#

#

#  Percent Identity  Matrix - created by Clustal2.1

#

#

 

     1: CAJ47128.2  100.00   97.54   97.89   97.89   97.89   97.89   98.60   97.54   97.54   98.25   98.60   97.89   98.25   98.25   97.89   97.89   97.89   97.89   97.89   98.25   97.89   98.25   97.89   98.25   97.89   98.25   98.25   98.60

     2: ACM04459.1   97.54  100.00   99.65   98.25   98.25   98.25   98.25   98.60   98.60   98.25   98.60   98.25   98.60   98.60   98.95   98.95   98.95   98.95   98.95   98.60   98.95   98.60   98.95   98.95   98.95   99.30   98.60   98.95

     3: CAI30650.2   97.89   99.65  100.00   98.60   98.60   98.60   98.60   98.95   98.95   98.60   98.95   98.60   98.95   98.95   99.30   99.30   99.30   99.30   99.30   98.95   99.30   98.95   99.30   99.30   99.30   99.65   98.95   99.30

     4: AAG17550.1   97.89   98.25   98.60  100.00   98.60   98.60   98.60   98.25   98.60   98.60   98.95   99.30   98.95   98.95   98.60   98.60   98.60   98.60   98.60   98.95   98.60   98.95   98.60   98.60   98.60   98.95   98.95   99.30

     5: AAK69828.1   97.89   98.25   98.60   98.60  100.00   98.60   98.60   98.25   98.25   98.60   98.95   98.60   98.95   98.95   98.60   98.60   98.60   98.60   98.60   98.95   98.60   98.95   98.60   98.60   98.60   98.95   98.95   99.30

     6: AAL40899.1   97.89   98.25   98.60   98.60   98.60  100.00   98.60   98.25   98.25   98.60   98.95   98.60   98.95   98.95   98.60   98.60   98.60   98.60   98.60   98.95   98.60   98.95   98.60   98.60   98.60   98.95   98.95   99.30

     7: CAJ47126.2   98.60   98.25   98.60   98.60   98.60   98.60  100.00   98.25   98.25   98.60   98.95   98.60   98.95   98.95   98.60   98.60   98.60   99.30   98.60   98.95   98.60   98.95   98.60   98.95   98.60   98.95   98.95   99.30

     8: CAJ47131.2   97.54   98.60   98.95   98.25   98.25   98.25   98.25  100.00   98.60   98.25   98.60   98.25   98.60   98.60   98.95   98.95   98.95   98.95   98.95   98.60   98.95   98.60   98.95   98.95   98.95   99.30   98.60   98.95

     9: CAJ47137.2   97.54   98.60   98.95   98.60   98.25   98.25   98.25   98.60  100.00   98.25   98.60   98.25   98.60   98.60   98.95   98.95   98.95   98.95   98.95   98.60   98.95   98.60   98.95   98.95   98.95   99.30   98.60   98.95

    10: AEK80394.1   98.25   98.25   98.60   98.60   98.60   98.60   98.60   98.25   98.25  100.00   99.65   98.60   98.95   98.95   98.60   98.60   98.60   98.60   98.60   98.95   98.60   98.95   98.60   98.60   98.60   98.95   98.95   99.30

    11: CAJ47138.2   98.60   98.60   98.95   98.95   98.95   98.95   98.95   98.60   98.60   99.65  100.00   98.95   99.30   99.30   98.95   98.95   98.95   98.95   98.95   99.30   98.95   99.30   98.95   98.95   98.95   99.30   99.30   99.65

    12: AFC60795.1   97.89   98.25   98.60   99.30   98.60   98.60   98.60   98.25   98.25   98.60   98.95  100.00   98.95   98.95   98.60   98.60   98.60   98.60   98.60   98.95   98.60   98.95   98.60   98.60   98.60   98.95   98.95   99.30

    13: AAP03063.1   98.25   98.60   98.95   98.95   98.95   98.95   98.95   98.60   98.60   98.95   99.30   98.95  100.00   99.30   98.95   98.95   98.95   98.95   98.95   99.30   98.95   99.30   98.95   98.95   98.95   99.30   99.30   99.65

    14: AAP82228.1   98.25   98.60   98.95   98.95   98.95   98.95   98.95   98.60   98.60   98.95   99.30   98.95   99.30  100.00   98.95   98.95   98.95   98.95   98.95   99.30   98.95   99.30   98.95   98.95   98.95   99.30   99.30   99.65

