   99.64  100.00   97.45   97.08   97.81   97.81   97.08   97.45   96.35   96.35   96.72   95.99   95.99   95.99   95.99   95.99   95.99   96.35   95.99   96.35   95.99   95.62   75.82   76.92   76.56   76.56   76.56   76.19   76.56   77.29   76.56   76.56   76.19   76.56   75.09   76.56   76.19   76.56   76.92   76.92   78.02   77.29   78.02   77.66   57.88   57.51   57.14   57.51   57.14   57.14   57.51   57.14   57.14   57.51   57.51   57.51   57.51   57.14   57.51   57.25   55.72   55.72   59.70   58.67   58.67   58.67   57.56   27.92   29.34   29.01   28.63   30.08   27.34   26.95   30.71   32.30   28.17   27.78   34.36   34.90   34.12   33.20   31.64   32.81   33.20   33.20   24.22   24.22   21.05   22.18   20.56   21.37   21.37   21.37   20.97

    33: AHL30281.1   49.08   49.45   56.88   56.88   56.51   61.17   97.08   98.18   97.08   96.72   97.81   97.45   97.45   98.18   98.18   98.18   97.45   97.45   97.45   97.81   97.08   97.08   97.08   97.08   97.08   97.08   97.08   97.08   98.18   97.45   97.81   97.45  100.00   98.18   98.18   98.18   98.18   98.54   96.72   96.72   97.81   97.08   97.08   97.08   97.08   97.08   97.08   97.45   97.08   97.45   97.08   96.72   76.19   76.56   76.19   76.19   76.19   75.82   76.19   76.92   76.19   76.19   75.82   76.19   75.46   76.92   76.56   76.19   76.56   76.92   78.39   76.92   77.66   77.29   57.14   56.78   56.78   57.14   56.78   56.78   57.14   56.78   56.78   57.14   57.14   57.14   57.14   56.78   57.14   56.88   54.98   54.98   58.96   57.93   57.93   57.93   56.83   28.30   29.73   29.39   28.63   30.47   27.34   26.95   31.10   32.68   27.78   27.38   34.36   34.90   34.12   34.38   32.81   33.98   34.38   34.38   24.61   24.61   21.46   22.18   20.97   21.77   21.77   21.77   21.37

    34: AJA32744.1   49.45   49.82   56.88   56.88   56.51   61.54   96.72   96.35   96.72   96.35   97.45   97.08   97.08   96.35   96.35   97.81   97.08   97.08   97.08   97.45   96.72   96.72   96.72   96.72   96.72   96.72   96.72   96.72   97.08   97.08   97.45   97.08   98.18  100.00   98.54   98.54   98.54   98.91   97.08   97.08   97.45   96.72   96.72   96.72   96.72   96.72   96.72   97.08   96.72   97.08   96.72   96.35   75.82   76.92   76.56   76.56   76.56   76.19   76.56   77.29   76.56   76.56   76.19   76.56   75.09   77.29   76.19   76.56   76.56   76.92   78.75   77.29   78.02   77.66   57.14   56.78   56.04   56.41   56.04   56.04   56.41   56.04   56.04   56.41   56.41   56.41   56.41   56.04   56.41   56.13   54.98   54.98   58.96   57.93   57.93   57.93   56.83   28.68   30.12   29.77   29.01   30.86   27.73   27.34   31.10   33.07   28.17   27.78   33.98   34.51   33.73   33.98   32.42   33.59   33.98   33.98   24.61   24.61   21.05   21.77   20.56   21.37   21.37   21.37   20.97

    35: AGU69255.1   49.82   50.18   57.25   57.25   56.88   61.90   97.45   97.08   97.45   97.08   98.18   97.08   97.08   97.08   97.08   98.54   97.81   97.81   97.81   98.18   97.45   97.45   97.45   97.45   97.45   97.45   97.45   97.45   97.81   97.08   98.18   97.81   98.18   98.54  100.00   99.27   98.54   98.91   97.08   97.08   97.45   96.72   96.72   96.72   96.72   96.72   96.72   97.08   96.72   97.08   96.72   96.35   76.56   77.66   77.29   77.29   77.29   76.92   77.29   78.02   77.29   77.29   76.92   77.29   75.82   78.02   76.92   77.29   77.29   77.66   79.49   78.02   78.75   78.39   57.51   57.14   56.78   57.14   56.78   56.78   57.14   56.78   56.78   57.14   57.14   57.14   57.14   56.78   57.14   56.88   55.35   55.35   59.33   58.30   58.30   58.30   57.20   28.30   29.73   29.39   28.63   30.47   27.34   26.95   31.50   32.68   27.78   27.38   34.36   34.90   34.12   33.59   32.03   33.20   33.59   33.59   25.00   25.00   20.65   21.77   20.16   20.97   20.97   20.97   20.56

    36: AJG01377.1   49.82   50.18   57.25   57.25   56.88   61.54   97.45   97.08   97.45   97.08   98.18   97.08   97.08   97.08   97.08   98.54   97.81   97.81   97.81   98.18   97.45   97.45   97.45   97.45   97.45   97.45   97.45   97.45   97.81   97.08   98.18   97.81   98.18   98.54   99.27  100.00   98.54   98.91   97.08   97.08   97.45   96.72   96.72   96.72   96.72   96.72   96.72   97.08   96.72   97.08   96.72   96.35   76.19   77.29   76.92   76.92   76.92   76.56   76.92   77.66   76.92   76.92   76.56   76.92   75.46   77.66   76.56   76.92   76.92   77.29   79.12   77.66   78.39   78.02   57.51   57.14   56.78   57.14   56.78   56.78   57.14   56.78   56.78   57.14   57.14   57.14   57.14   56.78   57.14   56.88   55.35   55.35   59.33   58.30   58.30   58.30   57.20   28.30   30.12   29.77   29.01   30.86   27.73   27.34   31.10   32.68   27.78   27.38   34.36   34.90   34.12   33.59   32.03   33.20   33.59   33.59   24.61   24.61   21.05   22.18   20.56   21.37   21.37   21.37   20.97

    37: ACX31141.1   49.45   49.82   56.88   56.88   56.51   61.17   96.72   96.35   96.72   96.72   98.18   97.08   97.08   97.08   97.08   97.81   97.08   97.81   97.81   98.18   97.45   97.45   97.45   96.72   96.72   96.72   96.72   96.72   97.08   97.08   97.45   97.08   98.18   98.54   98.54   98.54  100.00   98.91   97.08   97.08   97.45   96.72   96.72   96.72   96.72   96.72   96.72   97.08   96.72   97.08   96.72   96.35   75.82   76.92   76.56   76.56   76.56   76.19   76.56   77.29   76.56   76.56   76.19   76.56   75.09   76.92   76.19   76.56   76.56   76.56   78.39   76.92   77.66   77.66   57.51   57.14   56.41   56.78   56.41   56.41   56.78   56.41   56.41   56.78   56.78   56.78   56.78   56.41   56.78   56.51   55.35   55.35   59.33   58.67   58.30   58.30   57.20   28.30   30.12   29.77   29.01   30.86   27.73   27.34   31.10   32.68   27.78   27.38   34.36   34.90   34.12   33.98   32.42   33.59   33.98   33.98   24.61   24.61   21.05   22.18   20.56   21.37   21.37   21.37   20.97

    38: AHL30273.1   49.82   50.18   57.62   57.62   57.25   61.54   97.08   96.72   97.08   96.72   97.81   97.45   97.45   96.72   96.72   98.18   97.45   97.45   97.45   97.81   97.08   97.08   97.08   97.08   97.08   97.08   97.08   97.08   97.45   97.45   97.81   97.45   98.54   98.91   98.91   98.91   98.91  100.00   97.45   97.45   97.81   97.08   97.08   97.08   97.08   97.08   97.08   97.45   97.08   97.45   97.08   96.72   76.19   77.29   76.92   76.92   76.92   76.56   76.92   77.66   76.92   76.92   76.56   76.92   75.46   77.66   76.56   76.92   76.92   77.29   79.12   77.66   78.39   78.02   57.88   57.51   56.41   56.78   56.41   56.41   56.78   56.41   56.41   56.78   56.78   56.78   56.78   56.41   56.78   56.51   55.72   55.72   59.70   58.67   58.67   58.67   57.56   28.68   30.12   29.77   29.01   30.86   27.73   27.34   31.10   33.07   27.78   27.38   34.36   34.90   34.12   33.98   32.42   33.59   33.98   33.98   24.61   24.61   21.05   21.77   20.56   21.37   21.37   21.37   20.97

    39: AGU69253.1   49.82   50.18   57.25   57.25   56.88   62.27   96.72   96.35   96.72   96.35   96.72   96.72   96.72   96.35   96.35   97.45   97.08   97.81   97.08   97.45   96.72   96.72   97.08   95.99   95.99   95.99   96.35   95.99   96.35   96.35   96.72   96.35   96.72   97.08   97.08   97.08   97.08   97.45  100.00   99.27   97.45   97.45   97.45   97.45   97.45   97.45   97.45   97.81   97.45   97.81   97.45   97.08   75.46   76.56   76.19   76.19   76.19   75.82   76.19   76.92   76.19   76.19   75.82   76.19   74.73   76.92   75.82   76.19   76.19   76.56   78.02   76.92   77.66   77.29   57.88   57.51   57.14   57.51   57.14   57.14   57.51   57.14   57.14   57.51   57.51   57.51   57.51   57.14   57.51   57.25   55.35   55.35   59.33   58.30   58.30   58.30   57.20   28.68   30.50   30.15   29.39   31.25   28.12   27.73   30.71   33.07   27.78   27.38   34.36   34.90   34.12   34.38   32.81   33.98   34.38   34.38   23.44   23.44   20.65   21.37   20.16   20.97   20.97   20.97   20.56

    40: AGU69254.1   50.18   50.55   57.62   57.62   57.25   62.64   96.72   96.35   96.72   96.35   96.72   96.72   96.72   96.35   96.35   97.45   97.08   97.81   97.08   97.45   96.72   96.72   97.08   95.99   95.99   95.99   96.35   95.99   96.35   96.35   96.72   96.35   96.72   97.08   97.08   97.08   97.08   97.45   99.27  100.00   97.45   97.45   97.45   97.45   97.45   97.45   97.45   97.81   97.45   97.81   97.45   97.08   75.46   76.56   76.19   76.19   76.19   75.82   76.19   76.92   76.19   76.19   75.82   76.19   74.73   76.92   75.82   76.19   76.19   76.56   78.02   76.92   77.66   77.29   58.24   57.88   57.14   57.51   57.14   57.14   57.51   57.14   57.14   57.51   57.51   57.51   57.51   57.14   57.51   57.25   55.72   55.72   59.70   58.67   58.67   58.67   57.56   28.68   30.50   30.15   29.39   31.25   28.12   27.73   30.31   32.68   28.17   27.78   34.36   34.90   34.12   34.77   33.20   34.38   34.77   34.77   23.83   23.83   20.24   20.97   19.76   20.56   20.56   20.56   20.16

    41: AHL30275.1   49.82   50.18   57.62   57.62   57.25   61.54   97.08   96.72   97.08   96.72   97.08   97.08   97.08   96.72   96.72   97.81   97.45   98.18   97.45   97.81   97.08   97.08   97.08   97.08   97.08   97.08   97.08   97.08   97.45   96.72   97.08   96.72   97.81   97.45   97.45   97.45   97.45   97.81   97.45   97.45  100.00   97.81   97.81   97.81   97.81   97.81   97.81   98.18   97.81   98.18   97.81   97.45   75.82   76.92   76.56   76.56   76.56   76.19   76.56   77.29   76.56   76.56   76.19   76.56   75.09   77.29   76.19   76.56   76.92   76.92   78.75   77.29   78.02   77.66   56.78   56.78   57.14   57.51   57.14   57.14   57.51   57.14   57.14   57.51   57.51   57.51   57.51   57.14   57.51   57.25   56.09   56.09   60.07   59.04   59.04   59.04   57.93   28.68   30.50   29.77   29.01   30.86   27.73   27.34   31.10   33.07   28.57   28.17   34.36   34.90   34.12   34.77   32.81   33.98   34.38   34.38   23.83   23.83   20.65   20.97   20.16   20.97   20.97   20.97   20.56

    42: ADI58622.1   49.08   49.45   56.51   56.51   56.13   61.90   97.45   96.72   97.45   97.08   96.35   97.45   97.45   96.72   96.72   97.81   97.45   98.18   97.81   97.81   97.08   97.45   97.08   96.35   96.72   96.72   97.08   96.72   97.08   95.99   96.35   95.99   97.08   96.72   96.72   96.72   96.72   97.08   97.45   97.45   97.81  100.00   98.54   98.54   99.27   98.54   98.91   98.91   98.54   98.91   98.54   98.18   75.82   76.92   76.56   76.56   76.56   76.19   76.56   77.29   76.56   76.56   76.19   76.56   75.09   77.29   76.19   76.56   76.92   76.92   78.39   77.29   78.02   77.66   56.78   56.41   56.78   57.14   56.78   56.78   57.14   56.78   56.78   57.14   57.14   57.14   57.14   56.78   57.14   56.88   55.35   55.72   59.33   58.30   58.30   58.30   57.20   27.92   30.12   29.39   28.63   30.47   27.34   26.95   30.71   32.30   27.78   27.38   33.98   34.51   33.73   34.38   32.81   33.98   34.38   34.38   23.83   23.83   21.05   21.37   20.16   20.97   20.97   20.97   20.56

    43: ADI58618.1   49.82   50.18   57.25   57.25   56.88   62.27   97.81   96.72   97.45   97.08   96.35   97.45   97.45   96.72   96.72   97.81   97.45   98.18   97.45   97.81   97.08   97.08   97.08   96.35   96.72   96.72   97.08   96.72   97.08   95.99   96.35   95.99   97.08   96.72   96.72   96.72   96.72   97.08   97.45   97.45   97.81   98.54  100.00   99.27   99.27   99.27   99.27   98.91   98.54   98.91   98.54   98.18   75.82   76.92   76.56   76.56   76.56   76.19   76.56   77.29   76.56   76.56   76.19   76.56   75.09   77.29   76.19   76.56   76.92   76.92   78.39   77.29   78.02   77.66   57.14   56.78   56.78   57.14   56.78   56.78   57.14   56.78   56.78   57.14   57.14   57.14   57.14   56.78   57.14   56.88   55.72   55.72   59.70   58.67   58.67   58.67   57.56   27.92   31.27   30.53   29.77   31.64   28.12   27.73   30.71   32.68   28.17   27.78   33.98   34.51   33.73   34.77   33.20   34.38   34.77   34.77   23.44   23.44   21.05   21.37   20.16   20.97   20.97   20.97   20.56

    44: ADI58619.1   49.45   49.82   56.88   56.88   56.51   61.90   97.45   96.72   97.45   97.08   96.35   97.45   97.45   96.72   96.72   97.81   97.45   98.18   97.45   97.81   97.08   97.08   97.08   96.35   96.72   96.72   97.08   96.72   97.08   95.99   96.35   95.99   97.08   96.72   96.72   96.72   96.72   97.08   97.45   97.45   97.81   98.54   99.27  100.00   99.27   99.27   99.27   98.91   98.54   98.91   98.54   98.18   76.19   76.92   76.56   76.56   76.56   76.19   76.56   77.29   76.56   76.56   76.19   76.56   75.09   77.29   76.19   76.56   76.92   76.92   78.39   77.29   78.02   77.66   57.14   56.78   57.14   57.51   57.14   57.14   57.51   57.14   57.14   57.51   57.51   57.51   57.51   57.14   57.51   57.25   55.72   55.72   59.70   58.67   58.67   58.67   57.56   28.68   31.27   30.53   29.77   31.64   28.12   27.73   30.71   32.68   28.57   28.17   34.36   34.90   34.12   34.77   33.20   34.38   34.77   34.77   23.44   23.44   21.05   21.37   20.16   20.97   20.97   20.97   20.56

    45: ADI58620.1   49.08   49.45   56.51   56.51   56.13   61.90   97.45   96.72   97.45   97.08   96.35   97.45   97.45   96.72   96.72   97.81   97.45   98.18   97.45   97.81   97.08   97.08   97.08   96.35   96.72   96.72   97.08   96.72   97.08   95.99   96.35   95.99   97.08   96.72   96.72   96.72   96.72   97.08   97.45   97.45   97.81   99.27   99.27   99.27  100.00   99.27   99.27   98.91   98.54   98.91   98.54   98.18   75.82   76.92   76.56   76.56   76.56   76.19   76.56   77.29   76.56   76.56   76.19   76.56   75.09   77.29   76.19   76.56   76.92   76.92   78.39   77.29   78.02   77.66   56.78   56.41   56.78   57.14   56.78   56.78   57.14   56.78   56.78   57.14   57.14   57.14   57.14   56.78   57.14   56.88   55.35   55.72   59.33   58.30   58.30   58.30   57.20   27.92   30.89   30.15   29.39   31.25   27.73   27.34   30.31   32.30   27.78   27.38   33.98   34.51   33.73   34.38   32.81   33.98   34.38   34.38   23.44   23.44   21.05   21.37   20.16   20.97   20.97   20.97   20.56

    46: ADI58621.1   49.45   49.82   56.88   56.88   56.51   61.90   97.45   97.08   97.45   97.08   96.35   97.45   97.45   96.72   96.72   97.81   97.45   98.18   97.45   97.81   97.08   97.08   97.08   96.35   96.72   96.72   97.08   96.72   97.08   95.99   96.35   95.99   97.08   96.72   96.72   96.72   96.72   97.08   97.45   97.45   97.81   98.54   99.27   99.27   99.27  100.00   99.27   98.91   98.54   98.91   98.54   98.18   76.19   77.29   76.92   76.92   76.92   76.56   76.92   77.66   76.92   76.92   76.56   76.92   75.46   77.66   76.56   76.92   77.29   77.29   78.75   77.66   78.39   78.02   57.14   56.78   57.14   57.51   57.14   57.14   57.51   57.14   57.14   57.51   57.51   57.51   57.51   57.14   57.51   57.25   55.72   55.72   59.70   58.67   58.67   58.67   57.56   28.30   31.27   30.53   29.77   31.64   28.12   27.73   30.71   32.68   28.17   27.78   34.36   34.90   34.12   34.77   33.20   34.38   34.77   34.77   23.44   23.44   21.05   21.37   20.16   20.97   20.97   20.97   20.56

    47: ADX07746.1   49.08   49.45   56.51   56.51   56.13   61.90   97.45   96.72   97.45   97.08   96.35   97.45   97.45   96.72   96.72   97.81   97.45   98.18   97.81   97.81   97.08   97.81   97.08   96.35   96.72   96.72   97.08   96.72   97.08   95.99   96.35   95.99   97.08   96.72   96.72   96.72   96.72   97.08   97.45   97.45   97.81   98.91   99.27   99.27   99.27   99.27  100.00   98.91   98.54   98.91   98.54   98.18   75.82   76.92   76.56   76.56   76.56   76.19   76.56   77.29   76.56   76.56   76.19   76.56   75.09   77.29   76.19   76.56   76.92   76.92   78.39   77.29   78.02   77.66   56.78   56.41   56.78   57.14   56.78   56.78   57.14   56.78   56.78   57.14   57.14   57.14   57.14   56.78   57.14   56.88   55.35   55.35   59.33   58.30   58.30   58.30   57.20   27.92   30.89   30.15   29.39   31.25   27.73   27.34   30.71   32.30   28.17   27.78   33.98   34.51   33.73   34.38   32.81   33.98   34.38   34.38   23.44   23.44   21.05   21.37   20.16   20.97   20.97   20.97   20.56

    48: ALL53530.1   49.45   49.82   57.25   57.25   56.88   62.64   97.81   97.08   97.81   97.45   96.72   97.81   97.81   97.08   97.08   98.18   97.81   98.54   97.81   98.18   97.45   97.45   97.45   96.72   97.08   97.08   97.45   97.08   97.45   96.35   96.72   96.35   97.45   97.08   97.08   97.08   97.08   97.45   97.81   97.81   98.18   98.91   98.91   98.91   98.91   98.91   98.91  100.00   98.91   99.27   98.91   98.54   76.92   77.66   77.29   77.29   77.29   76.92   77.29   78.02   77.29   77.29   76.92   77.29   75.82   78.02   76.92   77.29   77.66   77.66   79.12   78.02   78.75   78.39   57.51   57.14   57.51   57.88   57.51   57.51   57.88   57.51   57.51   57.88   57.88   57.88   57.88   57.51   57.88   57.62   56.09   56.09   60.07   59.04   59.04   59.04   57.93   28.30   30.89   29.77   29.39   31.25   28.12   27.73   31.10   33.07   27.78   27.38   34.75   35.29   34.51   35.16   33.59   34.77   35.16   35.16   23.83   23.83   20.65   21.37   19.76   20.56   20.56   20.56   20.16

    49: AJA32743.1   49.45   49.82   56.88   56.88   56.51   62.27   97.45   96.72   97.45   97.08   96.35   97.45   97.45   96.72   96.72   97.81   97.45   98.18   97.45   97.81   97.81   97.08   97.08   96.35   96.72   96.72   97.08   96.72   97.08   95.99   96.35   95.99   97.08   96.72   96.72   96.72   96.72   97.08   97.45   97.45   97.81   98.54   98.54   98.54   98.54   98.54   98.54   98.91  100.00   99.27   98.91   98.54   75.82   76.92   76.56   76.56   76.56   76.19   76.56   77.29   76.56   76.56   76.19   76.56   75.09   77.29   76.19   76.56   76.92   76.92   78.39   77.29   78.02   77.66   57.14   56.78   57.14   57.51   57.14   57.14   57.51   57.14   57.14   57.51   57.51   57.51   57.51   57.14   57.51   57.25   55.72   55.72   59.70   58.67   58.67   58.67   57.56   28.30   31.27   30.53   29.77   31.64   28.52   28.12   30.71   32.68   27.78   27.38   34.36   34.90   34.12   34.77   33.20   34.38   34.77   34.77   23.44   23.44   20.65   20.97   19.76   20.56   20.56   20.56   20.16

    50: ADX07747.1   49.82   50.18   57.25   57.25   56.88   62.64   97.81   97.08   97.81   97.45   96.72   97.81   97.81   97.08   97.08   98.18   97.81   98.54   97.81   98.18   97.81   97.45   97.45   96.72   97.08   97.08   97.45   97.08   97.45   96.35   96.72   96.35   97.45   97.08   97.08   97.08   97.08   97.45   97.81   97.81   98.18   98.91   98.91   98.91   98.91   98.91   98.91   99.27   99.27  100.00   99.27   98.91   76.19   77.29   76.92   76.92   76.92   76.56   76.92   77.66   76.92   76.92   76.56   76.92   75.46   77.66   76.56   76.92   77.29   77.29   78.75   77.66   78.39   78.02   57.51   57.14   57.51   57.88   57.51   57.51   57.88   57.51   57.51   57.88   57.88   57.88   57.88   57.51   57.88   57.62   56.09   56.09   60.07   59.04   59.04   59.04   57.93   28.68   30.89   30.15   29.39   31.25   28.12   27.73   31.10   33.07   28.17   27.78   34.75   35.29   34.51   35.16   33.59   34.77   35.16   35.16   23.83   23.83   21.05   21.37   20.16   20.97   20.97   20.97   20.56

    51: ACD84989.1   49.82   50.18   57.25   57.25   56.88   62.64   97.45   96.72   97.45   97.08   96.35   97.45   97.45   96.72   96.72   97.81   97.45   98.18   97.45   97.81   97.45   97.08   97.08   96.35   96.72   96.72   97.08   96.72   97.08   95.99   96.35   95.99   97.08   96.72   96.72   96.72   96.72   97.08   97.45   97.45   97.81   98.54   98.54   98.54   98.54   98.54   98.54   98.91   98.91   99.27  100.00   99.27   75.82   76.92   76.56   76.56   76.56   76.19   76.56   77.29   76.56   76.56   76.19   76.56   75.09   77.29   76.19   76.56   76.92   76.92   78.39   77.29   78.02   77.66   57.51   57.14   57.51   57.88   57.51   57.51   57.88   57.51   58.24   57.88   57.51   57.88   57.88   57.51   57.88   57.62   56.09   56.09   60.07   59.04   59.04   59.04   57.93   29.06   30.89   29.77   29.01   30.86   27.73   27.34   31.10   33.46   28.57   28.17   34.75   35.29   34.90   35.16   33.59   34.77   35.16   35.16   24.22   24.22   21.46   21.77   20.56   21.37   21.37   21.37   20.97

    52: ADI58617.1   49.82   50.18   57.25   57.25   56.88   62.64   97.08   96.35   97.08   96.72   95.99   97.08   97.08   96.35   96.35   97.45   97.08   97.81   97.08   97.45   97.08   96.72   96.72   95.99   96.35   96.35   96.72   96.35   96.72   95.62   95.99   95.62   96.72   96.35   96.35   96.35   96.35   96.72   97.08   97.08   97.45   98.18   98.18   98.18   98.18   98.18   98.18   98.54   98.54   98.91   99.27  100.00   75.46   76.56   76.19   76.19   76.19   75.82   76.19   76.92   76.19   76.19   75.82   76.19   74.73   76.92   75.82   76.19   76.56   76.56   78.02   76.92   77.66   77.29   57.51   57.14   57.51   57.88   57.51   57.51   57.88   57.51   57.88   57.88   57.51   57.88   57.88   57.51   57.88   57.62   56.09   56.09   60.07   59.04   59.04   59.04   57.93   29.06   30.89   29.77   29.01   30.86   27.73   27.34   31.10   33.46   28.57   28.17   34.75   35.29   34.90   35.16   33.59   34.77   35.16   35.16   24.61   24.61   21.46   21.77   20.56   21.37   21.37   21.37   20.97

    53: AIZ00987.1   47.04   47.41   55.97   56.34   55.97   60.81   76.56   76.92   76.56   76.56   76.56   75.82   75.82   76.56   76.56   76.19   76.56   76.56   76.56   76.92   76.19   76.19   76.19   76.19   76.19   76.19   76.19   76.56   76.19   75.09   75.82   75.82   76.19   75.82   76.56   76.19   75.82   76.19   75.46   75.46   75.82   75.82   75.82   76.19   75.82   76.19   75.82   76.92   75.82   76.19   75.82   75.46  100.00   87.91   88.64   89.01   89.01   88.28   88.28   87.91   88.28   88.28   88.64   89.74   86.81   87.18   87.91   87.91   88.64   87.91   88.64   88.28   88.64   89.38   57.51   57.14   57.72   58.09   57.72   57.72   58.09   57.72   57.72   58.09   58.09   58.09   58.09   57.72   58.09   57.84   57.78   57.78   59.93   59.26   59.63   59.26   58.89   29.06   29.34   25.95   27.10   26.95   25.78   25.39   30.71   31.52   27.78   27.38   33.20   33.33   32.55   34.77   33.59   34.38   34.77   34.77   23.44   23.44   19.43   20.56   19.35   20.16   20.16   20.16   19.76

    54: AGZ83153.1   46.30   46.67   57.84   58.21   57.84   60.44   77.66   77.29   77.66   77.66   76.92   76.92   76.92   76.92   76.92   77.29   77.29   77.66   77.66   78.02   77.66   77.66   77.66   77.29   77.29   77.29   77.29   77.29   77.29   76.19   76.92   76.92   76.56   76.92   77.66   77.29   76.92   77.29   76.56   76.56   76.92   76.92   76.92   76.92   76.92   77.29   76.92   77.66   76.92   77.29   76.92   76.56   87.91  100.00   95.97   95.24   95.24   93.77   94.51   94.51   94.51   95.24   94.87   92.67   92.67   95.24   93.41   94.51   94.51   94.14   94.51   95.60   94.87   95.97   56.04   55.68   57.35   57.72   57.35   57.35   57.72   57.35   57.35   57.35   57.72   57.72   57.72   57.35   57.72   57.84   57.41   57.04   59.93   59.63   59.26   60.00   58.89   27.55   29.34   26.72   27.86   28.12   26.17   25.78   32.68   32.30   27.78   27.38   33.59   33.73   32.94   34.38   32.81   33.98   34.38   34.38   25.00   25.00   20.24   21.37   20.16   20.97   20.97   20.97   20.56

    55: AGW16408.1   46.67   47.04   57.46   57.84   57.46   62.27   77.29   76.92   77.29   77.29   76.56   76.56   76.56   76.56   76.56   76.92   76.92   77.29   77.29   77.66   77.29   77.29   77.29   76.92   76.92   76.92   76.92   76.92   76.92   75.82   76.56   76.56   76.19   76.56   77.29   76.92   76.56   76.92   76.19   76.19   76.56   76.56   76.56   76.56   76.56   76.92   76.56   77.29   76.56   76.92   76.56   76.19   88.64   95.97  100.00   97.80   97.80   97.07   97.07   97.07   97.07   97.80   97.44   95.24   95.24   94.87   95.24   96.34   96.34   96.70   96.34   96.70   96.70   97.80   56.04   55.68   58.46   58.82   58.46   58.46   58.82   58.46   58.46   58.46   58.82   58.82   58.82   58.46   58.82   58.58   57.41   57.41   60.30   60.00   60.00   60.37   60.00   27.55   28.96   26.72   27.86   27.34   25.39   25.00   32.28   31.91   27.38   26.98   33.59   33.73   32.94   34.77   33.20   34.38   34.77   34.77   23.44   23.44   18.62   19.76   18.55   19.35   19.35   19.35   18.95

    56: AGW16407.1   47.41   47.78   57.84   58.21   57.84   61.54   77.29   76.92   77.29   77.29   76.56   76.56   76.56   76.56   76.56   76.92   76.92   77.29   77.29   77.66   76.92   76.92   76.92   76.92   76.92   76.92   76.92   76.92   76.92   75.82   76.56   76.56   76.19   76.56   77.29   76.92   76.56   76.92   76.19   76.19   76.56   76.56   76.56   76.56   76.56   76.92   76.56   77.29   76.56   76.92   76.56   76.19   89.01   95.24   97.80  100.00   99.27   97.07   97.80   97.07   97.07   97.80   97.44   95.24   95.24   94.87   95.24   96.34   96.34   97.44   96.34   96.70   96.70   97.80   56.04   55.68   57.72   58.09   57.72   57.72   58.09   57.72   57.72   57.72   58.09   58.09   58.09   57.72   58.09   57.84   58.15   57.04   59.93   59.63   59.26   60.00   58.89   28.68   29.34   26.72   27.86   27.73   25.78   25.39   31.89   31.52   26.98   26.59   33.20   33.33   32.55   34.77   32.81   33.98   34.38   34.38   23.05   23.05   18.62   19.76   18.55   19.35   19.35   19.35   18.95

    57: AGW83450.1   47.04   47.41   57.46   57.84   57.46   61.17   77.29   76.92   77.29   77.29   76.56   76.56   76.56   76.56   76.56   76.92   76.92   77.29   77.29   77.66   76.92   76.92   76.92   76.92   76.92   76.92   76.92   76.92   76.92   75.82   76.56   76.56   76.19   76.56   77.29   76.92   76.56   76.92   76.19   76.19   76.56   76.56   76.56   76.56   76.56   76.92   76.56   77.29   76.56   76.92   76.56   76.19   89.01   95.24   97.80   99.27  100.00   97.80   98.53   97.07   97.07   97.80   97.44   95.24   95.24   94.87   95.24   96.34   96.34   97.44   96.34   96.70   96.70   97.80   56.04   55.68   58.46   58.82   58.46   58.46   58.82   58.46   58.46   58.46   58.82   58.82   58.82   58.46   58.46   58.58   58.15   57.04   59.93   59.63   59.26   60.00   58.89   28.68   29.34   26.72   27.86   27.73   25.78   25.39   31.50   31.52   26.98   26.59   33.59   33.33   32.55   34.77   32.81   33.98   34.38   34.38   23.05   23.05   18.62   19.76   18.55   19.35   19.35   19.35   18.95

    58: AGW16411.1   46.67   47.04   55.97   56.34   55.97   61.54   76.92   76.56   76.92   76.92   76.19   76.19   76.19   76.19   76.19   76.56   76.56   76.92   76.92   77.29   76.56   76.56   76.56   76.56   76.56   76.56   76.56   76.56   76.56   75.46   76.19   76.19   75.82   76.19   76.92   76.56   76.19   76.56   75.82   75.82   76.19   76.19   76.19   76.19   76.19   76.56   76.19   76.92   76.19   76.56   76.19   75.82   88.28   93.77   97.07   97.07   97.80  100.00   98.53   96.34   96.34   96.34   95.97   94.87   94.51   94.87   95.24   95.60   95.60   96.34   96.34   96.70   96.70   97.80   56.41   56.04   58.82   59.19   58.82   58.82   59.19   58.82   58.82   58.82   59.19   59.19   59.19   58.82   58.82   58.96   57.41   57.41   60.30   60.00   59.26   60.37   59.26   27.92   29.34   26.34   27.48   27.34   25.39   25.39   31.10   31.52   26.98   26.59   33.98   33.73   32.94   35.16   32.81   33.98   34.38   34.38   23.05   23.05   18.62   19.76   18.15   18.95   18.95   18.95   18.55

    59: AGW83452.1   47.04   47.41   57.09   57.46   57.09   61.54   77.29   76.92   77.29   77.29   76.56   76.56   76.56   76.56   76.56   76.92   76.92   77.29   77.29   77.66   76.92   76.92   76.92   76.92   76.92   76.92   76.92   76.92   76.92   75.82   76.56   76.56   76.19   76.56   77.29   76.92   76.56   76.92   76.19   76.19   76.56   76.56   76.56   76.56   76.56   76.92   76.56   77.29   76.56   76.92   76.56   76.19   88.28   94.51   97.07   97.80   98.53   98.53  100.00   97.07   96.34   97.44   97.07   95.24   94.87   94.87   95.97   95.97   95.60   97.44   96.34   96.70   96.70   97.80   57.14   56.78   58.82   59.19   58.82   58.82   59.19   58.82   58.82   58.82   59.19   59.19   59.19   58.82   58.82   58.96   57.78   57.41   60.30   60.00   59.63   60.37   59.26   28.68   29.34   26.34   27.48   27.34   25.78   25.78   31.10   31.52   26.98   26.59   33.59   33.33   32.55   34.38   32.81   33.98   34.38   34.38   23.05   23.05   18.62   19.76   18.55   19.35   19.35   19.35   18.95

    60: AGW83448.1   47.41   47.78   58.21   58.58   58.21   61.90   78.02   77.66   78.02   78.02   77.29   77.29   77.29   77.29   77.29   77.66   77.66   78.02   78.02   78.39   77.66   77.66   77.66   77.66   77.66   77.66   77.66   77.66   77.66   76.56   77.29   77.29   76.92   77.29   78.02   77.66   77.29   77.66   76.92   76.92   77.29   77.29   77.29   77.29   77.29   77.66   77.29   78.02   77.29   77.66   77.29   76.92   87.91   94.51   97.07   97.07   97.07   96.34   97.07  100.00   97.80   97.44   97.07   94.14   96.34   94.87   96.70   96.70   96.34   97.07   96.34   96.70   97.44   97.80   56.41   56.04   58.82   59.19   58.82   58.82   59.19   58.82   58.82   58.82   59.19   59.19   59.19   58.82   59.19   58.96   58.15   57.78   60.67   60.37   60.00   60.74   59.63   28.68   29.34   26.72   27.48   27.73   26.17   25.78   31.89   31.52   26.98   26.59   33.59   33.73   32.94   34.77   32.81   33.98   34.38   34.38   23.44   23.44   18.62   19.76   18.55   19.35   19.35   19.35   18.95

    61: AGW16413.1   46.67   47.04   58.21   58.58   58.21   61.17   77.29   76.92   77.29   77.29   76.56   76.56   76.56   76.56   76.56   76.92   77.29   77.29   77.29   77.66   76.92   76.92   76.92   77.66   77.66   77.66   77.66   77.66   77.66   75.82   76.56   76.56   76.19   76.56   77.29   76.92   76.56   76.92   76.19   76.19   76.56   76.56   76.56   76.56   76.56   76.92   76.56   77.29   76.56   76.92   76.56   76.19   88.28   94.51   97.07   97.07   97.07   96.34   96.34   97.80  100.00   98.53   98.17   94.51   95.97   94.87   95.60   97.07   96.34   96.34   96.34   97.44   98.17   97.80   55.68   55.31   58.82   59.19   58.82   58.82   59.19   58.82   58.82   58.82   59.19   59.19   59.19   58.82   59.19   58.96   57.04   56.67   59.55   59.26   58.89   59.63   58.52   28.68   28.96   26.34   27.48   27.34   25.39   25.00   31.50   31.91   26.59   26.19   33.20   33.33   32.55   34.38   32.42   33.59   33.98   33.98   22.66   22.66   19.03   20.16   18.95   19.76   19.76   19.76   19.35

    62: AGW83446.1   46.30   46.67   58.21   58.58   58.21   61.54   77.29   76.92   77.29   77.29   76.56   76.56   76.56   76.56   76.56   76.92   76.92   77.29   77.29   77.66   76.92   76.92   76.92   77.66   77.66   77.66   77.66   77.66   77.66   75.82   76.56   76.56   76.19   76.56   77.29   76.92   76.56   76.92   76.19   76.19   76.56   76.56   76.56   76.56   76.56   76.92   76.56   77.29   76.56   76.92   76.56   76.19   88.28   95.24   97.80   97.80   97.80   96.34   97.44   97.44   98.53  100.00   99.63   94.51   96.70   94.87   95.60   97.44   96.34   97.07   96.34   97.44   96.70   97.80   55.68   55.31   58.09   58.46   58.09   58.09   58.46   58.09   58.09   58.09   58.46   58.46   58.46   58.09   58.46   58.21   57.41   57.04   59.93   59.63   59.26   60.00   58.89   28.68   28.96   26.34   27.48   27.34   25.39   25.00   31.50   31.91   26.59   26.19   32.82   32.94   32.16   33.98   32.42   33.59   33.98   33.98   22.66   22.66   19.03   20.16   18.95   19.76   19.76   19.76   19.35

    63: AGW83449.1   46.30   46.67   58.21   58.58   58.21   61.54   76.92   76.56   76.92   76.92   76.19   76.19   76.19   76.19   76.19   76.56   76.56   76.92   76.92   77.29   76.56   76.56   76.56   77.29   77.29   77.29   77.29   77.29   77.29   75.46   76.19   76.19   75.82   76.19   76.92   76.56   76.19   76.56   75.82   75.82   76.19   76.19   76.19   76.19   76.19   76.56   76.19   76.92   76.19   76.56   76.19   75.82   88.64   94.87   97.44   97.44   97.44   95.97   97.07   97.07   98.17   99.63  100.00   94.14   96.34   94.51   95.24   97.07   95.97   96.70   95.97   97.07   96.34   97.44   55.68   55.31   58.09   58.46   58.09   58.09   58.46   58.09   58.09   58.09   58.46   58.46   58.46   58.09   58.46   58.21   57.41   57.04   59.93   59.63   59.26   60.00   58.89   28.68   28.96   26.34   27.48   27.34   25.39   25.00   31.50   32.30   26.59   26.19   32.82   32.94   32.16   33.98   32.42   33.59   33.98   33.98   22.66   22.66   19.03   20.16   18.95   19.76   19.76   19.76   19.35

    64: AGZ83155.1   46.67   47.04   57.84   58.21   57.84   61.90   77.29   76.92   77.29   77.29   76.56   76.56   76.56   76.56   76.56   76.92   77.66   77.29   77.29   77.66   76.92   76.92   76.92   76.92   76.92   76.92   76.92   76.92   76.92   75.82   76.56   76.56   76.19   76.56   77.29   76.92   76.56   76.92   76.19   76.19   76.56   76.56   76.56   76.56   76.56   76.92   76.56   77.29   76.56   76.92   76.56   76.19   89.74   92.67   95.24   95.24   95.24   94.87   95.24   94.14   94.51   94.51   94.14  100.00   92.31   93.41   94.51   94.14   95.24   94.51   94.87   95.24   95.60   96.34   56.78   56.41   58.82   59.19   58.82   58.82   59.19   58.82   58.82   58.82   59.19   59.19   59.19   58.82   59.19   58.96   57.78   57.41   60.30   60.00   60.37   60.37   60.00   27.55   28.57   26.72   27.48   26.95   25.00   24.61   31.89   31.13   26.19   25.79   32.82   32.94   32.16   34.38   33.20   33.98   34.38   34.38   23.05   23.05   18.22   19.35   18.15   18.95   18.95   18.95   18.55

    65: AGW83451.1   46.67   47.04   57.84   58.21   57.84   61.54   75.82   76.19   75.82   75.82   75.82   75.09   75.09   75.82   75.82   75.46   75.46   75.82   75.82   76.19   75.46   75.46   75.46   76.19   76.19   76.19   76.19   76.19   76.19   75.09   75.09   75.09   75.46   75.09   75.82   75.46   75.09   75.46   74.73   74.73   75.09   75.09   75.09   75.09   75.09   75.46   75.09   75.82   75.09   75.46   75.09   74.73   86.81   92.67   95.24   95.24   95.24   94.51   94.87   96.34   95.97   96.70   96.34   92.31  100.00   93.04   96.70   97.07   95.24   95.24   94.51   95.60   94.87   95.97   56.04   55.68   57.35   57.72   57.35   57.35   57.72   58.09   57.35   57.35   57.72   57.72   57.72   57.35   57.72   57.46   56.67   56.30   59.18   58.52   58.15   58.89   57.78   28.68   28.57   25.95   27.10   26.95   25.00   24.61   31.50   31.91   26.59   26.19   33.20   33.33   32.55   34.38   32.42   33.59   33.98   33.98   22.66   22.66   19.03   20.16   18.95   19.76   19.76   19.76   19.35

    66: AGW83447.1   46.30   46.67   57.46   57.84   57.46   61.54   78.02   77.66   78.02   77.66   76.92   77.29   77.29   76.92   76.92   77.66   77.66   77.66   77.66   78.02   77.29   77.29   77.29   76.92   77.66   77.66   77.66   77.66   77.66   75.82   76.56   76.56   76.92   77.29   78.02   77.66   76.92   77.66   76.92   76.92   77.29   77.29   77.29   77.29   77.29   77.66   77.29   78.02   77.29   77.66   77.29   76.92   87.18   95.24   94.87   94.87   94.87   94.87   94.87   94.87   94.87   94.87   94.51   93.41   93.04  100.00   94.51   94.87   94.87   95.60   97.07   96.70   96.70   97.07   56.04   55.68   57.72   58.09   57.72   57.72   58.09   57.72   57.72   57.72   58.09   58.09   58.09   57.72   58.09   57.84   58.15   57.78   59.93   59.63   59.26   60.00   58.89   27.92   29.73   27.10   27.86   28.12   25.78   25.39   32.28   31.13   25.79   25.40   32.43   32.55   31.76   33.98   32.03   33.20   33.59   33.59   23.44   23.44   18.62   19.76   18.55   19.35   19.35   19.35   18.95

    67: AGW16406.1   47.04   47.41   57.84   58.21   57.84   61.90   76.92   77.29   76.92   76.92   76.92   76.19   76.19   76.92   76.92   76.56   77.29   76.92   76.92   77.29   76.56   76.56   76.56   76.56   76.56   76.56   76.56   76.56   76.56   75.46   76.19   76.19   76.56   76.19   76.92   76.56   76.19   76.56   75.82   75.82   76.19   76.19   76.19   76.19   76.19   76.56   76.19   76.92   76.19   76.56   76.19   75.82   87.91   93.41   95.24   95.24   95.24   95.24   95.97   96.70   95.60   95.60   95.24   94.51   96.70   94.51  100.00   95.60   95.97   96.34   95.97   96.34   96.70   97.44   57.14   56.78   58.82   59.19   58.82   58.82   59.19   58.82   58.82   58.82   59.19   59.19   59.19   58.82   59.19   58.96   58.15   57.04   59.93   59.26   58.89   59.63   58.52   29.06   28.96   26.34   27.48   27.34   25.78   25.39   31.50   31.52   26.59   26.19   33.59   33.73   32.94   34.77   32.81   33.98   34.38   34.38   23.05   23.05   19.43   20.16   18.95   19.76   19.76   19.76   19.35

    68: AGW16412.1   47.04   47.41   58.58   58.96   58.58   62.27   77.29   76.92   77.29   77.29   76.56   76.56   76.56   76.56   76.56   76.92   76.92   77.29   77.29   77.66   76.92   76.92   76.92   77.66   77.66   77.66   77.66   77.66   77.66   76.56   76.56   76.56   76.19   76.56   77.29   76.92   76.56   76.92   76.19   76.19   76.56   76.56   76.56   76.56   76.56   76.92   76.56   77.29   76.56   76.92   76.56   76.19   87.91   94.51   96.34   96.34   96.34   95.60   95.97   96.70   97.07   97.44   97.07   94.14   97.07   94.87   95.60  100.00   96.34   95.97   96.34   97.44   96.70   97.80   56.78   56.41   58.09   58.46   58.09   58.09   58.46   58.82   58.09   58.09   58.46   58.46   58.46   58.09   58.46   58.21   58.15   57.78   60.30   60.37   60.00   60.74   59.63   28.68   28.96   26.34   27.48   27.34   25.39   25.00   31.50   31.91   26.19   25.79   33.20   33.33   32.55   34.38   32.42   33.59   33.98   33.98   22.66   22.66   18.62   19.76   18.55   19.35   19.35   19.35   18.95

    69: AGW16410.1   46.67   47.04   57.84   58.21   57.84   62.64   77.66   77.29   77.66   77.66   76.56   76.92   76.92   76.92   76.92   77.29   77.29   77.66   77.66   78.02   77.29   77.29   77.29   77.29   77.29   77.29   77.29   77.29   77.29   76.19   76.92   76.92   76.56   76.56   77.29   76.92   76.56   76.92   76.19   76.19   76.92   76.92   76.92   76.92   76.92   77.29   76.92   77.66   76.92   77.29   76.92   76.56   88.64   94.51   96.34   96.34   96.34   95.60   95.60   96.34   96.34   96.34   95.97   95.24   95.24   94.87   95.97   96.34  100.00   95.60   96.34   96.70   96.70   97.80   56.41   56.04   58.82   59.19   58.82   58.82   59.19   58.82   58.82   58.82   59.19   59.19   59.19   58.82   59.19   58.96   58.15   57.78   60.30   60.00   59.63   60.37   59.26   28.30   28.57   27.10   27.86   27.34   26.17   25.78   31.50   31.13   26.59   26.19   33.20   33.33   32.55   34.77   32.42   33.20   33.59   33.59   23.05   23.05   18.22   19.35   18.15   18.95   18.95   18.95   18.55