    15: ABA60809.1   97.89   98.95   99.30   98.60   98.60   98.60   98.60   98.95   98.95   98.60   98.95   98.60   98.95   98.95  100.00   99.30   99.30   99.30   99.30   98.95   99.30   98.95   99.30   99.30   99.30   99.65   98.95   99.30

    16: ABC54571.1   97.89   98.95   99.30   98.60   98.60   98.60   98.60   98.95   98.95   98.60   98.95   98.60   98.95   98.95   99.30  100.00   99.30   99.30   99.30   98.95   99.30   98.95   99.30   99.30   99.30   99.65   98.95   99.30

    17: CAI30649.2   97.89   98.95   99.30   98.60   98.60   98.60   98.60   98.95   98.95   98.60   98.95   98.60   98.95   98.95   99.30   99.30  100.00   99.30   99.30   98.95   99.30   98.95   99.30   99.30   99.30   99.65   98.95   99.30

    18: CAI30651.2   97.89   98.95   99.30   98.60   98.60   98.60   99.30   98.95   98.95   98.60   98.95   98.60   98.95   98.95   99.30   99.30   99.30  100.00   99.30   98.95   99.30   98.95   99.30   99.30   99.30   99.65   98.95   99.30

    19: CAJ47129.2   97.89   98.95   99.30   98.60   98.60   98.60   98.60   98.95   98.95   98.60   98.95   98.60   98.95   98.95   99.30   99.30   99.30   99.30  100.00   98.95   99.30   98.95   99.30   99.30   99.30   99.65   98.95   99.30

    20: CAJ47130.2   98.25   98.60   98.95   98.95   98.95   98.95   98.95   98.60   98.60   98.95   99.30   98.95   99.30   99.30   98.95   98.95   98.95   98.95   98.95  100.00   98.95   99.30   98.95   98.95   98.95   99.30   99.30   99.65

    21: CAJ47132.2   97.89   98.95   99.30   98.60   98.60   98.60   98.60   98.95   98.95   98.60   98.95   98.60   98.95   98.95   99.30   99.30   99.30   99.30   99.30   98.95  100.00   98.95   99.30   99.30   99.30   99.65   98.95   99.30

    22: CAJ47133.2   98.25   98.60   98.95   98.95   98.95   98.95   98.95   98.60   98.60   98.95   99.30   98.95   99.30   99.30   98.95   98.95   98.95   98.95   98.95   99.30   98.95  100.00   98.95   98.95   98.95   99.30   99.30   99.65

    23: CAJ47134.2   97.89   98.95   99.30   98.60   98.60   98.60   98.60   98.95   98.95   98.60   98.95   98.60   98.95   98.95   99.30   99.30   99.30   99.30   99.30   98.95   99.30   98.95  100.00   99.30   99.30   99.65   98.95   99.30

    24: CAJ47135.2   98.25   98.95   99.30   98.60   98.60   98.60   98.95   98.95   98.95   98.60   98.95   98.60   98.95   98.95   99.30   99.30   99.30   99.30   99.30   98.95   99.30   98.95   99.30  100.00   99.30   99.65   98.95   99.30

    25: CAJ47136.2   97.89   98.95   99.30   98.60   98.60   98.60   98.60   98.95   98.95   98.60   98.95   98.60   98.95   98.95   99.30   99.30   99.30   99.30   99.30   98.95   99.30   98.95   99.30   99.30  100.00   99.65   98.95   99.30

    26: CAA66729.1   98.25   99.30   99.65   98.95   98.95   98.95   98.95   99.30   99.30   98.95   99.30   98.95   99.30   99.30   99.65   99.65   99.65   99.65   99.65   99.30   99.65   99.30   99.65   99.65   99.65  100.00   99.30   99.65

    27: CCK86744.1   98.25   98.60   98.95   98.95   98.95   98.95   98.95   98.60   98.60   98.95   99.30   98.95   99.30   99.30   98.95   98.95   98.95   98.95   98.95   99.30   98.95   99.30   98.95   98.95   98.95   99.30  100.00   99.65

    28: AAD37412.1   98.60   98.95   99.30   99.30   99.30   99.30   99.30   98.95   98.95   99.30   99.65   99.30   99.65   99.65   99.30   99.30   99.30   99.30   99.30   99.65   99.30   99.65   99.30   99.30   99.30   99.65   99.65  100.00

 

CLUSTAL O(1.2.4) multiple sequence alignment

 

 

CAJ47128.2      -MRIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADE

ACM04459.1      MRYIRRCIISLLATLPLAVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRADE

CAI30650.2      MRYIRRCIISLLATLPLAVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRADE

AAG17550.1      MRYFRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGSVGMIEMDLASGRTLTAWRADE