    70: AGW16404.1   47.78   48.15   58.21   58.58   58.21   61.90   77.66   77.66   77.66   77.29   76.92   76.92   76.92   76.92   76.92   77.29   77.29   77.29   77.29   77.66   76.92   76.92   76.92   77.29   77.29   77.29   77.29   77.29   77.29   76.19   76.92   76.92   76.92   76.92   77.66   77.29   76.56   77.29   76.56   76.56   76.92   76.92   76.92   76.92   76.92   77.29   76.92   77.66   76.92   77.29   76.92   76.56   87.91   94.14   96.70   97.44   97.44   96.34   97.44   97.07   96.34   97.07   96.70   94.51   95.24   95.60   96.34   95.97   95.60  100.00   97.07   97.44   97.44   97.80   56.78   56.41   58.09   58.46   58.09   58.09   58.46   58.09   58.09   58.09   58.46   58.46   58.46   58.09   58.46   58.21   58.52   57.41   60.30   60.00   59.63   60.37   59.26   29.06   28.96   26.34   27.48   27.34   25.78   25.39   31.89   31.52   26.98   26.59   33.20   33.33   32.55   34.38   32.42   33.59   33.98   33.98   23.05   23.05   18.62   19.76   18.55   19.35   19.35   19.35   18.95

    71: AGZ83154.1   47.04   47.41   58.21   58.58   58.21   62.64   79.12   78.75   79.12   78.75   78.39   78.39   78.39   78.02   78.02   78.75   78.75   78.75   78.75   79.12   78.39   78.39   78.39   78.39   79.12   79.12   79.12   79.12   79.12   77.29   78.02   78.02   78.39   78.75   79.49   79.12   78.39   79.12   78.02   78.02   78.75   78.39   78.39   78.39   78.39   78.75   78.39   79.12   78.39   78.75   78.39   78.02   88.64   94.51   96.34   96.34   96.34   96.34   96.34   96.34   96.34   96.34   95.97   94.87   94.51   97.07   95.97   96.34   96.34   97.07  100.00   98.17   98.17   98.53   56.78   56.41   58.09   58.46   58.09   58.09   58.46   58.09   58.09   58.09   58.46   58.46   58.46   58.09   58.46   58.21   58.52   58.15   61.42   60.74   60.74   61.11   60.00   28.30   29.73   27.10   27.86   28.12   25.78   25.39   31.89   31.52   26.19   25.79   33.20   33.33   32.55   33.98   32.03   33.20   33.59   33.59   23.05   23.05   18.22   19.35   18.15   18.95   18.95   18.95   18.55

    72: AGW16409.1   47.41   47.78   58.21   58.58   58.21   61.90   78.02   77.66   78.02   77.66   76.92   77.29   77.29   76.92   76.92   77.66   77.66   77.66   77.66   78.02   77.29   77.29   77.29   78.39   78.39   78.39   78.39   78.39   78.39   76.56   77.29   77.29   76.92   77.29   78.02   77.66   76.92   77.66   76.92   76.92   77.29   77.29   77.29   77.29   77.29   77.66   77.29   78.02   77.29   77.66   77.29   76.92   88.28   95.60   96.70   96.70   96.70   96.70   96.70   96.70   97.44   97.44   97.07   95.24   95.60   96.70   96.34   97.44   96.70   97.44   98.17  100.00   98.53   98.90   56.41   56.04   58.46   58.82   58.46   58.46   58.82   58.46   58.46   58.46   58.82   58.82   58.82   58.46   58.82   58.96   58.15   57.78   60.67   60.37   60.00   60.74   59.63   28.30   28.96   26.34   27.48   27.34   25.39   25.00   31.10   31.91   26.19   25.79   32.82   32.94   32.16   33.59   31.64   32.81   33.20   33.20   22.66   22.66   19.03   20.16   18.95   19.76   19.76   19.76   19.35

    73: AGW16405.1   47.41   47.78   57.84   58.21   57.84   62.27   78.75   78.39   78.75   78.39   77.66   78.02   78.02   77.66   77.66   78.39   78.75   78.39   78.39   78.75   78.02   78.02   78.02   78.39   78.39   78.39   78.39   78.39   78.39   77.29   78.02   78.02   77.66   78.02   78.75   78.39   77.66   78.39   77.66   77.66   78.02   78.02   78.02   78.02   78.02   78.39   78.02   78.75   78.02   78.39   78.02   77.66   88.64   94.87   96.70   96.70   96.70   96.70   96.70   97.44   98.17   96.70   96.34   95.60   94.87   96.70   96.70   96.70   96.70   97.44   98.17   98.53  100.00   98.90   57.14   56.78   59.56   59.93   59.56   59.56   59.93   59.56   59.56   59.56   59.93   59.93   59.93   59.56   59.93   59.70   58.15   57.78   60.67   60.37   60.00   60.74   59.63   28.30   29.34   26.72   27.86   27.73   25.78   25.39   31.89   31.52   26.59   26.19   33.59   33.73   32.94   34.38   32.42   33.59   33.98   33.98   23.05   23.05   18.62   19.76   18.55   19.35   19.35   19.35   18.95

    74: AGW16414.1   47.41   47.78   57.84   58.21   57.84   62.64   78.39   78.02   78.39   78.39   77.66   77.66   77.66   77.66   77.66   78.02   78.02   78.39   78.39   78.75   78.02   78.02   78.02   78.02   78.02   78.02   78.02   78.02   78.02   76.92   77.66   77.66   77.29   77.66   78.39   78.02   77.66   78.02   77.29   77.29   77.66   77.66   77.66   77.66   77.66   78.02   77.66   78.39   77.66   78.02   77.66   77.29   89.38   95.97   97.80   97.80   97.80   97.80   97.80   97.80   97.80   97.80   97.44   96.34   95.97   97.07   97.44   97.80   97.80   97.80   98.53   98.90   98.90  100.00   57.14   56.78   58.82   59.19   58.82   58.82   59.19   58.82   58.82   58.82   59.19   59.19   59.19   58.82   59.19   58.96   58.52   58.15   61.05   60.74   60.37   61.11   60.00   28.30   29.34   26.72   27.86   27.73   25.78   25.39   31.89   31.52   26.59   26.19   33.59   33.73   32.94   34.77   32.81   33.98   34.38   34.38   23.05   23.05   18.62   19.76   18.55   19.35   19.35   19.35   18.95

    75: AGW16415.1   54.61   54.98   55.39   56.13   55.76   55.31   57.88   57.88   57.14   57.51   58.24   57.14   56.78   57.88   57.88   57.14   57.51   57.88   57.88   58.24   57.88   57.51   57.88   57.14   56.78   57.14   57.14   57.14   57.14   58.24   57.88   57.88   57.14   57.14   57.51   57.51   57.51   57.88   57.88   58.24   56.78   56.78   57.14   57.14   56.78   57.14   56.78   57.51   57.14   57.51   57.51   57.51   57.51   56.04   56.04   56.04   56.04   56.41   57.14   56.41   55.68   55.68   55.68   56.78   56.04   56.04   57.14   56.78   56.41   56.78   56.78   56.41   57.14   57.14  100.00   93.80   54.78   55.15   54.78   54.78   55.15   55.15   54.78   55.15   54.78   55.15   55.15   54.78   55.15   54.85   59.26   57.78   59.55   59.26   59.63   60.37   61.11   32.71   31.54   30.42   30.80   31.13   29.18   29.18   33.73   35.27   31.23   30.83   35.38   35.55   34.77   37.35   35.80   36.58   36.58   36.58   24.90   24.90   21.05   21.37   20.56   21.77   21.77   21.77   20.97

    76: AGW16416.1   53.87   54.24   56.13   56.88   56.51   54.95   57.51   57.51   56.78   57.14   57.88   56.78   56.41   57.51   57.51   56.78   57.14   57.51   57.51   57.88   57.51   57.14   57.51   56.78   56.41   56.78   56.78   56.78   56.78   57.88   57.51   57.51   56.78   56.78   57.14   57.14   57.14   57.51   57.51   57.88   56.78   56.41   56.78   56.78   56.41   56.78   56.41   57.14   56.78   57.14   57.14   57.14   57.14   55.68   55.68   55.68   55.68   56.04   56.78   56.04   55.31   55.31   55.31   56.41   55.68   55.68   56.78   56.41   56.04   56.41   56.41   56.04   56.78   56.78   93.80  100.00   55.88   56.25   56.62   56.25   56.25   56.25   55.88   56.25   55.88   56.25   56.25   55.88   56.25   55.97   59.26   58.15   60.30   59.63   60.00   60.74   61.85   33.08   31.15   30.80   30.80   30.35   28.79   28.79   33.33   33.72   30.83   30.43   34.62   34.77   33.98   36.96   35.41   36.19   36.19   36.19   25.29   25.29   21.46   21.77   20.97   22.18   22.18   22.18   21.37

    77: ADK35870.1   47.78   48.15   56.34   55.60   55.97   59.19   57.51   57.51   57.14   57.51   57.14   56.78   56.78   57.51   57.51   57.51   57.14   57.51   57.14   57.51   57.88   57.51   57.88   57.51   56.78   56.78   56.78   57.14   57.14   56.41   57.14   57.14   56.78   56.04   56.78   56.78   56.41   56.41   57.14   57.14   57.14   56.78   56.78   57.14   56.78   57.14   56.78   57.51   57.14   57.51   57.51   57.51   57.72   57.35   58.46   57.72   58.46   58.82   58.82   58.82   58.82   58.09   58.09   58.82   57.35   57.72   58.82   58.09   58.82   58.09   58.09   58.46   59.56   58.82   54.78   55.88  100.00   99.27   99.27   99.27   99.27   99.27   99.27   99.27   99.27   99.27   99.27   99.27   99.27   99.26   57.41   57.78   59.93   60.37   60.00   61.11   60.74   31.06   32.17   29.12   29.12   30.59   29.02   29.02   31.23   34.77   27.09   26.69   35.27   35.43   34.65   34.12   32.94   33.33   33.73   33.73   20.70   20.70   20.24   19.35   19.35   19.76   19.76   19.76   19.76

    78: ADK35871.1   48.15   48.52   56.72   55.97   56.34   59.56   57.88   57.88   57.51   57.88   57.51   57.14   57.14   57.88   57.88   57.88   57.51   57.88   57.51   57.88   58.24   57.88   58.24   57.88   57.14   57.14   57.14   57.51   57.51   56.78   57.51   57.51   57.14   56.41   57.14   57.14   56.78   56.78   57.51   57.51   57.51   57.14   57.14   57.51   57.14   57.51   57.14   57.88   57.51   57.88   57.88   57.88   58.09   57.72   58.82   58.09   58.82   59.19   59.19   59.19   59.19   58.46   58.46   59.19   57.72   58.09   59.19   58.46   59.19   58.46   58.46   58.82   59.93   59.19   55.15   56.25   99.27  100.00   99.27   99.27   99.27   99.27   99.27   99.27   99.27   99.27   99.27   99.27   99.27   99.26   57.41   57.78   59.93   60.37   60.00   61.11   60.74   30.68   32.17   29.12   29.12   30.59   29.02   29.02   31.23   34.77   27.09   26.69   35.66   35.83   35.04   34.51   33.33   33.73   34.12   34.12   20.70   20.70   20.24   19.35   19.35   19.76   19.76   19.76   19.76

    79: ADK35872.1   48.15   48.52   56.34   55.60   55.97   59.19   57.51   57.51   57.14   57.51   57.14   56.78   56.78   57.51   57.51   57.51   57.14   57.51   57.14   57.51   57.88   57.51   57.88   57.51   56.78   56.78   56.78   57.14   57.14   56.41   57.14   57.14   56.78   56.04   56.78   56.78   56.41   56.41   57.14   57.14   57.14   56.78   56.78   57.14   56.78   57.14   56.78   57.51   57.14   57.51   57.51   57.51   57.72   57.35   58.46   57.72   58.46   58.82   58.82   58.82   58.82   58.09   58.09   58.82   57.35   57.72   58.82   58.09   58.82   58.09   58.09   58.46   59.56   58.82   54.78   56.62   99.27   99.27  100.00   99.63   99.27   99.27   99.27   99.27   99.27   99.27   99.27   99.27   99.27   99.26   57.41   57.78   59.93   60.37   60.00   61.11   60.74   30.68   32.17   29.12   29.12   30.59   29.02   29.02   31.23   34.77   27.09   26.69   35.66   35.83   35.04   34.51   33.33   33.73   34.12   34.12   20.70   20.70   20.24   19.35   19.35   19.76   19.76   19.76   19.76

    80: AJT57878.1   48.15   48.52   56.34   55.60   55.97   59.19   57.51   57.51   57.14   57.51   57.14   56.78   56.78   57.51   57.51   57.51   57.14   57.51   57.14   57.51   57.88   57.51   57.88   57.51   56.78   56.78   56.78   57.14   57.14   56.41   57.14   57.14   56.78   56.04   56.78   56.78   56.41   56.41   57.14   57.14   57.14   56.78   56.78   57.14   56.78   57.14   56.78   57.51   57.14   57.51   57.51   57.51   57.72   57.35   58.46   57.72   58.46   58.82   58.82   58.82   58.82   58.09   58.09   58.82   57.35   57.72   58.82   58.09   58.82   58.09   58.09   58.46   59.56   58.82   54.78   56.25   99.27   99.27   99.63  100.00   99.27   99.27   99.27   99.27   99.27   99.27   99.27   99.27   99.27   99.26   57.41   57.78   59.93   60.37   60.00   61.11   60.74   30.68   32.17   29.12   29.12   30.59   29.02   29.02   31.23   34.77   27.09   26.69   35.66   35.83   35.04   34.51   33.33   33.73   34.12   34.12   20.70   20.70   20.24   19.35   19.35   19.76   19.76   19.76   19.76

    81: ADK35873.1   48.15   48.52   56.72   55.97   56.34   59.56   57.88   57.88   57.51   57.88   57.51   57.14   57.14   57.88   57.88   57.88   57.51   57.88   57.51   57.88   58.24   57.88   58.24   57.88   57.14   57.14   57.14   57.51   57.51   56.78   57.51   57.51   57.14   56.41   57.14   57.14   56.78   56.78   57.51   57.51   57.51   57.14   57.14   57.51   57.14   57.51   57.14   57.88   57.51   57.88   57.88   57.88   58.09   57.72   58.82   58.09   58.82   59.19   59.19   59.19   59.19   58.46   58.46   59.19   57.72   58.09   59.19   58.46   59.19   58.46   58.46   58.82   59.93   59.19   55.15   56.25   99.27   99.27   99.27   99.27  100.00   99.27   99.27   99.27   99.27   99.27   99.27   99.27   99.27   99.26   57.78   58.15   60.30   60.74   60.37   61.48   61.11   30.68   32.17   29.12   29.12   30.59   29.02   29.02   31.23   34.77   27.09   26.69   35.66   35.83   35.04   34.51   33.33   33.73   34.12   34.12   20.70   20.70   20.65   19.76   19.35   19.76   19.76   19.76   19.76

    82: ADK35874.1   48.15   48.52   56.72   55.97   56.34   59.19   57.51   57.51   57.14   57.51   57.14   56.78   56.78   57.51   57.51   57.51   57.14   57.51   57.14   57.51   57.88   57.51   57.88   57.51   56.78   56.78   56.78   57.14   57.14   56.41   57.14   57.14   56.78   56.04   56.78   56.78   56.41   56.41   57.14   57.14   57.14   56.78   56.78   57.14   56.78   57.14   56.78   57.51   57.14   57.51   57.51   57.51   57.72   57.35   58.46   57.72   58.46   58.82   58.82   58.82   58.82   58.09   58.09   58.82   58.09   57.72   58.82   58.82   58.82   58.09   58.09   58.46   59.56   58.82   55.15   56.25   99.27   99.27   99.27   99.27   99.27  100.00   99.27   99.27   99.27   99.27   99.27   99.27   99.27   99.26   57.41   57.78   59.93   60.37   60.00   61.11   60.74   30.68   32.17   29.12   29.12   30.59   29.02   29.02   31.23   34.77   27.09   26.69   35.66   35.83   35.04   34.51   33.33   33.73   34.12   34.12   20.70   20.70   19.84   18.95   18.95   19.35   19.35   19.35   19.35

    83: AIT76095.1   47.78   48.15   56.34   55.60   55.97   59.19   57.51   57.51   57.14   57.51   57.14   56.78   56.78   57.51   57.51   57.51   57.14   57.51   57.14   57.51   57.88   57.51   57.88   57.51   56.78   56.78   56.78   57.14   57.14   56.41   57.14   57.14   56.78   56.04   56.78   56.78   56.41   56.41   57.14   57.14   57.14   56.78   56.78   57.14   56.78   57.14   56.78   57.51   57.14   57.51   58.24   57.88   57.72   57.35   58.46   57.72   58.46   58.82   58.82   58.82   58.82   58.09   58.09   58.82   57.35   57.72   58.82   58.09   58.82   58.09   58.09   58.46   59.56   58.82   54.78   55.88   99.27   99.27   99.27   99.27   99.27   99.27  100.00   99.27   99.27   99.27   99.27   99.27   99.27   99.26   57.41   57.78   59.93   60.37   60.00   61.11   60.74   30.68   32.17   28.74   28.74   30.20   28.63   28.63   30.83   34.77   27.09   26.69   35.27   35.43   35.04   34.12   32.94   33.33   33.73   33.73   20.70   20.70   20.24   19.35   19.35   19.76   19.76   19.76   19.76

    84: AIY30331.1   48.15   48.52   56.34   55.60   55.97   59.56   57.88   57.88   57.51   57.88   57.51   57.14   57.14   57.88   57.88   57.88   57.51   57.88   57.51   57.88   58.24   57.88   58.24   57.88   57.14   57.14   57.14   57.51   57.51   56.78   57.51   57.51   57.14   56.41   57.14   57.14   56.78   56.78   57.51   57.51   57.51   57.14   57.14   57.51   57.14   57.51   57.14   57.88   57.51   57.88   57.88   57.88   58.09   57.35   58.46   57.72   58.46   58.82   58.82   58.82   58.82   58.09   58.09   58.82   57.35   57.72   58.82   58.09   58.82   58.09   58.09   58.46   59.56   58.82   55.15   56.25   99.27   99.27   99.27   99.27   99.27   99.27   99.27  100.00   99.27   99.27   99.27   99.27   99.27   99.26   57.41   57.78   59.93   60.37   60.00   61.11   60.74   30.68   32.17   29.12   29.12   30.59   29.02   29.02   30.83   34.77   27.09   26.69   35.66   35.83   35.04   34.51   33.33   33.73   34.12   34.12   20.70   20.70   20.24   19.35   19.35   19.76   19.76   19.76   19.76

    85: AIY30332.1   47.78   48.15   56.34   55.60   55.97   59.19   57.88   57.88   57.51   57.88   57.51   57.14   57.14   57.88   57.88   57.88   57.51   57.88   57.51   57.88   58.24   57.88   58.24   57.88   57.14   57.14   57.14   57.51   57.51   56.78   57.51   57.51   57.14   56.41   57.14   57.14   56.78   56.78   57.51   57.51   57.51   57.14   57.14   57.51   57.14   57.51   57.14   57.88   57.51   57.88   57.51   57.51   58.09   57.72   58.82   58.09   58.82   59.19   59.19   59.19   59.19   58.46   58.46   59.19   57.72   58.09   59.19   58.46   59.19   58.46   58.46   58.82   59.93   59.19   54.78   55.88   99.27   99.27   99.27   99.27   99.27   99.27   99.27   99.27  100.00   99.27   99.27   99.27   99.27   99.26   57.41   57.78   59.93   60.37   60.00   61.11   60.74   30.30   32.17   29.12   29.12   30.59   29.02   29.02   30.83   34.38   26.69   26.29   35.27   35.43   34.65   34.12   32.94   33.33   33.73   33.73   20.31   20.31   19.84   18.95   18.95   19.35   19.35   19.35   19.35

    86: AJO16038.1   48.15   48.52   56.72   55.97   56.34   59.56   57.88   57.88   57.51   57.88   57.51   57.14   57.14   57.88   57.88   57.88   57.51   57.88   57.51   57.88   58.24   57.88   58.24   57.88   57.14   57.14   57.14   57.51   57.51   56.78   57.51   57.51   57.14   56.41   57.14   57.14   56.78   56.78   57.51   57.51   57.51   57.14   57.14   57.51   57.14   57.51   57.14   57.88   57.51   57.88   57.88   57.88   58.09   57.72   58.82   58.09   58.82   59.19   59.19   59.19   59.19   58.46   58.46   59.19   57.72   58.09   59.19   58.46   59.19   58.46   58.46   58.82   59.93   59.19   55.15   56.25   99.27   99.27   99.27   99.27   99.27   99.27   99.27   99.27   99.27  100.00   99.27   99.27   99.27   99.26   57.78   58.15   60.30   60.74   60.37   61.48   61.11   30.68   32.17   29.12   29.12   30.59   29.02   29.02   30.83   34.77   27.09   26.69   35.66   35.83   35.04   34.51   33.33   33.73   34.12   34.12   20.70   20.70   20.24   19.35   19.35   19.76   19.76   19.76   19.76

    87: AKF41839.1   48.15   48.52   56.72   55.97   56.34   59.56   57.88   57.88   57.51   57.88   57.51   57.14   57.14   57.88   57.88   57.88   57.51   57.88   57.51   57.88   58.24   57.88   58.24   57.88   57.14   57.14   57.14   57.51   57.51   56.78   57.51   57.51   57.14   56.41   57.14   57.14   56.78   56.78   57.51   57.51   57.51   57.14   57.14   57.51   57.14   57.51   57.14   57.88   57.51   57.88   57.88   57.88   58.09   57.72   58.82   58.09   58.82   59.19   59.19   59.19   59.19   58.46   58.46   59.19   57.72   58.09   59.19   58.46   59.19   58.46   58.46   58.82   59.93   59.19   55.15   56.25   99.27   99.27   99.27   99.27   99.27   99.27   99.27   99.27   99.27   99.27  100.00   99.27   99.27   99.26   57.78   58.15   60.30   60.74   60.37   61.48   61.11   30.68   32.17   29.12   29.12   30.59   29.02   29.02   31.23   34.77   27.09   26.69   36.05   36.22   35.43   34.90   33.73   34.12   34.51   34.51   20.70   20.70   20.24   19.35   19.35   19.76   19.76   19.76   19.76

    88: AKF41840.1   47.78   48.15   56.34   55.60   55.97   59.19   57.51   57.51   57.14   57.51   57.14   56.78   56.78   57.51   57.51   57.51   57.14   57.51   57.14   57.51   57.88   57.51   57.88   57.51   56.78   56.78   56.78   57.14   57.14   56.41   57.14   57.14   56.78   56.04   56.78   56.78   56.41   56.41   57.14   57.14   57.14   56.78   56.78   57.14   56.78   57.14   56.78   57.51   57.14   57.51   57.51   57.51   57.72   57.35   58.46   57.72   58.46   58.82   58.82   58.82   58.82   58.09   58.09   58.82   57.35   57.72   58.82   58.09   58.82   58.09   58.09   58.46   59.56   58.82   54.78   55.88   99.27   99.27   99.27   99.27   99.27   99.27   99.27   99.27   99.27   99.27   99.27  100.00   99.27   99.26   57.41   57.78   59.93   60.37   60.00   61.11   60.74   30.30   32.56   29.50   29.50   30.59   29.02   29.02   30.83   34.38   26.69   26.29   35.27   35.43   34.65   34.12   32.94   33.33   33.73   33.73   20.31   20.31   19.84   18.95   18.95   19.35   19.35   19.35   19.35

    89: AKR53962.1   48.15   48.52   56.72   55.97   56.34   59.56   57.88   57.88   57.51   57.88   57.51   57.14   57.14   57.88   57.88   57.88   57.51   57.88   57.51   57.88   58.24   57.88   58.24   57.88   57.14   57.14   57.14   57.51   57.51   56.78   57.51   57.51   57.14   56.41   57.14   57.14   56.78   56.78   57.51   57.51   57.51   57.14   57.14   57.51   57.14   57.51   57.14   57.88   57.51   57.88   57.88   57.88   58.09   57.72   58.82   58.09   58.46   58.82   58.82   59.19   59.19   58.46   58.46   59.19   57.72   58.09   59.19   58.46   59.19   58.46   58.46   58.82   59.93   59.19   55.15   56.25   99.27   99.27   99.27   99.27   99.27   99.27   99.27   99.27   99.27   99.27   99.27   99.27  100.00   99.26   57.78   58.15   60.30   60.74   60.37   61.48   61.11   30.68   32.17   29.50   29.50   30.98   29.41   29.41   31.23   34.77   27.09   26.69   35.27   35.83   35.04   34.51   33.33   33.73   34.12   34.12   20.70   20.70   20.24   19.35   19.35   19.76   19.76   19.76   19.76

    90: AKF41838.1   48.50   48.87   57.20   56.44   56.82   58.96   57.62   57.62   57.25   57.62   57.25   56.88   56.88   57.62   57.62   57.62   57.25   57.62   57.25   57.62   57.99   57.62   57.99   57.62   56.88   56.88   56.88   57.25   57.25   56.88   57.25   57.25   56.88   56.13   56.88   56.88   56.51   56.51   57.25   57.25   57.25   56.88   56.88   57.25   56.88   57.25   56.88   57.62   57.25   57.62   57.62   57.62   57.84   57.84   58.58   57.84   58.58   58.96   58.96   58.96   58.96   58.21   58.21   58.96   57.46   57.84   58.96   58.21   58.96   58.21   58.21   58.96   59.70   58.96   54.85   55.97   99.26   99.26   99.26   99.26   99.26   99.26   99.26   99.26   99.26   99.26   99.26   99.26   99.26  100.00   58.27   58.65   60.84   61.28   60.90   62.03   61.65   30.77   31.89   28.79   28.79   30.28   29.08   29.08   30.52   34.52   27.53   27.13   35.43   35.60   34.80   33.86   32.67   33.07   33.47   33.47   20.63   20.24   20.58   19.67   19.67   20.08   20.08   20.08   20.08

    91: AFH36332.1   52.77   53.14   58.89   59.26   59.63   55.93   55.35   55.35   54.98   55.72   55.72   54.98   54.61   55.35   55.72   55.35   54.98   56.46   55.72   56.09   55.72   55.35   55.35   55.35   54.98   54.98   54.98   54.61   54.98   55.72   55.72   55.72   54.98   54.98   55.35   55.35   55.35   55.72   55.35   55.72   56.09   55.35   55.72   55.72   55.35   55.72   55.35   56.09   55.72   56.09   56.09   56.09   57.78   57.41   57.41   58.15   58.15   57.41   57.78   58.15   57.04   57.41   57.41   57.78   56.67   58.15   58.15   58.15   58.15   58.52   58.52   58.15   58.15   58.52   59.26   59.26   57.41   57.41   57.41   57.41   57.78   57.41   57.41   57.41   57.41   57.78   57.78   57.41   57.78   58.27  100.00   93.12   86.08   86.59   86.23   88.04   89.13   29.55   31.91   29.23   29.62   29.53   27.56   27.56   30.20   33.98   28.24   27.84   33.72   33.86   33.07   35.02   33.59   34.38   34.77   34.77   21.01   21.01   21.12   21.03   20.24   20.63   20.63   20.63   20.24

    92: AGZ83156.1   51.66   52.03   57.41   57.78   58.15   56.67   55.35   55.35   54.98   55.72   55.72   54.98   54.61   55.35   55.72   55.35   54.98   56.46   55.72   56.09   55.72   55.35   55.35   55.35   54.98   54.98   54.98   54.61   54.98   55.72   55.72   55.72   54.98   54.98   55.35   55.35   55.35   55.72   55.35   55.72   56.09   55.72   55.72   55.72   55.72   55.72   55.35   56.09   55.72   56.09   56.09   56.09   57.78   57.04   57.41   57.04   57.04   57.41   57.41   57.78   56.67   57.04   57.04   57.41   56.30   57.78   57.04   57.78   57.78   57.41   58.15   57.78   57.78   58.15   57.78   58.15   57.78   57.78   57.78   57.78   58.15   57.78   57.78   57.78   57.78   58.15   58.15   57.78   58.15   58.65   93.12  100.00   86.81   87.68   86.23   88.04   88.04   27.65   30.74   27.69   28.08   28.35   25.98   25.98   28.63   33.20   27.84   27.45   32.17   32.28   31.50   34.24   32.03   32.42   32.81   32.81   21.01   21.01   20.72   21.83   20.24   20.63   20.63   20.63   20.24

    93: AGW16417.1   52.99   53.36   58.43   58.80   59.18   56.55   60.07   59.33   58.96   59.70   59.70   58.96   58.58   59.33   59.70   59.33   58.96   60.45   59.70   60.07   59.70   59.33   59.33   59.33   58.96   58.96   58.96   58.96   58.96   59.70   59.70   59.70   58.96   58.96   59.33   59.33   59.33   59.70   59.33   59.70   60.07   59.33   59.70   59.70   59.33   59.70   59.33   60.07   59.70   60.07   60.07   60.07   59.93   59.93   60.30   59.93   59.93   60.30   60.30   60.67   59.55   59.93   59.93   60.30   59.18   59.93   59.93   60.30   60.30   60.30   61.42   60.67   60.67   61.05   59.55   60.30   59.93   59.93   59.93   59.93   60.30   59.93   59.93   59.93   59.93   60.30   60.30   59.93   60.30   60.84   86.08   86.81  100.00   93.04   93.77   93.04   92.67   28.74   31.10   28.40   28.02   28.69   25.90   25.90   28.97   33.99   28.17   27.78   32.55   32.67   31.87   35.04   33.20   33.60   33.99   33.99   20.87   20.87   20.56   21.69   20.48   20.88   20.88   20.88   20.48

    94: AHA11124.1   52.40   52.77   57.78   58.15   58.52   57.41   58.30   58.30   57.93   58.67   58.67   57.93   57.56   58.30   58.67   58.30   57.93   59.41   58.67   59.04   58.67   58.30   58.30   58.30   57.93   57.93   57.93   57.93   57.93   58.67   58.67   58.67   57.93   57.93   58.30   58.30   58.67   58.67   58.30   58.67   59.04   58.30   58.67   58.67   58.30   58.67   58.30   59.04   58.67   59.04   59.04   59.04   59.26   59.63   60.00   59.63   59.63   60.00   60.00   60.37   59.26   59.63   59.63   60.00   58.52   59.63   59.26   60.37   60.00   60.00   60.74   60.37   60.37   60.74   59.26   59.63   60.37   60.37   60.37   60.37   60.74   60.37   60.37   60.37   60.37   60.74   60.74   60.37   60.74   61.28   86.59   87.68   93.04  100.00   92.39   92.39   93.48   27.65   31.13   28.08   27.69   27.95   25.59   25.59   29.41   33.20   27.45   27.06   32.17   32.28   31.50   33.46   32.42   32.81   33.20   33.20   20.23   20.23   19.92   21.03   19.84   20.24   20.24   20.24   19.84

    95: ALM26450.1   53.14   53.51   59.26   59.63   60.00   57.04   58.30   58.30   57.93   58.67   58.67   57.93   57.56   58.30   58.67   58.30   57.93   59.41   58.67   59.04   58.67   58.30   58.30   58.30   57.93   57.93   57.93   57.93   57.93   58.67   58.67   58.67   57.93   57.93   58.30   58.30   58.30   58.67   58.30   58.67   59.04   58.30   58.67   58.67   58.30   58.67   58.30   59.04   58.67   59.04   59.04   59.04   59.63   59.26   60.00   59.26   59.26   59.26   59.63   60.00   58.89   59.26   59.26   60.37   58.15   59.26   58.89   60.00   59.63   59.63   60.74   60.00   60.00   60.37   59.63   60.00   60.00   60.00   60.00   60.00   60.37   60.00   60.00   60.00   60.00   60.37   60.37   60.00   60.37   60.90   86.23   86.23   93.77   92.39  100.00   91.30   93.84   28.03   30.74   27.69   27.69   27.56   25.59   25.59   29.41   33.20   27.13   26.74   31.78   31.89   31.10   32.68   32.03   32.81   33.20   33.20   20.62   20.62   19.44   20.55   18.97   19.37   19.37   19.37   18.97

    96: AHA11125.1   53.14   53.51   59.63   60.00   60.37   58.52   58.30   58.30   57.93   58.67   58.67   57.93   57.56   58.30   58.67   58.30   57.93   59.41   58.67   59.04   58.67   58.30   58.30   58.30   57.93   57.93   57.93   57.93   57.93   58.67   58.67   58.67   57.93   57.93   58.30   58.30   58.30   58.67   58.30   58.67   59.04   58.30   58.67   58.67   58.30   58.67   58.30   59.04   58.67   59.04   59.04   59.04   59.26   60.00   60.37   60.00   60.00   60.37   60.37   60.74   59.63   60.00   60.00   60.37   58.89   60.00   59.63   60.74   60.37   60.37   61.11   60.74   60.74   61.11   60.37   60.74   61.11   61.11   61.11   61.11   61.48   61.11   61.11   61.11   61.11   61.48   61.48   61.11   61.48   62.03   88.04   88.04   93.04   92.39   91.30  100.00   95.65   28.79   31.13   28.85   28.46   28.74   26.38   26.38   30.20   33.59   29.02   28.63   33.72   33.86   33.07   34.24   33.20   33.59   33.98   33.98   21.01   21.01   19.92   21.03   19.84   20.24   20.24   20.24   19.84

    97: AHA11126.1   53.51   53.87   59.63   60.00   60.37   57.78   57.20   57.20   56.83   57.56   57.56   56.83   56.46   57.20   57.56   57.20   56.83   58.30   57.56   57.93   57.56   57.20   57.20   57.20   56.83   56.83   56.83   56.83   56.83   57.56   57.56   57.56   56.83   56.83   57.20   57.20   57.20   57.56   57.20   57.56   57.93   57.20   57.56   57.56   57.20   57.56   57.20   57.93   57.56   57.93   57.93   57.93   58.89   58.89   60.00   58.89   58.89   59.26   59.26   59.63   58.52   58.89   58.89   60.00   57.78   58.89   58.52   59.63   59.26   59.26   60.00   59.63   59.63   60.00   61.11   61.85   60.74   60.74   60.74   60.74   61.11   60.74   60.74   60.74   60.74   61.11   61.11   60.74   61.11   61.65   89.13   88.04   92.67   93.48   93.84   95.65  100.00   28.79   30.35   28.46   28.46   27.95   25.98   25.98   30.20   33.59   28.63   28.24   32.95   33.07   32.28   34.24   33.20   33.59   33.98   33.98   20.62   20.62   19.92   21.03   19.84   20.24   20.24   20.24   19.84

    98: AEM66528.1   32.83   32.45   31.72   31.72   32.09   28.95   28.30   28.68   28.68   29.06   28.68   28.68   28.68   28.68   29.06   28.68   28.68   28.68   28.30   28.68   28.68   28.30   29.06   29.06   29.06   29.06   29.06   29.06   29.06   28.30   28.30   27.92   28.30   28.68   28.30   28.30   28.30   28.68   28.68   28.68   28.68   27.92   27.92   28.68   27.92   28.30   27.92   28.30   28.30   28.68   29.06   29.06   29.06   27.55   27.55   28.68   28.68   27.92   28.68   28.68   28.68   28.68   28.68   27.55   28.68   27.92   29.06   28.68   28.30   29.06   28.30   28.30   28.30   28.30   32.71   33.08   31.06   30.68   30.68   30.68   30.68   30.68   30.68   30.68   30.30   30.68   30.68   30.30   30.68   30.77   29.55   27.65   28.74   27.65   28.03   28.79   28.79  100.00   29.06   28.36   28.36   28.63   28.63   28.63   30.27   34.47   28.85   28.46   33.21   33.72   32.95   36.26   33.59   33.97   34.73   34.35   27.20   26.44   20.32   17.86   19.84   20.63   20.63   20.63   20.24

    99: ALA99191.1   31.54   31.54   29.39   29.01   29.39   28.74   29.73   29.73   30.12   30.50   29.34   30.12   30.12   29.73   30.12   30.12   30.12   30.50   29.73   30.12   30.50   29.73   30.12   29.34   29.73   29.73   29.73   29.73   29.73   29.73   29.34   29.34   29.73   30.12   29.73   30.12   30.12   30.12   30.50   30.50   30.50   30.12   31.27   31.27   30.89   31.27   30.89   30.89   31.27   30.89   30.89   30.89   29.34   29.34   28.96   29.34   29.34   29.34   29.34   29.34   28.96   28.96   28.96   28.57   28.57   29.73   28.96   28.96   28.57   28.96   29.73   28.96   29.34   29.34   31.54   31.15   32.17   32.17   32.17   32.17   32.17   32.17   32.17   32.17   32.17   32.17   32.17   32.56   32.17   31.89   31.91   30.74   31.10   31.13   30.74   31.13   30.35   29.06  100.00   72.86   76.06   73.31   72.95   72.95   32.43   32.57   36.72   37.11   36.78   37.35   36.96   34.11   32.95   32.95   32.95   33.33   21.57   21.57   25.00   24.08   24.49   24.49   24.49   24.49   24.49

   100: ALA99186.1   30.92   30.92   29.55   29.17   29.55   26.62   29.77   29.39   29.77   30.15   29.01   29.77   29.77   29.39   29.77   29.77   29.77   30.15   29.39   29.77   30.15   29.39   29.77   29.01   29.39   29.39   29.39   29.39   29.39   29.39   29.01   29.01   29.39   29.77   29.39   29.77   29.77   29.77   30.15   30.15   29.77   29.39   30.53   30.53   30.15   30.53   30.15   29.77   30.53   30.15   29.77   29.77   25.95   26.72   26.72   26.72   26.72   26.34   26.34   26.72   26.34   26.34   26.34   26.72   25.95   27.10   26.34   26.34   27.10   26.34   27.10   26.34   26.72   26.72   30.42   30.80   29.12   29.12   29.12   29.12   29.12   29.12   28.74   29.12   29.12   29.12   29.12   29.50   29.50   28.79   29.23   27.69   28.40   28.08   27.69   28.85   28.46   28.36   72.86  100.00   79.93   75.18   76.98   76.62   32.69   31.56   37.98   38.76   35.61   36.15   35.38   35.25   34.48   34.10   34.48   34.87   22.57   22.96   24.80   23.89   25.10   25.10   25.10   25.10   25.10

   101: ALA99187.1   31.56   31.56   27.92   27.55   27.92   27.27   29.01   28.63   29.39   29.39   28.24   29.01   29.01   28.63   29.01   29.01   29.01   29.39   28.63   29.01   29.39   28.63   29.01   28.63   28.63   28.63   28.63   29.01   29.01   29.01   28.63   28.63   28.63   29.01   28.63   29.01   29.01   29.01   29.39   29.39   29.01   28.63   29.77   29.77   29.39   29.77   29.39   29.39   29.77   29.39   29.01   29.01   27.10   27.86   27.86   27.86   27.86   27.48   27.48   27.48   27.48   27.48   27.48   27.48   27.10   27.86   27.48   27.48   27.86   27.48   27.86   27.48   27.86   27.86   30.80   30.80   29.12   29.12   29.12   29.12   29.12   29.12   28.74   29.12   29.12   29.12   29.12   29.50   29.50   28.79   29.62   28.08   28.02   27.69   27.69   28.46   28.46   28.36   76.06   79.93  100.00   77.74   80.57   80.21   32.95   31.82   39.38   40.15   34.85   35.38   34.62   34.10   33.72   33.33   33.33   33.72   21.71   21.71   23.58   22.67   23.48   23.89   23.89   23.89   23.89

   102: ALA99190.1   31.52   31.52   30.89   30.12   29.73   26.74   30.47   30.47   30.86   30.47   30.08   30.86   30.86   30.47   30.86   30.86   30.86   31.25   30.47   30.86   31.25   30.47   30.86   30.08   30.47   30.47   30.47   30.47   30.47   30.47   30.08   30.08   30.47   30.86   30.47   30.86   30.86   30.86   31.25   31.25   30.86   30.47   31.64   31.64   31.25   31.64   31.25   31.25   31.64   31.25   30.86   30.86   26.95   28.12   27.34   27.73   27.73   27.34   27.34   27.73   27.34   27.34   27.34   26.95   26.95   28.12   27.34   27.34   27.34   27.34   28.12   27.34   27.73   27.73   31.13   30.35   30.59   30.59   30.59   30.59   30.59   30.59   30.20   30.59   30.59   30.59   30.59   30.59   30.98   30.28   29.53   28.35   28.69   27.95   27.56   28.74   27.95   28.63   73.31   75.18   77.74  100.00   88.69   88.34   34.11   33.85   36.47   37.25   36.15   36.33   35.55   37.35   36.19   35.80   35.80   36.19   22.44   22.44   22.95   21.63   22.86   22.86   22.86   22.86   22.86

   103: ALA99192.1   30.74   30.74   29.34   28.57   28.19   25.19   27.34   27.34   27.73   27.34   26.95   27.73   27.73   27.34   27.73   27.73   27.73   28.12   27.34   27.73   28.12   27.34   27.73   27.34   27.34   27.34   27.34   27.34   27.34   27.73   27.34   27.34   27.34   27.73   27.34   27.73   27.73   27.73   28.12   28.12   27.73   27.34   28.12   28.12   27.73   28.12   27.73   28.12   28.52   28.12   27.73   27.73   25.78   26.17   25.39   25.78   25.78   25.39   25.78   26.17   25.39   25.39   25.39   25.00   25.00   25.78   25.78   25.39   26.17   25.78   25.78   25.39   25.78   25.78   29.18   28.79   29.02   29.02   29.02   29.02   29.02   29.02   28.63   29.02   29.02   29.02   29.02   29.02   29.41   29.08   27.56   25.98   25.90   25.59   25.59   26.38   25.98   28.63   72.95   76.98   80.57   88.69  100.00   99.65   32.95   31.92   36.86   37.65   35.77   35.94   35.16   35.80   35.02   34.63   34.63   35.02   21.65   21.26   23.77   22.45   23.67   23.67   23.67   23.67   23.67

   104: ALA99193.1   30.74   30.74   29.34   28.57   28.19   25.19   26.95   26.95   27.34   26.95   26.56   27.34   27.34   26.95   27.34   27.34   27.34   27.73   26.95   27.34   27.73   26.95   27.34   26.95   26.95   26.95   26.95   26.95   26.95   27.34   26.95   26.95   26.95   27.34   26.95   27.34   27.34   27.34   27.73   27.73   27.34   26.95   27.73   27.73   27.34   27.73   27.34   27.73   28.12   27.73   27.34   27.34   25.39   25.78   25.00   25.39   25.39   25.39   25.78   25.78   25.00   25.00   25.00   24.61   24.61   25.39   25.39   25.00   25.78   25.39   25.39   25.00   25.39   25.39   29.18   28.79   29.02   29.02   29.02   29.02   29.02   29.02   28.63   29.02   29.02   29.02   29.02   29.02   29.41   29.08   27.56   25.98   25.90   25.59   25.59   26.38   25.98   28.63   72.95   76.62   80.21   88.34   99.65  100.00   32.56   31.92   36.86   37.65   35.77   35.94   35.16   35.80   35.02   34.63   34.63   35.02   21.65   21.26   23.77   22.45   23.67   23.67   23.67   23.67   23.67

   105: ADT70779.1   32.94   32.94   32.56   32.17   31.78   31.25   31.10   31.10   31.10   30.71   31.50   30.71   31.10   31.10   31.10   30.71   31.50   31.10   31.10   31.10   31.10   31.10   31.10   31.10   31.10   31.10   30.71   31.10   31.10   30.31   30.71   30.71   31.10   31.10   31.50   31.10   31.10   31.10   30.71   30.31   31.10   30.71   30.71   30.71   30.31   30.71   30.71   31.10   30.71   31.10   31.10   31.10   30.71   32.68   32.28   31.89   31.50   31.10   31.10   31.89   31.50   31.50   31.50   31.89   31.50   32.28   31.50   31.50   31.50   31.89   31.89   31.10   31.89   31.89   33.73   33.33   31.23   31.23   31.23   31.23   31.23   31.23   30.83   30.83   30.83   30.83   31.23   30.83   31.23   30.52   30.20   28.63   28.97   29.41   29.41   30.20   30.20   30.27   32.43   32.69   32.95   34.11   32.95   32.56  100.00   36.54   34.90   34.51   36.92   36.72   35.94   34.24   33.85   33.85   34.24   34.24   25.49   25.49   21.22   21.14   21.95   21.95   21.95   21.54   21.14

   106: ADZ54048.1   32.95   32.95   34.87   35.25   34.87   32.82   33.07   33.07   32.68   32.68   32.68   33.07   32.68   33.07   33.07   33.07   32.68   33.07   32.68   33.07   33.07   32.68   33.07   33.46   33.85   33.07   33.46   33.85   33.46   32.68   32.68   32.30   32.68   33.07   32.68   32.68   32.68   33.07   33.07   32.68   33.07   32.30   32.68   32.68   32.30   32.68   32.30   33.07   32.68   33.07   33.46   33.46   31.52   32.30   31.91   31.52   31.52   31.52   31.52   31.52   31.91   31.91   32.30   31.13   31.91   31.13   31.52   31.91   31.13   31.52   31.52   31.91   31.52   31.52   35.27   33.72   34.77   34.77   34.77   34.77   34.77   34.77   34.77   34.77   34.38   34.77   34.77   34.38   34.77   34.52   33.98   33.20   33.99   33.20   33.20   33.59   33.59   34.47   32.57   31.56   31.82   33.85   31.92   31.92   36.54  100.00   34.48   34.10   37.26   37.84   37.45   32.70   30.42   29.66   30.42   29.66   25.48   25.48   20.97   21.29   21.29   21.29   21.29   20.88   20.88

   107: AEE61368.1   30.59   30.20   27.41   27.80   28.19   27.56   28.17   28.17   27.78   28.57   27.78   27.78   27.78   28.17   28.57   27.78   28.17   28.17   28.17   28.17   28.17   28.17   28.17   28.57   27.78   27.78   27.78   27.78   27.78   28.17   28.17   28.17   27.78   28.17   27.78   27.78   27.78   27.78   27.78   28.17   28.57   27.78   28.17   28.57   27.78   28.17   28.17   27.78   27.78   28.17   28.57   28.57   27.78   27.78   27.38   26.98   26.98   26.98   26.98   26.98   26.59   26.59   26.59   26.19   26.59   25.79   26.59   26.19   26.59   26.98   26.19   26.19   26.59   26.59   31.23   30.83   27.09   27.09   27.09   27.09   27.09   27.09   27.09   27.09   26.69   27.09   27.09   26.69   27.09   27.53   28.24   27.84   28.17   27.45   27.13   29.02   28.63   28.85   36.72   37.98   39.38   36.47   36.86   36.86   34.90   34.48  100.00   99.27   40.70   40.31   39.92   34.50   33.85   34.24   35.02   34.63   25.39   25.39   27.42   27.71   27.71   28.51   28.51   28.11   27.71

   108: AIG94927.1   30.20   29.80   27.03   27.41   27.80   27.17   27.78   27.78   27.38   28.17   27.38   27.38   27.38   27.78   28.17   27.38   27.78   27.78   27.78   27.78   27.78   27.78   27.78   28.17   27.38   27.38   27.38   27.38   27.38   27.78   27.78   27.78   27.38   27.78   27.38   27.38   27.38   27.38   27.38   27.78   28.17   27.38   27.78   28.17   27.38   27.78   27.78   27.38   27.38   27.78   28.17   28.17   27.38   27.38   26.98   26.59   26.59   26.59   26.59   26.59   26.19   26.19   26.19   25.79   26.19   25.40   26.19   25.79   26.19   26.59   25.79   25.79   26.19   26.19   30.83   30.43   26.69   26.69   26.69   26.69   26.69   26.69   26.69   26.69   26.29   26.69   26.69   26.29   26.69   27.13   27.84   27.45   27.78   27.06   26.74   28.63   28.24   28.46   37.11   38.76   40.15   37.25   37.65   37.65   34.51   34.10   99.27  100.00   40.31   39.92   39.53   34.11   34.24   33.85   34.63   34.24   25.39   25.39   27.42   27.71   27.71   28.51   28.51   28.11   27.71

   109: AHF71363.1   33.33   33.33   31.42   31.80   31.42   32.43   34.75   35.14   34.75   34.75   34.36   34.36   34.36   35.14   35.14   34.36   35.14   34.75   34.75   35.14   35.14   34.75   35.14   34.75   34.75   33.98   34.36   34.36   34.36   34.36   34.36   34.36   34.36   33.98   34.36   34.36   34.36   34.36   34.36   34.36   34.36   33.98   33.98   34.36   33.98   34.36   33.98   34.75   34.36   34.75   34.75   34.75   33.20   33.59   33.59   33.20   33.59   33.98   33.59   33.59   33.20   32.82   32.82   32.82   33.20   32.43   33.59   33.20   33.20   33.20   33.20   32.82   33.59   33.59   35.38   34.62   35.27   35.66   35.66   35.66   35.66   35.66   35.27   35.66   35.27   35.66   36.05   35.27   35.27   35.43   33.72   32.17   32.55   32.17   31.78   33.72   32.95   33.21   36.78   35.61   34.85   36.15   35.77   35.77   36.92   37.26   40.70   40.31  100.00   99.62   98.85   45.04   45.80   45.42   46.18   45.80   26.56   26.56   23.48   24.19   23.79   24.19   24.19   23.79   23.79

   110: AJA30430.1   33.86   33.86   31.91   31.91   31.52   32.94   35.29   35.69   35.29   35.29   34.90   34.90   34.90   35.69   35.69   34.90   35.69   35.29   35.29   35.69   35.69   35.29   35.69   34.90   35.29   34.51   34.90   34.90   34.90   34.90   34.90   34.90   34.90   34.51   34.90   34.90   34.90   34.90   34.90   34.90   34.90   34.51   34.51   34.90   34.51   34.90   34.51   35.29   34.90   35.29   35.29   35.29   33.33   33.73   33.73   33.33   33.33   33.73   33.33   33.73   33.33   32.94   32.94   32.94   33.33   32.55   33.73   33.33   33.33   33.33   33.33   32.94   33.73   33.73   35.55   34.77   35.43   35.83   35.83   35.83   35.83   35.83   35.43   35.83   35.43   35.83   36.22   35.43   35.83   35.60   33.86   32.28   32.67   32.28   31.89   33.86   33.07   33.72   37.35   36.15   35.38   36.33   35.94   35.94   36.72   37.84   40.31   39.92   99.62  100.00   98.85   45.74   46.51   46.12   46.90   46.51   26.48   26.48   23.87   24.59   24.18   24.59   24.59   24.18   24.18

   111: AKR53961.1   33.07   33.07   31.13   31.13   30.74   32.16   34.51   34.90   34.51   34.51   34.12   34.12   34.12   34.90   34.90   34.12   34.90   34.51   34.51   34.90   34.90   34.51   34.90   34.12   34.51   33.73   34.12   34.12   34.12   34.12   34.12   34.12   34.12   33.73   34.12   34.12   34.12   34.12   34.12   34.12   34.12   33.73   33.73   34.12   33.73   34.12   33.73   34.51   34.12   34.51   34.90   34.90   32.55   32.94   32.94   32.55   32.55   32.94   32.55   32.94   32.55   32.16   32.16   32.16   32.55   31.76   32.94   32.55   32.55   32.55   32.55   32.16   32.94   32.94   34.77   33.98   34.65   35.04   35.04   35.04   35.04   35.04   35.04   35.04   34.65   35.04   35.43   34.65   35.04   34.80   33.07   31.50   31.87   31.50   31.10   33.07   32.28   32.95   36.96   35.38   34.62   35.55   35.16   35.16   35.94   37.45   39.92   39.53   98.85   98.85  100.00   44.96   45.74   45.35   46.12   45.74   26.48   26.48   23.87   24.59   24.18   24.59   24.59   24.18   24.18

   112: CAP69660.1   36.96   37.35   33.85   33.85   33.46   35.55   34.38   34.77   34.38   33.98   33.98   34.38   33.98   34.77   34.77   33.98   33.98   34.77   33.98   34.38   34.38   33.98   34.38   33.59   33.59   33.59   33.59   33.20   33.59   33.20   33.20   33.20   34.38   33.98   33.59   33.59   33.98   33.98   34.38   34.77   34.77   34.38   34.77   34.77   34.38   34.77   34.38   35.16   34.77   35.16   35.16   35.16   34.77   34.38   34.77   34.77   34.77   35.16   34.38   34.77   34.38   33.98   33.98   34.38   34.38   33.98   34.77   34.38   34.77   34.38   33.98   33.59   34.38   34.77   37.35   36.96   34.12   34.51   34.51   34.51   34.51   34.51   34.12   34.51   34.12   34.51   34.90   34.12   34.51   33.86   35.02   34.24   35.04   33.46   32.68   34.24   34.24   36.26   34.11   35.25   34.10   37.35   35.80   35.80   34.24   32.70   34.50   34.11   45.04   45.74   44.96  100.00   80.08   80.08   80.45   80.08   26.07   26.07   23.81   23.72   23.72   23.72   23.72   23.72   24.11

   113: ADV41666.1   33.59   33.98   32.43   32.43   32.05   35.94   32.81   33.20   32.81   32.42   32.42   32.81   32.42   33.20   33.20   32.42   32.42   33.20   32.42   32.81   32.81   32.42   32.81   32.03   32.03   32.03   32.03   31.64   32.03   31.64   31.64   31.64   32.81   32.42   32.03   32.03   32.42   32.42   32.81   33.20   32.81   32.81   33.20   33.20   32.81   33.20   32.81   33.59   33.20   33.59   33.59   33.59   33.59   32.81   33.20   32.81   32.81   32.81   32.81   32.81   32.42   32.42   32.42   33.20   32.42   32.03   32.81   32.42   32.42   32.42   32.03   31.64   32.42   32.81   35.80   35.41   32.94   33.33   33.33   33.33   33.33   33.33   32.94   33.33   32.94   33.33   33.73   32.94   33.33   32.67   33.59   32.03   33.20   32.42   32.03   33.20   33.20   33.59   32.95   34.48   33.72   36.19   35.02   35.02   33.85   30.42   33.85   34.24   45.80   46.51   45.74   80.08  100.00   95.11   95.86   95.49   24.90   24.90   24.70   24.60   24.60   24.21   24.21   24.21   24.60

   114: AER57903.1   33.98   34.38   33.20   33.20   32.82   36.33   33.98   34.38   33.98   33.59   33.59   33.98   33.59   34.38   34.38   33.59   33.59   34.38   33.59   33.98   33.98   33.59   33.98   33.20   33.20   33.20   33.20   32.81   33.20   32.81   32.81   32.81   33.98   33.59   33.20   33.20   33.59   33.59   33.98   34.38   33.98   33.98   34.38   34.38   33.98   34.38   33.98   34.77   34.38   34.77   34.77   34.77   34.38   33.98   34.38   33.98   33.98   33.98   33.98   33.98   33.59   33.59   33.59   33.98   33.59   33.20   33.98   33.59   33.20   33.59   33.20   32.81   33.59   33.98   36.58   36.19   33.33   33.73   33.73   33.73   33.73   33.73   33.33   33.73   33.33   33.73   34.12   33.33   33.73   33.07   34.38   32.42   33.60   32.81   32.81   33.59   33.59   33.97   32.95   34.10   33.33   35.80   34.63   34.63   33.85   29.66   34.24   33.85   45.42   46.12   45.35   80.08   95.11  100.00   98.50   98.12   25.29   25.29   23.90   24.21   23.81   23.81   23.81   23.81   24.21

   115: AFN20670.1   33.98   34.38   33.59   33.59   33.20   36.72   34.38   34.77   34.38   33.98   33.98   34.38   33.98   34.77   34.77   33.98   33.98   34.77   33.98   34.38   34.38   33.98   34.38   33.59   33.59   33.59   33.59   33.20   33.59   33.20   33.20   33.20   34.38   33.98   33.59   33.59   33.98   33.98   34.38   34.77   34.38   34.38   34.77   34.77   34.38   34.77   34.38   35.16   34.77   35.16   35.16   35.16   34.77   34.38   34.77   34.38   34.38   34.38   34.38   34.38   33.98   33.98   33.98   34.38   33.98   33.59   34.38   33.98   33.59   33.98   33.59   33.20   33.98   34.38   36.58   36.19   33.73   34.12   34.12   34.12   34.12   34.12   33.73   34.12   33.73   34.12   34.51   33.73   34.12   33.47   34.77   32.81   33.99   33.20   33.20   33.98   33.98   34.73   32.95   34.48   33.33   35.80   34.63   34.63   34.24   30.42   35.02   34.63   46.18   46.90   46.12   80.45   95.86   98.50  100.00   98.87   25.29   25.29   24.30   24.60   24.21   24.21   24.21   24.21   24.60

   116: BAR45714.1   34.77   35.16   33.59   33.59   33.20   36.72   34.38   34.77   34.38   33.98   33.98   34.38   33.98   34.77   34.77   33.98   33.98   34.77   33.98   34.38   34.38   33.98   34.38   33.59   33.59   33.59   33.59   33.20   33.59   33.20   33.20   33.20   34.38   33.98   33.59   33.59   33.98   33.98   34.38   34.77   34.38   34.38   34.77   34.77   34.38   34.77   34.38   35.16   34.77   35.16   35.16   35.16   34.77   34.38   34.77   34.38   34.38   34.38   34.38   34.38   33.98   33.98   33.98   34.38   33.98   33.59   34.38   33.98   33.59   33.98   33.59   33.20   33.98   34.38   36.58   36.19   33.73   34.12   34.12   34.12   34.12   34.12   33.73   34.12   33.73   34.12   34.51   33.73   34.12   33.47   34.77   32.81   33.99   33.20   33.20   33.98   33.98   34.35   33.33   34.87   33.72   36.19   35.02   35.02   34.24   29.66   34.63   34.24   45.80   46.51   45.74   80.08   95.49   98.12   98.87  100.00   24.90   24.90   24.30   24.60   24.21   24.21   24.21   24.21   24.60

   117: AEQ73521.1   23.26   23.26   23.37   22.99   22.99   23.64   23.83   23.83   24.22   23.83   24.22   24.22   24.22   23.83   23.83   24.22   23.83   23.83   23.83   23.83   23.83   23.83   23.83   23.44   23.83   23.83   23.44   23.83   23.83   24.22   24.22   24.22   24.61   24.61   25.00   24.61   24.61   24.61   23.44   23.83   23.83   23.83   23.44   23.44   23.44   23.44   23.44   23.83   23.44   23.83   24.22   24.61   23.44   25.00   23.44   23.05   23.05   23.05   23.05   23.44   22.66   22.66   22.66   23.05   22.66   23.44   23.05   22.66   23.05   23.05   23.05   22.66   23.05   23.05   24.90   25.29   20.70   20.70   20.70   20.70   20.70   20.70   20.70   20.70   20.31   20.70   20.70   20.31   20.70   20.63   21.01   21.01   20.87   20.23   20.62   21.01   20.62   27.20   21.57   22.57   21.71   22.44   21.65   21.65   25.49   25.48   25.39   25.39   26.56   26.48   26.48   26.07   24.90   25.29   25.29   24.90  100.00   98.55   30.38   31.03   29.89   31.03   31.03   30.27   29.50

   118: AGR55864.1   23.26   23.26   23.37   22.99   22.99   23.64   23.83   23.83   24.22   23.83   24.22   24.22   24.22   23.83   23.83   24.22   23.83   23.83   23.83   23.83   23.83   23.83   23.83   23.44   23.83   23.83   23.44   23.83   23.83   24.22   24.22   24.22   24.61   24.61   25.00   24.61   24.61   24.61   23.44   23.83   23.83   23.83   23.44   23.44   23.44   23.44   23.44   23.83   23.44   23.83   24.22   24.61   23.44   25.00   23.44   23.05   23.05   23.05   23.05   23.44   22.66   22.66   22.66   23.05   22.66   23.44   23.05   22.66   23.05   23.05   23.05   22.66   23.05   23.05   24.90   25.29   20.70   20.70   20.70   20.70   20.70   20.70   20.70   20.70   20.31   20.70   20.70   20.31   20.70   20.24   21.01   21.01   20.87   20.23   20.62   21.01   20.62   26.44   21.57   22.96   21.71   22.44   21.26   21.26   25.49   25.48   25.39   25.39   26.56   26.48   26.48   26.07   24.90   25.29   25.29   24.90   98.55  100.00   30.77   31.42   30.27   31.42   31.42   30.65   29.89

   119: CCE73593.2   22.09   22.09   21.12   20.72   20.72   18.62   21.05   21.46   21.05   21.05   21.46   20.65   20.24   21.46   21.46   20.65   20.65   20.65   21.05   21.05   21.05   21.05   21.05   21.05   21.46   21.46   21.46   21.46   21.46   20.65   21.05   21.05   21.46   21.05   20.65   21.05   21.05   21.05   20.65   20.24   20.65   21.05   21.05   21.05   21.05   21.05   21.05   20.65   20.65   21.05   21.46   21.46   19.43   20.24   18.62   18.62   18.62   18.62   18.62   18.62   19.03   19.03   19.03   18.22   19.03   18.62   19.43   18.62   18.22   18.62   18.22   19.03   18.62   18.62   21.05   21.46   20.24   20.24   20.24   20.24   20.65   19.84   20.24   20.24   19.84   20.24   20.24   19.84   20.24   20.58   21.12   20.72   20.56   19.92   19.44   19.92   19.92   20.32   25.00   24.80   23.58   22.95   23.77   23.77   21.22   20.97   27.42   27.42   23.48   23.87   23.87   23.81   24.70   23.90   24.30   24.30   30.38   30.77  100.00   83.21   85.40   84.31   84.31   84.31   83.94

   120: ALC76097.1   24.00   24.00   20.63   20.63   20.63   19.35   22.18   22.58   22.18   22.18   22.98   21.37   20.97   22.98   22.98   21.77   21.77   22.18   22.58   22.58   22.58   22.58   22.58   22.18   22.58   22.58   22.58   22.58   22.58   21.37   22.18   22.18   22.18   21.77   21.77   22.18   22.18   21.77   21.37   20.97   20.97   21.37   21.37   21.37   21.37   21.37   21.37   21.37   20.97   21.37   21.77   21.77   20.56   21.37   19.76   19.76   19.76   19.76   19.76   19.76   20.16   20.16   20.16   19.35   20.16   19.76   20.16   19.76   19.35   19.76   19.35   20.16   19.76   19.76   21.37   21.77   19.35   19.35   19.35   19.35   19.76   18.95   19.35   19.35   18.95   19.35   19.35   18.95   19.35   19.67   21.03   21.83   21.69   21.03   20.55   21.03   21.03   17.86   24.08   23.89   22.67   21.63   22.45   22.45   21.14   21.29   27.71   27.71   24.19   24.59   24.59   23.72   24.60   24.21   24.60   24.60   31.03   31.42   83.21  100.00   90.91   91.64   91.64   92.36   92.00

   121: ALC76101.1   23.60   23.60   20.63   20.24   20.24   18.15   20.56   20.97   20.56   20.56   20.97   20.16   19.76   20.97   20.97   20.16   20.16   20.16   20.56   20.56   20.56   20.56   20.56   20.56   20.97   20.97   20.97   20.97   20.97   20.56   20.56   20.56   20.97   20.56   20.16   20.56   20.56   20.56   20.16   19.76   20.16   20.16   20.16   20.16   20.16   20.16   20.16   19.76   19.76   20.16   20.56   20.56   19.35   20.16   18.55   18.55   18.55   18.15   18.55   18.55   18.95   18.95   18.95   18.15   18.95   18.55   18.95   18.55   18.15   18.55   18.15   18.95   18.55   18.55   20.56   20.97   19.35   19.35   19.35   19.35   19.35   18.95   19.35   19.35   18.95   19.35   19.35   18.95   19.35   19.67   20.24   20.24   20.48   19.84   18.97   19.84   19.84   19.84   24.49   25.10   23.48   22.86   23.67   23.67   21.95   21.29   27.71   27.71   23.79   24.18   24.18   23.72   24.60   23.81   24.21   24.21   29.89   30.27   85.40   90.91  100.00   96.36   96.36   97.09   97.45

   122: ALC76098.1   23.60   23.60   21.03   20.63   20.63   18.95   21.37   21.77   21.37   21.37   21.77   20.97   20.56   21.77   21.77   20.97   20.97   20.97   21.37   21.37   21.37   21.37   21.37   21.37   21.77   21.77   21.77   21.77   21.77   21.37   21.37   21.37   21.77   21.37   20.97   21.37   21.37   21.37   20.97   20.56   20.97   20.97   20.97   20.97   20.97   20.97   20.97   20.56   20.56   20.97   21.37   21.37   20.16   20.97   19.35   19.35   19.35   18.95   19.35   19.35   19.76   19.76   19.76   18.95   19.76   19.35   19.76   19.35   18.95   19.35   18.95   19.76   19.35   19.35   21.77   22.18   19.76   19.76   19.76   19.76   19.76   19.35   19.76   19.76   19.35   19.76   19.76   19.35   19.76   20.08   20.63   20.63   20.88   20.24   19.37   20.24   20.24   20.63   24.49   25.10   23.89   22.86   23.67   23.67   21.95   21.29   28.51   28.51   24.19   24.59   24.59   23.72   24.21   23.81   24.21   24.21   31.03   31.42   84.31   91.64   96.36  100.00  100.00   98.55   97.45

   123: ALC76099.1   23.60   23.60   21.03   20.63   20.63   18.95   21.37   21.77   21.37   21.37   21.77   20.97   20.56   21.77   21.77   20.97   20.97   20.97   21.37   21.37   21.37   21.37   21.37   21.37   21.77   21.77   21.77   21.77   21.77   21.37   21.37   21.37   21.77   21.37   20.97   21.37   21.37   21.37   20.97   20.56   20.97   20.97   20.97   20.97   20.97   20.97   20.97   20.56   20.56   20.97   21.37   21.37   20.16   20.97   19.35   19.35   19.35   18.95   19.35   19.35   19.76   19.76   19.76   18.95   19.76   19.35   19.76   19.35   18.95   19.35   18.95   19.76   19.35   19.35   21.77   22.18   19.76   19.76   19.76   19.76   19.76   19.35   19.76   19.76   19.35   19.76   19.76   19.35   19.76   20.08   20.63   20.63   20.88   20.24   19.37   20.24   20.24   20.63   24.49   25.10   23.89   22.86   23.67   23.67   21.95   21.29   28.51   28.51   24.19   24.59   24.59   23.72   24.21   23.81   24.21   24.21   31.03   31.42   84.31   91.64   96.36  100.00  100.00   98.55   97.45

   124: AFQ90085.1   24.00   24.00   21.43   21.03   21.03   18.95   21.37   21.77   21.37   21.37   21.77   20.97   20.56   21.77   21.77   20.97   20.97   20.97   21.37   21.37   21.37   21.37   21.37   21.37   21.77   21.77   21.77   21.77   21.77   21.37   21.37   21.37   21.77   21.37   20.97   21.37   21.37   21.37   20.97   20.56   20.97   20.97   20.97   20.97   20.97   20.97   20.97   20.56   20.56   20.97   21.37   21.37   20.16   20.97   19.35   19.35   19.35   18.95   19.35   19.35   19.76   19.76   19.76   18.95   19.76   19.35   19.76   19.35   18.95   19.35   18.95   19.76   19.35   19.35   21.77   22.18   19.76   19.76   19.76   19.76   19.76   19.35   19.76   19.76   19.35   19.76   19.76   19.35   19.76   20.08   20.63   20.63   20.88   20.24   19.37   20.24   20.24   20.63   24.49   25.10   23.89   22.86   23.67   23.67   21.54   20.88   28.11   28.11   23.79   24.18   24.18   23.72   24.21   23.81   24.21   24.21   30.27   30.65   84.31   92.36   97.09   98.55   98.55  100.00   98.91

   125: ALC76100.1   23.60   23.60   20.63   20.24   20.24   18.55   20.97   21.37   20.97   20.97   21.37   20.56   20.16   21.37   21.37   20.56   20.56   20.56   20.97   20.97   20.97   20.97   20.97   20.97   21.37   21.37   21.37   21.37   21.37   20.97   20.97   20.97   21.37   20.97   20.56   20.97   20.97   20.97   20.56   20.16   20.56   20.56   20.56   20.56   20.56   20.56   20.56   20.16   20.16   20.56   20.97   20.97   19.76   20.56   18.95   18.95   18.95   18.55   18.95   18.95   19.35   19.35   19.35   18.55   19.35   18.95   19.35   18.95   18.55   18.95   18.55   19.35   18.95   18.95   20.97   21.37   19.76   19.76   19.76   19.76   19.76   19.35   19.76   19.76   19.35   19.76   19.76   19.35   19.76   20.08   20.24   20.24   20.48   19.84   18.97   19.84   19.84   20.24   24.49   25.10   23.89   22.86   23.67   23.67   21.14   20.88   27.71   27.71   23.79   24.18   24.18   24.11   24.60   24.21   24.60   24.60   29.50   29.89   83.94   92.00   97.45   97.45   97.45   98.91  100.00

 

CLUSTAL O(1.2.4) multiple sequence alignment

 

 

BAP28835.1      ------------MKLLKILSLVCL---SI--------SIGACAEHSMSRAKTSTIPQVNN

AIT76118.1      ------------MKLLKILSLVCL---SI--------SIGACAEHSMSRAKTSTIPQVNN

AIN56719.1      -------------MKFKMKGLFCVILSSL--------AFSGCVYDSKL-------QRPVI

AGW83453.1      -------------MKFKMKGLFCVILSSL--------AFSGCVYDSKL-------QRPVI

AGW83454.1      -------------MKFKMKGLFCVILSSL--------AFSGCVYDSKL-------QRPVI

AKL59536.1      -------------MKKFI-LPIFSISILV--------SLSACSSIKTKSEDNF--H-ISS

AJG01375.1      ---------------MNI-KALLLITSAI--------FISACSPYIVTANPNH--SASKS

AHL30287.1      ---------------MNI-KTLLLITSAI--------FISACSPYIVTANPNH--SASKS

AHL30285.1      ---------------MNI-KALLLITSAI--------FISACSPYIVTANPNH--SASKS

AHL30280.1      ---------------MNI-KALLLITSAI--------FISACSPYIVTANPNH--SASKS

AHI63011.1      ---------------MNI-KTLLLITSAI--------FISACSPYIVSANPNH--SASKS

BAO09635.1      ---------------MNI-KALLLITSAI--------FISACSPYIVTANPNH--SASKS

AJG01376.1      ---------------MNI-KALLLITSAI--------FISACSPYIVTANPNH--SASKS

AHL30276.1      ---------------MNI-KTLLLITSAI--------FISACSPYIVTANPNH--SASKS

AHL30277.1      ---------------MNI-KTLLLITSAI--------FISACSPYIVTANPNH--SASKS

AJA32742.1      ---------------MNI-KALLLITSAI--------FISACSPYIVTANPNH--SASKS

AHL30272.1      ---------------MNI-KALLLITSAI--------FISACSPYIVTANPNH--SASKS

AGU69252.1      ---------------MNI-KALLLITSAI--------FISACSPYIVTANPNH--SASKS

ADM26744.1      ---------------MNI-KALLLITSAI--------FISACSPYIVTANPNH--SASKS

AHN07454.1      ---------------MNI-KALLLITSAI--------FISACSPYIVTANPNH--SASKS

AGU69250.1      ---------------MNI-KALLLITSAI--------FISACSPYIVTANPNH--SASKS

AGU69251.1      ---------------MNI-KALLLITSAI--------FISACSPYIVTANPNH--SASKS

AHL30274.1      ---------------MNI-KALLLITSAI--------FISACSPYIVTANPNH--SASKS

AHL30279.1      ---------------MNI-KALLLITSAI--------FISACSPYIVTANPNH--STSKS

AHL30283.1      ---------------MNI-KALLLITSAI--------FISACSPYIVTANPNH--SASKS

AJG01378.1      ---------------MNI-KALLLITSAI--------FISACSPYIVTANPNH--SASRS

AJG01379.1      ---------------MNI-KALLLITSAI--------FISACSPYIVTANPNH--SASKS

AHL30286.1      ---------------MNI-KALLLITSAI--------FISACSPYIVTANPNH--SASKT

AHN53381.1      ---------------MNI-KALLLITSAI--------FISACSPYIVTANPNH--SASKS

AHL30282.1      ---------------MNI-QALLLITSAI--------FISACSPYIVTANPNH--SASKS

AHL30278.1      ---------------MNI-QALLLITSAI--------FISACSPYIVTANPNH--SASKS

AHL30284.1      ---------------MNI-QALLLITSAI--------FISACSPYIVTANPNH--SASKS

AHL30281.1      ---------------MNI-KTLLLITSAI--------FISACSPYIVTANPNH--SASKS

AJA32744.1      ---------------MNI-KALLLITSAI--------FISACSPYIVSANPNH--SASKS

AGU69255.1      ---------------MNI-KALLLITSAI--------FISACSPYIVSANPNH--SASKS

AJG01377.1      ---------------MNI-KALLLITSAI--------FISACSPYIVSTNPNH--SASKS

ACX31141.1      ---------------MNI-KALLLITSAI--------FISACSPYIVSANPNH--SASKS

AHL30273.1      ---------------MKI-KALLLITSAI--------FISACSPYIVSANPNH--SASKS

AGU69253.1      ---------------MNI-QALLLITSAI--------FISACSPYIVSANPNH--SASKS

AGU69254.1      ---------------MNI-QALLLITSAI--------FISACSPYIVSANPNH--SASKS

AHL30275.1      ---------------MNI-KALLLITSAI--------FISACSPYIVTANPNH--SASKS

ADI58622.1      ---------------MNI-KALLLITSAI--------FISACSPYIVTANPNH--SASKS

ADI58618.1      ---------------MNI-KALLLITSAI--------FISACSPYIVTANPNH--SASKS

ADI58619.1      ---------------MNI-KALLLITSAI--------FISACSPYIVTANPNH--SASKS

ADI58620.1      ---------------MNI-KALLLITSAI--------FISACSPYIVTANPNH--SASKS

ADI58621.1      ---------------MNI-KALLLITSAI--------FISACSPYIVTANPNH--SASKS

ADX07746.1      ---------------MNI-KALLLITSAI--------FISACSPYIVTANPNH--SASKS

ALL53530.1      ---------------MNI-KALLFITSAI--------FISACSPYIVTANPNH--SASKS

AJA32743.1      ---------------MNI-KALLLITSAI--------FISACSPYIVTANPNH--SASKS

ADX07747.1      ---------------MNI-KALLLITSAI--------FISACSPYIVTANPNH--SASKS

ACD84989.1      ---------------MNI-KALLLITSAI--------FISACSPYIVTANPNH--SASKS

ADI58617.1      ---------------MNI-KALLLITSAI--------FISACSPYIVTANPNH--SASKS

AIZ00987.1      ---------------MTK-KTLFFAIGTM--------FLSACSFNTVEQHQIQ--S-IST

AGZ83153.1      ---------------MYK-KALIAATSIL--------FLSSCSSNTVKQHQIH--S-ISA

AGW16408.1      ---------------MYK-KAFIVATSIL--------FLSACSSNTVKQHQIH--S-ISA

AGW16407.1      ---------------MYK-KALIVATSIL--------FLSACSSNTVKQHQIH--T-ISA

AGW83450.1      ---------------MYK-KALIVATSIL--------FLSACSSNTVKQHQIH--S-ISA

AGW16411.1      ---------------MYK-KALIVATSIL--------FLSACSSNTVKQHQIH--S-ISA

AGW83452.1      ---------------MYK-KALIVATSIL--------FLSACSSNSVKQHQIH--S-ISA

AGW83448.1      ---------------MYK-KALIVTTSIL--------FLSACSSNSVKQNQIH--S-ISA

AGW16413.1      ---------------MYK-KALIVATSIL--------FLSACSSNTVKQNQIH--S-ISA

AGW83446.1      ---------------MYK-KALIVATSIL--------FLSACSSNMVKQHQIH--S-ISA

AGW83449.1      ---------------MYK-KALIVAISIL--------FLSACSSNMVKQHQIH--S-ISA

AGZ83155.1      ---------------MYK-KAFIVATSLL--------FLSACSSNTVEQHQIY--S-ISA

AGW83451.1      ---------------MYK-KTLIVTTSIL--------FLSACSSNMVKQHQIH--S-MSA

AGW83447.1      ---------------MYK-KALIAATSIL--------FLSSCSSNTVKQHQIH--S-ISA

AGW16406.1      ---------------MYK-KTLIVTTSIL--------FLSACSSNSVKQHQIH--S-MSA

AGW16412.1      ---------------MYK-KALIVATSIL--------FLSACSSNLVKQHQIH--S-ISA

AGW16410.1      ---------------MYK-KALIVATSLL--------FLSACSSNTVTQHQIH--S-ISA

AGW16404.1      ---------------MYK-KVLIVATSIL--------FLSACSSNSVKQHQIH--S-ISA

AGZ83154.1      ---------------MYK-KALIVATSIL--------FLSACSSNTVKQHQIH--S-ISA

AGW16409.1      ---------------MYK-KALIVATSIL--------FLSACSSNTVKQHQIH--S-ISA

AGW16405.1      ---------------MYK-KALIVATSIL--------FLSACSSNTVKQNQIH--S-ISA

AGW16414.1      ---------------MYK-KALIVATSIL--------FLSACSSNTVKQHQIH--S-ISA

AGW16415.1      ---------------MKNLQLGLIVLITT--------FGSACTTISPSVETAK--N-QHQ

AGW16416.1      ---------------MKTVQLCLIVLITT--------FGSACTTISPSVETAK--N-QHQ

ADK35870.1      ---------------MNK-YFTCYVVASL--------FLSGCTVQHNLINETP--SQIV-

ADK35871.1      ---------------MNK-YFTCYVVASL--------FLSGCTVQHNLINETP--SQIV-

ADK35872.1      ---------------MNK-YFTCYVVASL--------FLSGCTVQHNLINETP--SQIV-

AJT57878.1      ---------------MNK-YFTCYVVASL--------FLSGCTVQHNLINETP--SQIV-

ADK35873.1      ---------------MNK-YFTCYVVASL--------FLSGCTVQHNLINETP--SQIV-

ADK35874.1      ---------------MNK-YFTCYVVASL--------FLSGCTVQHNLINETP--SQIV-

AIT76095.1      ---------------MNK-YFTCYVVASL--------FLSGCTVQHNLINETP--SQIV-

AIY30331.1      ---------------MNK-YFTCYVVASP--------FLSGCTVQHNLINETP--SQIV-

AIY30332.1      ---------------MNK-YFTCYVVASL--------FLSGCTVQHNLINETP--SQIV-

AJO16038.1      ---------------MNK-YFTCYVVASL--------FLSGCTAQHNLINETP--SQIV-

AKF41839.1      ---------------MNK-YFTCYVVASL--------FLSGCTVQHNLINETP--SQIV-

AKF41840.1      ---------------MNK-YFTCYVVASL--------FLSGCTVQHNLINETP--SQIV-

AKR53962.1      ---------------MNK-YFTCYVVASL--------FLSGCTVQHNLINETP--SQIV-

AKF41838.1      ---------------MNK-YFTCYVVASL--------FLSGCTVQHNLINETP--SQIV-

AFH36332.1      ---------------MKT-LILLPLLSCL--------SLTACSLP---VSNSS--SQITS

AGZ83156.1      ---------------MKI-LILLPLLSCL--------SLTACSFA---VSNSP--SQITS

AGW16417.1      ---------------MKI-LILLPLLSCL--------GLTACSLP---VSSLP--SQSTS

AHA11124.1      ---------------MKI-LILLPLFSCL--------GLTACSLP---VSSSP--SQITS

ALM26450.1      ---------------MKI-LIFLPLLSCL--------SLTACSLP---VSSSP--SQITS

AHA11125.1      ---------------MKI-LILLPLLSCL--------GLTACTSP---VSSFP--SHITS

AHA11126.1      ---------------MKT-LIFLPLLNCL--------SLTACTLP---VSSSP--SHITS

AEM66528.1      --------------MKKTFILLNLILLVN--------LNGYCQTKSL----------KSN

ALA99191.1      --MMMLSRWRRSAVVLRIAAALLSPLAVAIPAHADAIANAA---NAV----------APK

ALA99186.1      MNTIISRRWRAGL-WRRLVGAVVLPATLAATPA----AYAADVPKAA----------PGR

ALA99187.1      MKKIIS-RWRRGVFGLRVALAVVSPMVFAVPAHATEAAGGAAGTKAA----------AVH

ALA99190.1      MKKTFS-RWRRGALVLRILGALASPVVFATPGHAAEPV------RPP----------SVH

ALA99192.1      MKKTLS-RWRRGALALRLLGALASPVVFAMPGHAAEPA------HSS----------AVR

ALA99193.1      MKKTLS-RWRRGALALRLLGALASPVVFAMPGHAAEPA------HSS----------AVR

ADT70779.1      -------------MHKHMSKLFIAFLAFL-----------L-SVP--------------A

ADZ54048.1      -------------MSKKNFIL--IFIFVI-----------LISCKNT----------EKT

AEE61368.1      -------------MAIRIFAI--LFSIFS-----------LATFAHA----------QEG

AIG94927.1      -------------MAIRIFAI--LFSIFS-----------LATFAHA----------QEG

AHF71363.1      ---------------MRVLALSAVFLVAS-----------IIGMPAV----------AKE

AJA30430.1      ---------------MRVLALSAVFLVAS-----------IIGMPAV----------AKE

AKR53961.1      ---------------MRVLALSAVFLVAS-----------IIGMPAV----------AKE

CAP69660.1      ------------------MKTIAAYLVLV-----------FFAGTAL----------SES

ADV41666.1      ------------------MKTFAAYVITA-----------CLSSTAL----------ASS

AER57903.1      ------------------MKTFAAYVIIA-----------CLSSTAL----------AGS

AFN20670.1      ------------------MKTFAAYVIIA-----------CLSSTAL----------AGS

BAR45714.1      ------------------MKTFAAYVIIA-----------CLSSTAL----------AGS

AEQ73521.1      -------------MKNTIHINFAIFLIIAN----------IIYSS-A----------S--

AGR55864.1      -------------MKNTIHINFAIFLIIAN----------IIYSS-A----------S--

CCE73593.2      -------------------MTVRLV-----------------SRA-L----------G--

ALC76097.1      -------------------MTVRRF-----------------SCA-L----------G--

ALC76101.1      -------------------MTVRLS-----------------SCA-L----------G--

ALC76098.1      -------------------MTVRLF-----------------STA-L----------G--

ALC76099.1      -------------------MTVRLF-----------------STA-L----------G--

AFQ90085.1      -------------------MTVRLS-----------------STA-L----------G--

ALC76100.1      -------------------MTVRLS-----------------STA-L----------G--

                                                                           

 

BAP28835.1      SIIDQNVQALFNEISADAVFVTYDGQNIK--KYGTHLDRAKTAYIPASTFKIANALIGLE

AIT76118.1      SIIDQNVQALFNEISADAVFVTYDGQNIK--KYGTHLDRAKTAYIPASTFKIANALIGLE

AIN56719.1      SERETEIPLLFNQAQTQAVFVTYDGIHLK--SYGNDLSRAKTEYIPASTFKMLNALIGLQ

AGW83453.1      SERETEIPLLFNQAQTQAVFVTYDGIHLK--SYGNDLSRAKTEYIPASTFKMLNALIGLQ

AGW83454.1      SERETEIPLLFNQAQTQAVFVTYDGIHLK--SYGNDLSRAKTEYIPASTFKMLNALIGLQ

AKL59536.1      QQHEKAIKSYFDEAQTQGVIIIKEGKNLS--TYGNALARANKEYVPASTFKMLNALIGLE

AJG01375.1      DKKAEKIKNLFNEAHTTGVLVIQQDQTQQ--SYGNDLARASTEYVPASTFKMLNALIGLE

AHL30287.1      DEKAEKIKNLFNEVHTTGVLVIQQGQTQQ--SYGNDLARASTEYVPASTFKMLNALIGLE

AHL30285.1      DKKAEKIKNLFNEAHTTGVLVIQQGQTQQ--SYGNDLARASTEYVPASTFKMLNALIGFE

AHL30280.1      DDKAEKIKNLFNEAHTTGVLVIHQGQTQQ--SYGNDLARASTEYVPASTFKMLNALIGLE

AHI63011.1      DEKAEKIKNLFNEAHTTGVLVIQQGQTQQ--SYGNDLARASTEYVPASTFKMLNALIGLE

BAO09635.1      DDKAEKIKNLFNEAHTTGVLVIHQGQTQQ--SYGNDLARASTEYVPASTFKMLNALIGLE

AJG01376.1      DDKAEKIKNLFNEAHTTGVLVIHQGQTQQ--SYGNDLARASTEYVPASTFKMLNALISLE

AHL30276.1      DEKAEKIKNLFNEVHTTGVLVIQQGQTQQ--SYGNDLARASTEYVPASTFKMLNALIGLE

AHL30277.1      DEKAEKIKNLFNEVHTKGVLVIQQGQTQQ--SYGNDLARASTEYVPASTFKMLNALIGLE

AJA32742.1      DEKAEKIKNLFNEAHTTGVLVIQQGQTQQ--SYGNDLARASTEYVPASTFKMLNALIGLE

AHL30272.1      DEKAEKIKNLFNEAHTTGVLVIQQGQTQQ--SYGNDLARASTEYVPASTFKMLNALISLE

AGU69252.1      DEKAEKIKNLFNEAHTTGVLVIQQGQTQQ--SYGNDLARASTEYVPASTFKMLNALIGLE

ADM26744.1      DEKAEKIKNLFNEAHTTGVLVIQQGQTQQ--SYGNDLARASTEYVPASTFKMLNALIGLE

AHN07454.1      DEKAEKIKNLFNEAHTTGVLVIQQGQTQQ--SYGNDLARASTEYVPASTFKMLNALIGLE

AGU69250.1      DEKAEKIKNLFNEAHTTGVLVIQQGQTQQ--SYGNDLARASTEYVPASTFKMLNALIGLE

AGU69251.1      DEKAEKIKNLFNEAHTTGVLVIQQGQTQQ--SYGNDLARASTEYVPASTFKMLNALIGLE

AHL30274.1      DEKAEKIKNLFNEAHTTGVLVIQQGQTQQ--SYGNDLARASTEYVPASTFKMLNALIGLE

AHL30279.1      DEKAEKIKNLFNEAHTTGVLVIQQGQTQQ--SYGNDLARASTEYVPASTFKMLNALIGLE

AHL30283.1      DDKAEKIKNLFTEAHTTGVLVIHQGQTQQ--SYGNDLARASTEYVPASTFKMLNALIGLE

AJG01378.1      DDKAEKIKNLFNEAHTTGVLVIHQGQTQQ--SYGNDLARASTEYVPASTFKMLNALIGLE

AJG01379.1      DDKAEKIKNLFNEAHTTGVLVIHQGQTQQ--SYGNDLARASTEYVPASTFKMLNALIGLE

AHL30286.1      DKKAEKIKNLFNEAHTTGVLVIQQGQTQQ--SYGNDLARASTEYVPASTFKMLNALIGLE

AHN53381.1      DKKAEKIKNLFNEVHTTGVLVIQQGQTQQ--SYGNDLARASTEYVPASTFKMLNALIGLE

AHL30282.1      DEKAEKIKNLFNEAHTTGVLVIQQGQTQQ--SYGNDLARASTEYVPASTFKMLNALIGLE

AHL30278.1      DEKAEKIKNLFNEAHTTGVLVIQQGQIQQ--SYGNDLARASTEYVPASTFKMLNALIGLE

AHL30284.1      DEKAEKIKYLFNEAHTTGVLVIQQGQIQQ--SYGNDLARASTEYVPASTFKMLNALIGLE

AHL30281.1      DEKAEKIKNLFNEVHTTGVLVIQQGQTQQ--SYGNDLARASTEYVPASTFKMLNALIGLE

AJA32744.1      DEKAEKIKNLFNEAHTTGVLVIQQGQTQQ--SYGNDFARASTEYVPASTFKMLNALIGLE

AGU69255.1      DEKAEKIKNLFNEAHTTGVLVIQQGQTQQ--SYGNDLARASTEYVPASTFKMLNALIGLE

AJG01377.1      DEKAEKIKNLFNEAHTTGVLVIQQGQTQQ--SYGNDLARASTEYVPASTFKMLNALIGLE

ACX31141.1      DEKAEKIKNLFNEAHTTGVLVIQQGQTQQ--SYGNDLARASTEYVPASTFKMLNALIGLE

AHL30273.1      DEKAEKIKNLFNEAHTTGVLVIQQGQTQQ--SYGNDLARASTEYVPASTFKMLNALIGLE

AGU69253.1      DEKAEKIKNLFNEAHTTGVLVIQQGQTQQ--SYGNDLARASTEYVPASTFKMLNALIGLE

AGU69254.1      DEKAEKIKNLFNEAHTTGVLVIQQGQTQQ--SYGNDLARASTEYVPASTFKMLNALIGLE

AHL30275.1      DEKAEKIKNLFNEAHTTGVLVIQQGQTQQ--SYGNDLVRASTEYVPASTFKMLNALIGLE

ADI58622.1      DVKAEKIKNLFNEAHTTGVLVIQQGQTQQ--SYGNDLARASTEYVPASTFKMLNALIGLE

ADI58618.1      DVKAEKIKNLFNEAHTTGVLVIQQGQTQQ--SYGNDLARASTEYVPASTFKMLNALIGLE

ADI58619.1      DVKAEKIRNLFNEAHTTGVLVIQQGQTQQ--SYGNDLARASTEYVPASTFKMLNALIGLE

ADI58620.1      DVKAEKIKNLFNEAHTTGVLVIQQGQTQQ--SYGNDLARASTEYVPASTFKMLNALIGLE

ADI58621.1      DVKAEKIKNLFNEAHTTGVLVIQQGQTQQ--SYGNDLARASTEYVPASTFKMLNALIGLE

ADX07746.1      DVKAEKIKNLFNEAHTTGVLVIQQGQTQQ--SYGNDLARASTEYVPASTFKMLNALIGLE

ALL53530.1      DVKAEKIKNLFNEAHTTGVLVIQQGQTQQ--SYGNDLARASTEYVPASTFKMLNALIGLE

AJA32743.1      DVKAEKIKNLFNEAHTTGVLVIQQGQTQQ--SYGNDLARASTEYVPASTLKMLNALIGLE

ADX07747.1      DVKAEKIKNLFNEAHTTGVLVIQQGQTQQ--SYGNDLARASTEYVPASTFKMLNALIGLE

ACD84989.1      DVKAEKIKNLFNEAHTTGVLVIQQGQTQQ--SYGNDLARASTEYVPASTFKMLNALIGLE

ADI58617.1      DVKAEKIKNLFNEAHTTGVLVIQQGQTQQ--SYGNDLARASTEYVPASTFKMLNALIGLE

AIZ00987.1      NKNSEKIQSLFDQAQTTGVLIIKRGQTEE--VYGNDLKRASTEYVPASTFKMLNALIGLE

AGZ83153.1      NKNSEEIKSLFDQAQTTGVLVIKRGQTEE--IYGNDLKRASTDYVPASTFKMLNALIGLE

AGW16408.1      NKNSEAIKSLFDQAQTTGVLVIKRGQTEE--IYGNDLKRASTDYVPASTFKMLNALIGLE

AGW16407.1      NKNSEEIKSLFDQAQTTGVLVIKRGQTEE--IYGNDLKRASTDYIPASTFKMLNALIGLE

AGW83450.1      NKNSEEIKSLFDQAQTTGVLVIKRGQTEE--IYGNDLKRASTDYIPASTFKMLNALIGLE

AGW16411.1      NKNSEAIKSLFDQAQTTGVLVIKRGQTEE--IYGNDLKRASTAYVPASTFKMLNALIGLE

AGW83452.1      NKNSEEIKSLFDQAQTTGVLVIKRGQTEE--IYGNDLKRASTDYVPASTFKMLNALIGLE

AGW83448.1      NKNSEEIKSLFDQAQTTGVLVIKRGQTEE--IYGNDLKRASTAYVPASTFKMLNALIGLE

AGW16413.1      NKNSEEIKSLFDQAQTTGVLVIKRGQTEE--IYGNDLKRASTAYVPASTFKMLNALIGLE

AGW83446.1      NKNSEEIKSLFDQAQTTGVLVIKRGQTEE--IYGNDLKRASTDYVPASTFKMLNALIGLE

AGW83449.1      NKNSEEIKSLFDQAQTTGVLVIKRGQTEE--IYGNDLKRASTDYVPASTFKMLNALIGLE

AGZ83155.1      NKNSEEIKSLFDQAQTTGVLVIKRGQTEE--IYGNDLKRASTEYVPASIFKMLNALIGLE

AGW83451.1      NKNSEEIKSLFDQAQTTGVLVIKRGKTEE--IYGNDLKRASTAYVPASTFKMLNALIGLE

AGW83447.1      NKNSEEIKSLFDQAQTTGVLVIKRGQTEE--IYGNDLKRAPTAYVPASTFKMLNALIGLE

AGW16406.1      NKNSEEIKSLFDQAQTTGVLVIKRGKTEE--IYGNDLKRASTAYVPASTFKMLNALIGLE

AGW16412.1      NKSSEEIKSLFDQAQTTGVLVIKRGQTEE--IYGNDLKRASTAYVPASTFKMLNALIGLE

AGW16410.1      NKNSEEIKSLFDQAQTTGVLVIKRGKTEE--IYGNDLKRASTAYVPASTFKMLNALIGLE

AGW16404.1      NKNSEEIKSLFDQAQTTGVLVIKRGQTEE--IYGNDLKRASTNYIPASTFKMLNALIGLE

AGZ83154.1      NKNSEEIKSLFDQAQTTGVLVIKRGQTEE--IYGNDLKRASTAYVPASTFKMLNALIGLE

AGW16409.1      NKNSEEIKSLFDQAQTTGVLVIKRGQTEE--IYGNDLKRASTAYVPASTFKMLNALIGLE

AGW16405.1      NKNSEEIKSLFDQAQTTGVLVIKRGQTEE--IYGNDLKRASTAYVPASTFKMLNALIGLE

AGW16414.1      NKNSEEIKSLFDQAQTTGVLVIKRGQTEE--IYGNDLKRASTAYVPASTFKMLNALIGLE

AGW16415.1      QSAQQQIQQAFNQLQTTGVIVIKDKHGLH--SYGNDLSRAQTPYVPASTFKILNALIGLE

AGW16416.1      QSTQQQIQQAFNQLQTTGVIVIKDKHGLH--SYGNDLSRAQTPYVPASTFKMLNALIGLE

ADK35870.1      QGHNQVIHQYFDEKNTSGALVIQTDKKIN--LYGNALSRANTEYVPASTFKMLNALIGLE

ADK35871.1      QGHNQVIHQYFDEKNTSGVLVIQTDKKIN--LYGNALSRANTEYVPASTFKMLNALIGLE

ADK35872.1      QGHNQVIHQYFDEKNTSGVLVIQTDKKIN--LYGNALSRANTEYVPASTFKMLNALIGLE

AJT57878.1      QGHNQVIHQYFDEKNTSGVLVIQTDKKIN--LYGNALSRANTEYVPASTFKMLNALIGLE

ADK35873.1      QGHNQVIHQYFDERNTSGVLVIQTDKKIN--LYGNALSRANTEYVPASTFKMLNALIGLE

ADK35874.1      QGHNQVIHQYFDEKNTSGVLVIQTDKKIN--LYGNALSRANTEYVPASTFKMLNALIGLE

AIT76095.1      QGHNQVIHQYFDEKNTSGVLVIQTDKKIN--LYGNALSRANTEYVPASTFKMLNALIGLE

AIY30331.1      QGHNQVIHQYFDEKNTSGVLVIQTDKKIN--LYGNALSRANTEYVPASTFKMLNALIGLE

AIY30332.1      QGHNQVIHQYFDEKNTSGVLVIQTDKKIN--LYGNALSRANTEYVPASTFKMLNALIGLE

AJO16038.1      QGHNQVIHQYFDEKNTSGVLVIQTDKKIN--LYGNALSRANTEYVPASTFKMLNALIGLE

AKF41839.1      QGHNQVINQYFDEKNTSGVLVIQTDKKIN--LYGNALSRANTEYVPASTFKMLNALIGLE

AKF41840.1      QGHNQVIHQYFDEKNTSGVLVIQTDKKIN--LYGNALSRANTEYVPASTFKMLNALIGLE

AKR53962.1      QGHNQVIHQYFDEKNTSGVLVIQTDKKIN--LYGNALSRANTEYVPASTFKMLNALIGLE

AKF41838.1      QGHNQVIHQYFDEKNTSGVLVIQTDKKIN--LYGNALSRANTEYVPASTFKMLNALIGLE

AFH36332.1      TQSIQTIAKLFDQAQSSGVLVIQRGPHLQ--VYGNDLSRAHTEYIPASTFKILNALIGLQ

AGZ83156.1      TQSIQAIVKLFDQAQSSGVLVIQRGPHLQ--VYGNELSRAHTEYVPASTFKMLNALIGLQ

AGW16417.1      ---TQAIASLFDQAQSSGVLVIQRDQQVQ--VYGNDLNRANTEYVPASTFKMPNALIGLQ

AHA11124.1      IQSTQAIAQLFDQAQSAGVLVIQRGQQIQ--VYGNDLSRANTEYVPASTFKMLNALIGLQ

ALM26450.1      TQSTQTIAQLFDQAQSSGVLGIQRGQQIQ--VYGNDLSRANTEYVPASTFKMLNALIGLQ

AHA11125.1      TQSTQAIAQLFDQAQSSGVLVIQRGQKVQ--VYGNDLSRAGTEYVPASTFKMLNALIGLQ

AHA11126.1      TQSTQAIAQLFDQAQSSGVLVIQRGQQIQ--VYGNDLSRADTEYVPASTFKMLNALIGLQ

AEM66528.1      EIVKPEFRNILDSLKVKGAILIYDVKNKT--YYSNDFSWTKTGIIPASTFKIPNSIIALE

ALA99191.1      IVERADWGKYFDAEGAKGTIIVLDGRTGG--YQAYDSTRANQRMSPASTYKIFNSLLALE

ALA99186.1      ITERADWGKLFAAEGVKGTIVVLDARTQT--YQAYDAARAGKRMSPASTYKIFNSLLALD

ALA99187.1      MKERADWGKFFDAEGVKGTIVVLDGRTQT--YQAFDTARAERRMSPASTYKIFNSLLALE

ALA99190.1      ITERADWGKYFADEGVKGTVVVLDGRTQT--YQAYDAARAERRLSPASTYKIFNSLLALE

ALA99192.1      IAERADWGKYFADEGVKGTVIVLDGRTQT--YQAYDAARAERRMSPASTYKIFNSLLALE

ALA99193.1      IAERADWGKYFADEGVKGTVIVLDGRTQT--YQAYDAARAERRMSPASTYKIFNSLLALE

ADT70779.1      AAEDQTLAELFAQQGIDGTIVISSLHNGK--TFIHNDPRAKQRFSTASTFKILNTLISLE

ADZ54048.1      SNETTLIDNIFTNSNAEGTLVIYNLNDDK--YIIHNKERAEQRFYPASTFKIYNSLIGLN

AEE61368.1      TLERSDWRKFFSEFQAKGTIVVADERQADRAMLVFDPVRSKKRYSPASTFKIPHTLFALD

AIG94927.1      TLERSDWRKFFSEFQAKGTIVVADERQADRAMLVFDPVRSKKRYSPASTFKIPHTLFALD

AHF71363.1      WQENKSWNAHFTEHKSQGVVVLWNENKQQ--GFTNNLKRANQAFLPASTFKIPNSLIALD

AJA30430.1      WQENKSWNAHFTEHKSQGVVVLWNENKQQ--GFTNNLKRANQAFLPASTFKIPNSLIALD

AKR53961.1      WQENKSWNAHFTEHKSQGVVVLWNENKQQ--GFTNNLKRANQAFLPASTFKIPNSLIALD

CAP69660.1      ISENLAWNKEFSSESVHGVFVLCKSSSNS--CTTNNATRASTAYIPASTFKIPNALIGLE

ADV41666.1      ITENTSWNKEFSAEAVNGVFVLCKSSSKS--CATNNLARASKEYLPASTFKIPNAIIGLE

AER57903.1      ITENTSWNKEFSAEAVNGVFVLCKSSSKS--CATNDLARASKEYLPASTFKIPNAIIGLE

AFN20670.1      ITENTSWNKEFSAEAVNGVFVLCKSSSKS--CATNDLARASKEYLPASTFKIPNAIIGLE

BAR45714.1      ITENTSWNKEFSAEAVNGVFVLCKSSSKS--CATNDLARASKEYLPASTFKIPNAIIGLE

AEQ73521.1      ASTDISTVASPLFEGTEGCFLLYDVSTN-TEIAQFNKAKCATQMAPDSTFKIALSLMAFD

AGR55864.1      ASTDISTVASPLFEGTEGCFLLYDASTN-AEIAQFNKAKCATQMAPDSTFKIALSLMAFD

CCE73593.2      AVLFASA-LTLPARADVLCTLVADAADGRILFQQGTRQDCTQRYTPASTFKLPIALMGAD

ALC76097.1      AALSLSALAGAPARAAVLCTVVADAADGRIVFQQGTQAACAERYTPASTFKLPIALMGAD

ALC76101.1      AALSLSALAGAPAQAAVLCTVVADAADGRIVYQQGTQQACAARYTPASTFKLPIALMGAD

ALC76098.1      AALSLSALAGAPAQAAILCTVVADAADGRIVYQQGTQQACAARYTPASTFKLPIALMGAD

ALC76099.1      AALSLSALAGAPAQAAILCTVVADAADGRIVYQQGTQQACAARYTPASTFKLPIALMGAD

AFQ90085.1      AALSLSALAGAPAQAAVLCTVVADAADGRIVYQQGTQQACAARYTPASTFKLPIALMGAD

ALC76100.1      AALSLSALAGAPAQAAVLCTVVADAADGRIVYQQGTQQACAARYTPASTFKLPIALMGAD

                                                               *  *:  :::. :

 

BAP28835.1      NHKATST-EI-FKWDGKPR----FFKAWDKDFTLGEAMQASTVPVYQELARRIGPSLMQS

AIT76118.1      NHKATST-EI-FKWDGKPR----FFKAWDKDFTLGEAMQASAVPVYQELARRIGPSLMQS

AIN56719.1      NAKATNT-EV-FHWNGEKR----AFSAWEKDMTLAEAMQASAVPVYQELARRIGLELMRE

AGW83453.1      NAKATNT-EV-FHWNGEKR----AFSAWEKDMTLAEAMQASAVPVYQELARRIGLELMRE

AGW83454.1      NAKATNT-EI-FHWNGEKR----AFSAWEKDMTLAEAMQASAVPVYQELARRIGLELMRE

AKL59536.1      NHKATTN-EI-FKWDGKKR----TYPMWEKDMTLGEAMALSAVPVYQELARRTGLELMQK

AJG01375.1      HHKATTT-EV-FKWDGQKR----LFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSK

AHL30287.1      HHKATTT-EV-FKWDGQKR----LFPKWEKDMTLGDAMKASAIPVYQDLARRIGLELMSK

AHL30285.1      HHKATTT-EV-FKWDGQKR----LFPEWEKDMTLGDAMKVSAIPVYQDLARRIGLELMSK

AHL30280.1      HHKATTT-EI-FKWDGQKR----LFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSK

AHI63011.1      HHKATTT-EV-FKWDGQKR----LFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSN

BAO09635.1      HHKATTT-EV-FKWDGEKR----LFPEWEKNMTLGDAMKASAIPVYQDLARRIGLELMSK

AJG01376.1      HHKATTT-EV-FKWDGEKR----LFPEWEKNMTLGDAMKASAIPVYQDLARRIGLELMSK

AHL30276.1      YHKATTT-EV-FKWDGQKR----LFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSK

AHL30277.1      HHKATTT-EV-FKWDGQKR----LFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSK

AJA32742.1      HHKATTT-EV-FKWDGEKR----LFPEWEKNMTLGDAMKASAIPVYQDLARRIGLELMSK

AHL30272.1      HHKATAT-EV-FKWDGQKR----LFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSK

AGU69252.1      HHKATTT-EV-FKWDGKKR----LFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSK

ADM26744.1      HHKATTT-EV-FKWDGQKR----LFPEWEKDMTLGDAMKASAIAVYQDLARRIGLELMSK

AHN07454.1      HHKATTT-EV-FKWDGQKR----LFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSK

AGU69250.1      HHKTTTT-EV-FKWDGQKR----LFPEWEKDMTLGDAMKASALPVYQDLARRIGLELMSK

AGU69251.1      HHKTTTT-EV-FKWDGQKR----LFPEWEKDMTLGDAMKASAIQVYQDLARRIGLELMSK

AHL30274.1      HHKTTTT-EV-FKWDGQKR----LFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSK

AHL30279.1      HHKATTT-EV-FKWNGQKR----LFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSN

AHL30283.1      HHKATTT-EV-FKWNGQKR----LFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSN

AJG01378.1      HHKATTT-EV-FKWNGQKR----LFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSN

AJG01379.1      HHKATTT-EV-FKWNGQKR----LFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSD

AHL30286.1      HHKATTT-EV-FKWNGQKR----LFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSN

AHN53381.1      HHKATTT-EV-FKWNGQKR----LFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSN

AHL30282.1      HHKATTT-EV-FKWDGQKR----LFPEWEKNMTLGDAMKASAIPVYQDLARRIGLELMSN

AHL30278.1      HHKATTT-EV-FKWDGQKR----LFPEWEKNMTLGDAMKASAIPVYQDLARRIGLELMSN

AHL30284.1      HHKATTT-EV-FKWDGQKR----LFPEWEKNMTLGDAMKASAIPVYQDLARRIGLELMSN

AHL30281.1      HHKATTT-EV-FKWDGQKR----LFPEWEKNMTLGDAMKASAIPVYQDLARRIGLELMSN

AJA32744.1      HHKATTT-EV-FKWDGQKR----LFPEWEKNMTLGDAMKASAIPVYQDLARRIGLELMSN

AGU69255.1      HHKATTT-EV-FKWDGQKR----LFPEWEKNMTLGDAMKASAIPVYQDLARRIGLELMSN

AJG01377.1      HHKATTT-EV-FKWDGQKR----LFPEWEKNMTLGDAMKASAIPVYQDLARRIGLELMSN

ACX31141.1      HHKATTT-EV-FKWDGQKR----LFPEWEKNMTLGDAMKASAIPVYQDLARRIGLELMSN

AHL30273.1      HHKATTT-EV-FKWDGQKR----LFPEWEKNMTLGDAMKASAIPVYQDLARRIGLELMSN

AGU69253.1      HHKATTT-EV-FKWDGKKR----LFPEWEKDMTLGDAMKASAIPIYQDLARRIGLELMSK

AGU69254.1      HHKATTT-EV-FKWDGKKR----LFPEWEKDMTLGDAMEASAIPVYQDLARRIGLELMSK

AHL30275.1      HHKATTT-EV-FKWDGKKR----LFREWEKDMTLGDAMKASAIPVYQDLARRIGLELMSN

ADI58622.1      HHKATTT-EV-FKWDSKKR----LFPEWEKDMTLGDAMKASAILVYQDLARRIGLELMSK

ADI58618.1      HHKATTT-EV-FKWDGKKR----LFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSK

ADI58619.1      HHKATTT-EV-FKWDGKKR----LFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSK

ADI58620.1      HHKATTT-EV-FKWDSKKR----LFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSK

ADI58621.1      HHKATTT-EV-FKWDGKKR----LFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSK

ADX07746.1      HHKATTT-EV-FKWDGKKR----LFPEWEKDMTLGDAMKASAIQVYQDLARRIGLELMSK

ALL53530.1      HHKATTT-EV-FKWDGKKR----LFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSK

AJA32743.1      HHKATTT-EV-FKWDGKKR----LFPEWEKDMTLGDAMKASALPVYQDLARRIGLELMSK

ADX07747.1      HHKATTT-EV-FKWDGKKR----LFPEWEKDMTLGDAMKASAMPVYQDLARRIGLELMSK

ACD84989.1      HHKATTT-EV-FKWDGKKR----LFPEWEKDMTLGDAMKASAVPVYQDLARRIGLELMSK

ADI58617.1      HHKATTT-EV-FKWDGKKR----LFPEWEKDMTLGDAMKASAVPVYQDLARRIGLELMSK

AIZ00987.1      HHKATPT-EV-FKWDGQKR----LFPDWEKDMTLGDAMKASAIPVYQELARRIGLDLMSK

AGZ83153.1      HHKVTTT-EV-FKWDGQKR----LFPDWEKDMTLGDAMKASAIPVYQELARRIGLDLMSK

AGW16408.1      HHKVTTT-EV-FKWDGQKR----LFPDWEKDMTLGDAMKASAIPVYQELARRIGLDLMSK

AGW16407.1      HHKATTT-EV-FKWDGQKR----LFPDWEKDMTLGDAMKASAIPVYQELARRIGLDLMSK

AGW83450.1      HHKATTT-EV-FKWDGQKR----LFPDWEKDMTLGDAMKASAIPVYQELARRIGLDLMSK

AGW16411.1      HHKAITT-EV-FKWDGQKR----LFPDWEKDMTLGDAMKASAIPVYQELARRIGLDLMSK

AGW83452.1      HHKATTT-EV-FKWDGQKR----LFPDWEKDMTLGDAMKASAIPVYQELARRIGLDLMSK

AGW83448.1      HHKATTT-EV-FKWDGQKR----LFPDWEKDMTLGDAMKASAIPVYQELARRIGLDLMSK

AGW16413.1      HHKATIT-EV-FKWNGQKR----LFPDWEKDMTLSDAMKASAIPVYQELARRIGLDLMSK

AGW83446.1      HHKATTT-EV-FKWNGQKR----LFPDWEKDMTLSDAMKASAIPVYQELARRIGLDLMSK

AGW83449.1      HHKATTT-EV-FKWNGQKR----LFPDWEKDMTLSDAMKASAIPVYQELARRIGLDLMSK

AGZ83155.1      HHKATAT-EV-FKWDGQKR----LFPDWEKDMTLGDAMKASAIPVYQELARRIGLDLMSK

AGW83451.1      HHKATTT-EV-FKWNGQKR----LFPDWKKDMTLGDAMKASAIPVYQELARRIGLDLMSK

AGW83447.1      HHKATTT-EV-FKWDGQKR----LFPDWEKDMTLGDAMKASAIPVYQELARRIGLDLMSK

AGW16406.1      HHKATAT-EV-FKWDGQKR----LFPDWEKDMTLGDAMKASAIPVYQELARRIGLDLMSK

AGW16412.1      HHKATTT-EV-FKWNGQKR----LFPDWEKDMTLGDAMKASAIPVYQELARRIGLDLMSK

AGW16410.1      HHKATTT-EV-FKWDGQKR----LFPDWEKDMTLGNAMKASAIPVYQELAQRIGLDLMSK

AGW16404.1      HHKATTT-EV-FKWDGQKR----LFPDWEKDMTLGDAMKASAIPVYQELARRIGLDLMSK

AGZ83154.1      HHKATTT-EV-FKWDGQKR----LFPDWEKDMTLGDAMKASAIPVYQELARRIGLDLMSQ

AGW16409.1      HHKATTT-EV-FKWNGQKR----LFPDWEKDMTLGDAMKASAIPVYQELARRIGLDLMSK

AGW16405.1      HHKATIT-EV-FKWDGQKR----LFPDWEKDMTLGDAMKASAIPVYQELARRIGLDLMSK

AGW16414.1      HHKATTT-EV-FKWDGQKR----LFPDWEKDMTLGDAMKASAIPVYQELARRIGLDLMSK

AGW16415.1      HGKATST-EV-FKWDGQKR----SFPTWEKDMTLGQAIQASAVPVYQELARRIGLDLMQK

AGW16416.1      HGKATRT-EV-FKWDGQKR----SFTAWEKDMTLGQAMQASAVPVYQELARRIGVDLMQK

ADK35870.1      NQKTDIN-EI-FKWKGEKR----SFTAWEKDMTLGEAMKLSAVPVYQELARRIGLDLMQK

ADK35871.1      NQKTDIN-EI-FKWKGEKR----SFTAWEKDMTLGEAMKLSAVPVYQELARRIGLDLMQK

ADK35872.1      NQKTDIN-EI-FKWKGEKR----SFTAWEKDMTLGEAMKLSAVPVYQELARRIGLDLMQK

AJT57878.1      NQKTDIN-EI-FKWKGEKR----SFTAWEKDMTLGEAMKLSAVPVYQELARRIGLDLMQK

ADK35873.1      NQKTDIN-EI-FKWKGEKR----SFTAWEKDMTLGEAMKLSAVPVYQELARRIGLDLMQK

ADK35874.1      NQKTDIN-EI-FKWKGEKR----SFTAWEKDMTLGEAMKLSAVPVYQELARRIGLDLMQK

AIT76095.1      NQKTDIN-EI-FKWKGEKR----SFTAWEKDMTLGEAMKLSAVPVYQELARRIGLDLMQK

AIY30331.1      NQKTDIN-EI-FKWKGEKR----SFTAWEKDMTLGEAMKLSAVPVYQELARRIGLDLMQK

AIY30332.1      NQKTDIN-EI-FKWKGEKR----SFTAWEKDMTLGEAMKLSAAPVYQELARRIGLDLMQK

AJO16038.1      NQKTDIN-EI-FKWKGEKR----SFTAWEKDMTLGEAMKLSAVPVYQELARRIGLDLMQK

AKF41839.1      NQKTDIN-EI-FKWKGEKR----SFTAWEKDMTLGEAMKLSAVPVYQELARRIGLDLMQK

AKF41840.1      NQKTDIN-EI-FKWKGEKR----SFTAWEKDMTLGEAMKLSAVPVYQELARRIGLDLMQK

AKR53962.1      NQKTDIN-EI-FKWKGEKR----SFTAWEKDMTLGEAMKLSAVPVYQELARRIGLDLMQK

AKF41838.1      NQKTDIN-EI-FKWKGEKR----SFTAWEKDMTLGEAMKLSAVPVYQELARRIGLDLMQK

AFH36332.1      HGKATTN-EI-FKWDGKKR----SFAAWEKDMTLGQAMQASAVPVYQELARRIGLELMQQ

AGZ83156.1      HGKATTN-EI-FKWDRKKR----SFAAWEKDMTLGQAMQASAVPVYQELARRIGLELMQQ

AGW16417.1      HGKATTN-EI-FKWDGKKR----SFTAWEKDMTLGQAMQASAVPVYQELARRIGLELMQQ

AHA11124.1      HGKATTN-EI-FKWDGKKR----SFSAWEKDMTLGQAMQASAVPVYQELARRIGLELMQQ

ALM26450.1      HGKATTN-EI-FKWDGKKR----SFSAWEKDMTLGQAMQASAVPVYQELARRIGLELMQQ

AHA11125.1      HGKATTN-EI-FKWDGKKR----SFAAWEKDMTLGEAMQASAVPVYQELARRIGLELMQQ

AHA11126.1      HGKATTN-EI-FKWDGKKR----SFSAWEKDMTLGQAMQASAVPVYQELARRIGLELMQQ

AEM66528.1      TGIIKNDSTI-FKWNGEKR----KFKNWEEDLTFKKAFQVSCVPCYQEIARKIGVKRMKR

ALA99191.1      SGALDNEREI-IPWDGKPR----SMKRWNAAMNLRDAFRVSCLPCYQVVSRKIARTYAQG

ALA99186.1      SGALDNERAI-IPWDGKPR----RIKNWNAAMDLRTAFRVSCLPCYQVVSHKIGRQYAQA

ALA99187.1      SGALDNEREI-IPWDGKPR----RGKYWNAAMDLRTAFRVSCLPCYQVVSHKIARQFAQS

ALA99190.1      SGAIDNEREV-IPWDGKPR----SMKAWNAALNLRDAFRVSCLPCYQILSHKIPRQYAQA

ALA99192.1      SGALDNEREV-IPWDGKPR----RVKAWNAALDLRNAFRVSCLPCYQVVSHKIPRQYAQA

ALA99193.1      SGALDNEREV-IPWDGKPR----RVKAWNAALDLRNAFRVSCLPCYQVVSHKIPRQYAQA

ADT70779.1      EKAISGKDDV-LKWDGHIY----DFPDWNRDQTLESAFKVSCVWCYQALARQVGAEKYRN

ADZ54048.1      EKAVKDVDEVFYKYNGEKV----FLESWAKDSNLRYAIKNSQVPAYKELARRIGLEKMKE

AEE61368.1      AGAVRDEFQI-FRWDGVNR----GFAGHNQDQDLRSAMRNSTVWVYELFAKEIGDDKARR

AIG94927.1      AGAVRDEFQI-FRWDGVNR----GFAGHNQDQDLRSAMRNSTVWVYELFAKEIGDDKARR

AHF71363.1      LGVVKDEHQV-FKWDGQTR----DIATWNRDHNLITAMKYSVVPVYQEFARQIGEARMSK

AJA30430.1      LGVVKDEHQV-FKWDGQTR----DIATWNRDHNLITAMKYSVVPVYQEFARQIGEARMSK

AKR53961.1      LGVVKDEHQV-FKWDGQTR----DIATWNRDHNLITAMKYSVVPVHQEFARQIGEARMSK

CAP69660.1      TGAIKDARQV-FKWDGKPR----AMKQWEKDLTLRGAIQVSAVPVFQQIARDIGKKRMQK

ADV41666.1      TGVIKNEHQV-FKWDGKPR----AMKQWERDLSLRGAIQVSAVPVFQQIAREVGEVRMQK

AER57903.1      TGVIKNEHQV-FKWDGKPR----AMKQWERDLTLRGAIQVSAVPVFQQIAREVDEVRMQK

AFN20670.1      TGVIKNEHQV-FKWDGKPR----AMNQWERDLTLRGAIQVSAVPVFQQIAREVGEVRMQK

BAR45714.1      TGVIENEHQV-FKWDGKPR----AMKQWERDLTLRGAIQVSAVPVFQQIAREVGEVRMQK

AEQ73521.1      AEIIDQKTI--FKWDKTPK----GMEIWNSNHTPKTWMQFSVVWVSQEITQKIGLNKIKN

AGR55864.1      AEIIDQKTI--FKWDKTPK----GMEIWNSNHTPKTWMQFSVVWVSQEITQKIGLNKIKN

CCE73593.2      AGILQGPHQ--PVWNYQPAYPDWGGEAWRQPTDPARWIKYSVVWYSQLTARALGQERFQR

ALC76097.1      AGILQGPHA--PVWNYQPGYPDWGGDAWRQPTDPARWIKYSVVWYSQLTARALGQERFQR

ALC76101.1      AGILTGPHA--PVWNYQPDYPDWGGDAWRQPTDPARWIKYSVVWYSQLTARALGQERFQR

ALC76098.1      AGILTGPHA--PVWNYQPGYPDWGGDAWRQPTDPARWIKYSVVWYSQLTARALGQERFQR

ALC76099.1      AGILTGPHA--PVWNYQPGYPDWGGDAWRQPTDPARWIKYSVVWYSQLTARALGQERFQR

AFQ90085.1      AGILTGPHA--PVWNYQPGYPDWGGDAWRQPTDPARWIKYSVVWYSQLTARALGQERFQR

ALC76100.1      AGILTGPHA--PVWNYQPGYPDWGGDAWRQPTDPARWIKYSVVWYSQLTARALGQERFQR

                             :.                      :  *     :  ::        

 

BAP28835.1      ELQRIGYGNMQI-GT-----EVDQFWLKGPLTITPIQEVKFVYDLAQGQLPFKPEVQQ-Q

AIT76118.1      ELQRIGYGNMQI-GT-----EVDQFWLKGPLTITPIQEVKFVYDLAQGQLPFKPEVQQ-Q

AIN56719.1      EVKRVGFGNAEI-GQ-----QVDNFWLVGPLKISPEQEVQFAYQLAMKQLPFDRNVQQ-Q

AGW83453.1      EVKRVGFGNAEI-GQ-----QVDNFWLVGPLKISPEQEVQFAYQLAMKQLPFDRNVQQ-Q

AGW83454.1      EVKRVGFGNAEI-GQ-----QVDNFWLVGPLKISPEQEVQFAYQLAMKQLPFDRNVQQ-Q

AKL59536.1      EVKRVNFGNTNI-GT-----QVDNFWLVGPLKITPVQEVNFADDLAHNRLPFKLETQE-E

AJG01375.1      EVKRVGYGNADI-GT-----QVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQD-E

AHL30287.1      EVKRVGYGNADI-GT-----QVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQD-K

AHL30285.1      EVKRVGYGNADI-GT-----QVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQD-E

AHL30280.1      EVKRVGYGNADI-GT-----QVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSLKVQD-E

AHI63011.1      EVKRVGYGNADI-GT-----QVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSPKVQD-E

BAO09635.1      EVKRVGYGNADI-GT-----QVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQD-E

AJG01376.1      EVKRVGYGNADI-GT-----QVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQD-E

AHL30276.1      EVKRVGYGNADI-GT-----QVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSPKVQD-E

AHL30277.1      EVKRVGYGNADI-GT-----QVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSPKVQD-E

AJA32742.1      EVKRVGYGNADI-GT-----QVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQD-E

AHL30272.1      EVKRVGYGNADI-GT-----QVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQD-E

AGU69252.1      EVKRVGYGNADI-GT-----QVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSPKVQD-E

ADM26744.1      EVKRVGYGNADI-GT-----QVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSPKVQD-E

AHN07454.1      EVKRVGYGNADI-GT-----QVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSPKVQD-E

AGU69250.1      EVKRVGYGNADI-GT-----QVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSPKVQD-E

AGU69251.1      EVKRVGYGNADI-GT-----QVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSPKVQD-E

AHL30274.1      EVKRVGYGNADI-GT-----QVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSPKVQD-E

AHL30279.1      EVKRIGYGNADI-GT-----QVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQD-E

AHL30283.1      EVKRVGYGNADI-GT-----QVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQD-E

AJG01378.1      EVKRVGYGNADI-GT-----QVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQD-E

AJG01379.1      EVKRVGYGNADI-GT-----QVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQD-E

AHL30286.1      EVKRVGYGNADI-GT-----QVDNFWLVGPLKITPQQEAQFTYKLANKTLPFSQKVQD-E

AHN53381.1      EVKRVGYGNADI-GT-----QVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQD-E

AHL30282.1      EVKRIGYGNADI-GT-----QVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQD-E

AHL30278.1      EVKRIGYGNADI-GT-----QVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQD-E

AHL30284.1      EVKRIGYGNADI-GT-----QVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQD-E

AHL30281.1      EVKRVGYGNADI-GT-----QVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQD-E

AJA32744.1      EVKRVGYGNADI-GT-----QVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQEVQD-E

AGU69255.1      EVKRVGYGNADI-GT-----QVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQE-E

AJG01377.1      EVKRVGYGNADI-GT-----QVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQD-E

ACX31141.1      EVKHVGYGNADI-GT-----QVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSPKVQD-E

AHL30273.1      EVKRVGYGNADI-GT-----QVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQD-E

AGU69253.1      EVKRVGYGNADI-GT-----QVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQD-E

AGU69254.1      EVKRVGYGNADI-GT-----QVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQD-E

AHL30275.1      EVKRVGYGNADI-GT-----QVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQD-E

ADI58622.1      EVKRVGYGNADI-GT-----QVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQD-E

ADI58618.1      EVKRVGYGNADI-GT-----QVDNFWVVGPLKITPQQEAQFAYKLANKTLPFSQKVQD-E

ADI58619.1      EVKRVGYGNADI-GT-----QVDNFWVVGPLKITPQQEAQFAYKLANKTLPFSQKVQD-E

ADI58620.1      EVKRVGYGNADI-GT-----QVDNFWVVGPLKITPQQEAQFAYKLANKTLPFSQKVQD-E

ADI58621.1      EVKRVGYGNADI-GT-----QVDNFWVVGPLKITPQQEAQFAYKLANKTLPFSQKVQD-G

ADX07746.1      EVKRVGYGNADI-GT-----QVDNFWVVGPLKITPQQEAQFAYKLANKTLPFSQKVQD-E

ALL53530.1      EVKRVGYGNADI-GT-----QVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQD-E

AJA32743.1      EVKRVGYGNADI-GT-----QVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQD-E

ADX07747.1      EVKRVGYGNADI-GT-----QVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQD-E

ACD84989.1      EVKRVGYGNADI-GT-----QVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQD-E

ADI58617.1      EVKRVGYGNADI-GT-----QVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQD-E

AIZ00987.1      EVKRIDFGNADI-GS-----KIDNFWLVGPLKITPQQEAQFAYELAHKTLPFSKNVQE-Q

AGZ83153.1      EVKRIGFGNADI-GS-----KVDNFWLVGPLKISPEQETQFAYKLANKTLPFSKNVQE-Q

AGW16408.1      EVKRIGFGNANI-GS-----KVDDFWLVGPLKITPQQETQFAYQLAHKTLPFSKNVQE-Q

AGW16407.1      EVKRIGFGNANI-GS-----KVDDFWLVGPLKITPQQETQFAYQLAHKTLPFSKNVQE-Q

AGW83450.1      EVKRIGFGNANI-GS-----KVDDFWLVGPLKITPQQETQFAYQLAHKTLPFSKNVQE-Q

AGW16411.1      EVKRIGFGNANI-GS-----KVDDFWLVGPLKITPQQETQFAYQLAHKMLPFSKDVQE-Q

AGW83452.1      EVKRIGFGNANI-GS-----KVDDFWLVGPLKITPQQETQFAYQLAHKMLPFSKDVQE-Q

AGW83448.1      EVKRIGFGNANI-GS-----KVDDFWLVGPLKITPQQETQFAYQLAHKTLPFSKNVQE-Q

AGW16413.1      EVKRIGFGNANI-GS-----KVDDFWLVGPLKITPQQETQFAYQLAHKTLPFSKNVQE-Q

AGW83446.1      EVKRIGFGNANI-GS-----KVDDFWLVGPLKITPQQETQFAYQLAHKTLPFSKNVQE-Q

AGW83449.1      EVKRIGFGNANI-GS-----KVDDFWLVGPLKITPQQETQFAYQLAHKTLPFSKNVQE-Q

AGZ83155.1      EVKRIGFGNANI-GS-----KVDNFWLVGPLKITPQQEAQFAYQLAHKTLPFSKDVQE-Q

AGW83451.1      EVKRIGFGNANI-GS-----KVDDFWLVGPLKITPQQETQFAYQLAHKTLPFSKNVQE-Q

AGW83447.1      EVKRVGFGNASI-GS-----KVDNFWLVGPLKITPQQETQFAYQLALKTLPFSQDVQE-Q

AGW16406.1      EVKRIGFGNANI-GS-----KVDNFWLVGPLKITPQQETQFAYQLAHKTLPFSKDVQE-Q

AGW16412.1      EVKRIGFGNANI-GS-----KVDNFWLVGPLKITPQQETQFAYQLAHKTLPFSKNVQE-Q

AGW16410.1      EVKRIGFGNANI-GS-----KVDNFWLVGPLKITPQQETQFAYQLAHKTLPFSKNVQE-Q

AGW16404.1      EVKRIGFGNANI-GS-----KVDDFWLVGPLKITPQQETQFAYQLAHKTLPFSQDVQE-Q

AGZ83154.1      EVKRVGFGNANI-GS-----KVDNFWLVGPLKITPQQETQFAYQLAHKTLPFSQDVQE-Q

AGW16409.1      EVKRIGFGNANI-GS-----KVDNFWLVGPLKITPQQETQFAYQLAHKTLPFSQDVQE-Q

AGW16405.1      EVKRIGFGNANI-GS-----KVDNFWLVGPLKITPQQETQFAYQLAHKTLPFSQDVQE-Q

AGW16414.1      EVKRIGFGNANI-GS-----KVDNFWLVGPLKITPQQETQFAYQLAHKTLPFSKDVQE-Q

AGW16415.1      EVQRIGYGNQQI-GT-----VVDNFWLVGPLQITPVQEVLFVEKLANIQLAFKPDVQH-T

AGW16416.1      EVQRIGYGNQQI-GT-----VVDNFWLVGPLQITPVQEVLFVEKLANTQLAFKPDVQH-T

ADK35870.1      EVKRIGFGNAEI-GQ-----QVDNFWLVGPLKVTPIQEVEFVSQLAHTQLPFSEKVQA-N

ADK35871.1      EVKRIGFGNAEI-GQ-----QVDNFWLVGPLKVTPIQEVEFVSQLAHTQLPFSEKVQA-N

ADK35872.1      EVKRIGFGNAEI-GQ-----QVDNFWLVGPLKVTPIQEVEFVSQLAHTQLPFSEKVQA-N

AJT57878.1      EVKRIGFGNAEI-GQ-----QVDNFWLVGPLKVTPIQEVEFVSQLAHTQLPFSEKVQA-N

ADK35873.1      EVKRIGFGNAEI-GQ-----QVDNFWLVGPLKVTPIQEVEFVSQLAHTQLPFSEKVQA-N

ADK35874.1      EVKRIGFGNAEI-GQ-----QVDNFWLVGPLKVTPIQEVEFVSQLAHTQLPFSEKVQA-N

AIT76095.1      EVKRIGFGNAEI-GQ-----QVDNFWLVGPLKVTPIQEVEFVSQLAHTQLPFSEKVQA-N

AIY30331.1      EVKRIGFGNAEI-GQ-----QVDNFWLVGPLKVTPIQEVEFVSQLAHTQLPFSEKVQA-N

AIY30332.1      EVKRIGFGNAEI-GQ-----QVDNFWLVGPLKVTPIQEVEFVSQLAHTQLPFSEKVQA-N

AJO16038.1      EVKRIGFGNAEI-GQ-----QVDNFWLVGPLKVTPIQEVEFVSQLAHTQLPFSEKVQA-N

AKF41839.1      EVKRIGFGNAEI-GQ-----QVDNFWLVGPLKVTPIQEVEFVSQLAHTQLPFSEKVQA-N

AKF41840.1      EVKRIGFGNAEI-GQ-----QVDNFWLVGPLKVTPIQEVEFVSQLAHTQLPFSEKVQA-N

AKR53962.1      EVKRIGFGNAEI-GQ-----QVDNFWLVGPLKVTPIQEVEFVSQLAHTQLPFSEKVQA-N

AKF41838.1      EVKRIGFGNAEI-GQ-----QVDNFWLVGPLKVTPIQEVEFVSQLAHTQLPFSEKVQA-N

AFH36332.1      EVQRIRFGNQQI-GQ-----HIDNFWLVGPLKITPVQEVEFASALAQEQLAFDPQVQQ-Q

AGZ83156.1      EVQRIQFGNQQI-GQ-----HIDNFWLVGPLKVTPKQEVKFASALAQEQLAFDPRFQQ-Q

AGW16417.1      EVQRIQFGNQQI-GQ-----QVDNFWLVGPLKVTPKQEVQFVSALAREQLAFDPQVQQ-Q

AHA11124.1      EVQCIQFGNQQI-GQ-----QVDNFWLVGPLKVTPKQEVQFVSALAREQLAFDPQVQQ-Q

ALM26450.1      EVQRIQFGNQQI-GQ-----QVDNFWLVGPLKVTPKQEVQFVSVLAREQLAFDPQVQQ-Q

AHA11125.1      EVRRIQFGNQQI-GQ-----QVDNFWLVGPLKITPKQEVEFVSALAREQLAFDPQVQQ-Q

AHA11126.1      EVQRIQFGNQQI-GQ-----QVDNFWLVGPLKITPKQEVEFVSALAREQLAFDPQVQQ-Q

AEM66528.1      YLKKLNYRGMVFDTL-----TIDQFWLEGESKITQMQQIDFLERLYFSKFPISDRTIK-I

ALA99191.1      KLDAVGYGNHTI-GS-----AADAYWVDNSLQISAREQVVFLQRLARGQLPFSARTQD-I

ALA99186.1      KLNEVGYGNRTI-GG-----APDAYWVDDSLQISAREQVDFVQRLARGTLPFSARSQD-I

ALA99187.1      KLNEAGYGNHTI-GR-----AADAYWVDDSLQISAREQVDFLQRLARGTLPFSARSQD-I

ALA99190.1      KLNEVGYGNRTI-GH-----AADTYWVDDSLQISAREQVDFLQRLAKGTLPFSARSQD-I

ALA99192.1      KLNEAGYGNRTI-GR-----AAHAYWIDDSLQISAREQVDFLQRLATGTLPFSARSQD-I

ALA99193.1      KLNEAGYGNRTI-GR-----AAHAYWIDDSLQISAREQVDFLQRLATGALPFSARSQD-I

ADT70779.1      YLRKSVYGELRE-PF-----EETTFWLDGSLQISAIEQVNFLKKVHLRTLPFSASSYE-T

ADZ54048.1      NIEKLDFGNKNI-GD-----SVDTFWLEGPLEISAMEQVKLLTKLAQNELPYPIEIQK-A

AEE61368.1      YLKKIDYGNADP-ST-----SNGDCWIEGSLAISAQEQIAFLRKLYRNELPFRVEHQR-L

AIG94927.1      YLKKIDYGNADP-ST-----SNGDYWIEDSLAISAQEQIAFLRKLYRNELPFRVEHQR-L

AHF71363.1      MLHAFDYGNEDI-SG-----NVDSFWLDGGIRISATEQISFLRKLYHNKLHVSERSQR-I

AJA30430.1      MLHAFDYGNEDI-SG-----NVDSFWLDGGIRISATEQISFLRKLYHNKLHVSERSQR-I

AKR53961.1      MLHAFDYGNEDI-SG-----NVDSFWLDGGIRISATEQISFLRKLYHNKLHVSERSQR-I

CAP69660.1      YLNLFSYGNANI-GG-----GIDKFWLEGQLRISAVNQVKFLESLYLNNLPASKANQL-I

ADV41666.1      YLKKFSYGNQNI-SG-----GTDKFWLEDQLRISAVNQVEFLESLFLNKLSASKENQL-I

AER57903.1      YLKNFSYGNQNI-SG-----GIDKFWLEGQLRISAVNQVEFLESLYLNKLSASKENQL-T

AFN20670.1      YLKKFSYGNQNI-SG-----GIDKFWLEGQLRISAVNQVEFLESLYLNKLSASKENQL-I

BAR45714.1      YLKKFSYGNQNI-SG-----GIDKFWLKGQLRISAVNQVEFLESLYLNKLSASKENQL-I

AEQ73521.1      YLKDFDYGNQDFSGDKERNNGLTEAWLESSLKISPEEQIQFLRKIINHNLPVKNSAIENT

AGR55864.1      YLKDFDYGNQDFSGDKERNNGLTEAWLESSLKISPEEQIQFLRKIINHNLPVKNSAIENT

CCE73593.2      YTSAFGYGNADVSGEPGKHNGTDGAWIISSLRISPFEQVDFLRKFVNRQLPVKAAAYD-L

ALC76097.1      YASAFQYGNEDVSGEPGKHNGLDGAWINSSLRISPLEQLAFLRKLVNRQLPLKPAAYD-L

ALC76101.1      YASAFHYGNEDVSGEPGKHNGTDGAWIISSLRISPLEQLAFLRKVVNRQLPVKAAAYD-L

ALC76098.1      YASAFHYGNEDVSGEPGKHNGLDGAWINSSLRISPLEQLAFLRKLVNRQLPVKAAAYD-L

ALC76099.1      YASAFHYGNEDVSGEPGKHNGLDGAWINSSLRISPLEQLAFLRKLVNRQLPVKAAAYD-L

AFQ90085.1      YASAFHYGNEDVSGEPGKHNGLDGAWINSSLRISPLEQLAFLRKLVNRQLPLKAAAYD-L

ALC76100.1      YASAFHYGNEDVSGEPGKHNGLDGAWINSSLRISPLEQLAFLRKLVNRQLPLKAAAYD-L

                      :                  *: .   ::  ::  :   .    :         

 

BAP28835.1      VKEMLYVERRGENRLYAKSGWG---MAV----DPQVGWYVGFVEKADGQVVAFALNMQMK

AIT76118.1      VKEMLYVERRGENRLYAKSGWG---MAV----DPQVGWYVGFVEKADGQVVAFALNMQMK

AIN56719.1      VKNMLYIERRGDSKLYAKSGWG---MDV----KPQVGWYTGWVEQPNGKVTAFALNMNMQ

AGW83453.1      VKDMLYIERRGDSKLYAKSGWG---MDV----EPQVGWYTGWVEQPNGKVTAFALNMNMQ

AGW83454.1      VKDMLYIERRGDSKLYAKSGWG---MDV----EPQVGWYTGWVEQPNGKVTAFALNMNMQ

AKL59536.1      VKKMLLIKEVNGSKIYAKSGWG---MGV----TPQVGWLTGWVEQANGKKISFSLNLEMK

AJG01375.1      VQSMLFIEEKNGNKIYAKSGWG---WDV----DPQVGWLTGWVVQPQGNIVAFSLNLEMK

AHL30287.1      VQSMLFIEEKNGNKIYAKSGWG---WDV----DPQVGWLTGWVVQPQGNIVAFSLNLEMK

AHL30285.1      VQSMLFIEEKNGNKIYAKSGWG---WDV----DPQVGWLTGWVVQPQGNIVAFSLNLEMK

AHL30280.1      VQSMLFIEEKNGNKIYAKSGWG---WDV----DPQVGWLTGWVVQPQGNIVAFSLNLEMK

AHI63011.1      VQSMLFIEEKNGNKIYAKSGWG---WDV----DPQVGWLTGWVVQPQGNIVAFSLNLEMK

BAO09635.1      VQSMLFIEEKNGNKIYAKSGWG---WDV----NPQVGWLTGWVVKPQGNIVAFSLNLEMK

AJG01376.1      VQSMLFIEEKNGNKIYAKSGWG---WDV----NPQVGWLTGWVVQPQGNIVAFSLNLEMK

AHL30276.1      VQSMLFIEEKNGNKIYAKSGWG---WDV----DPQVGWLTGWVVQPQGNIVAFSLNLEMK

AHL30277.1      VQSMLFIEEKNGNKIYAKSGWG---WDV----DPQVGWLTGWVVQPQGNIVAFSLNLEMK

AJA32742.1      VQSMLFIEEKNGNKIYAKSGWG---WDV----DPQVGWLTGWVVQPQGNIVAFSLNLEMK

AHL30272.1      VQSMLFIEEKNGNKIYAKSGWG---WDV----DPQVGWLTGWVVQPQGNIVAFSLNLEMK

AGU69252.1      VQSMLFIEEKNGNKIYAKSGWG---WDV----DPQVGWLTGWVVQPQGNIVAFSLNLEMK

ADM26744.1      VQSMLFIEEKNGNKIYAKSGWG---WDV----DPQVGWLTGWVVQPQGNIVAFSLNLEMK

AHN07454.1      VQSMLFIEEKNGNKIYAKSGWG---WDV----DPQVGWLTGWVVQPQGNIVAFSLNLEMK

AGU69250.1      VQSMLFIEEKNGNKIYAKSGWG---WDV----DPQVGWLTGWVVQPQGNIVAFSLNLEMK

AGU69251.1      VQSMLFIEEKNGNKIYAKSGWG---WDV----DPQVGWLTGWVVQPQGNIVAFSLNLEMK

AHL30274.1      VQSMLFIEEKNGNKIYAKSGWG---WDV----DPQVGWLTGWVVQPKGNIVAFSLNLEMK

AHL30279.1      VQSMLFIEEKNGNKIYAKSGWE---WDV----D