AAK69828.1      MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADE

AAL40899.1      MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADE

CAJ47126.2      MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADE

CAJ47131.2      MRYIRLCIISLLAALPLAVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRADE

CAJ47137.2      MRYVRLCIISLLATLPLAVHTSPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRADE

AEK80394.1      KRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADE

CAJ47138.2      KRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADE

AFC60795.1      MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGSVGMIEMDLASGRTLTAWRADE

AAP03063.1      MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADE

AAP82228.1      MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADE

ABA60809.1      MRYIRLCIISLLATLPLAVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRADE

ABC54571.1      MRYIRLCIISLLATMPLAVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRADE

CAI30649.2      MRYIRLCIISLLATLPLAVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRADE

CAI30651.2      MRYIRLCIISLLATLPLAVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRADE

CAJ47129.2      MRYIRLCIISLLATLPLTVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRADE

CAJ47130.2      MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADE

CAJ47132.2      MRYIRLCIISLLATLPLAVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRADE

CAJ47133.2      MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASSRTLTAWRADE

CAJ47134.2      MRYIRLCIISLLATLPLAVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRADE

CAJ47135.2      MRYIRLCIISLLATLPLAVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRADE

CAJ47136.2      MRYIRLCIISLLATLPLAVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRADE

CAA66729.1      MRYIRLCIISLLATLPLAVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRADE

CCK86744.1      MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADE

AAD37412.1      MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADE

                   .* *******::**:**:********* ******* **********.**********

 

CAJ47128.2      RFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCA

ACM04459.1      RFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCA

CAI30650.2      RFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCA

AAG17550.1      RFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCA

AAK69828.1      RFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCA

AAL40899.1      RFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHFADGMTVGELCA

CAJ47126.2      RFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKYLADGMTVGELCA

CAJ47131.2      RFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCA

CAJ47137.2      RFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCA

AEK80394.1      RFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYSQQDLVDYSPVSEKHLADGMTVGELCA

CAJ47138.2      RFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCA

AFC60795.1      RFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCA

AAP03063.1      RFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTIGELCA

AAP82228.1      RFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCA

ABA60809.1      RFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCA

ABC54571.1      RFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCA

CAI30649.2      RFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCA

CAI30651.2      RFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKYLADGMTVGELCA

CAJ47129.2      RFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCA

CAJ47130.2      RFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCA

CAJ47132.2      RFPMMSTFKVALCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCA

CAJ47133.2      RFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCA

CAJ47134.2      RFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCA

CAJ47135.2      RFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCA

CAJ47136.2      RFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCA

CAA66729.1      RFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCA

CCK86744.1      RFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCA

AAD37412.1      RFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCA

                **********.********************** *************::*****:*****

 

CAJ47128.2      AAITMSDNSAANLLLATVGGPVGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPA

ACM04459.1      AAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPA

CAI30650.2      AAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPA

AAG17550.1      AAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPA

AAK69828.1      AVITMSDNSAANLLLATVGGPAGLTAFLRQIDDNVTRLDRWETELNEALPGDARDTTTPA

AAL40899.1      AAITMSDNSAANLLLATVGGPAGLSAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPA

CAJ47126.2      AAITMSDNSAANLLLATVGGPVGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPA

CAJ47131.2      AAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPA

CAJ47137.2      AAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPA

AEK80394.1      AAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPA

CAJ47138.2      AAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPA

AFC60795.1      AAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPA

AAP03063.1      AAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPA

AAP82228.1      AAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPA

ABA60809.1      AAITVSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPA

ABC54571.1      AAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPA

CAI30649.2      AAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPA

CAI30651.2      AAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPA

CAJ47129.2      AAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPA

CAJ47130.2      AAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPA

CAJ47132.2      AAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPA

CAJ47133.2      AAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPA

CAJ47134.2      AAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEVLPGDARDTTTPA

CAJ47135.2      AAITMSDNSAANLLLATVGGPTGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPA

CAJ47136.2      AAITMSDNSAANLLLATVGSPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPA

CAA66729.1      AAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPA

CCK86744.1      AAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPA

AAD37412.1      AAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPA

                *.**:**************.*.**:******.***************.************

 

CAJ47128.2      SMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADRTGAGERGARG

ACM04459.1      SMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARG

CAI30650.2      SMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARG

AAG17550.1      SMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARG

AAK69828.1      SMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARG

AAL40899.1      SMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARG

CAJ47126.2      SMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARG

CAJ47131.2      SMAATLRKLLTSQRLSARSQRQLLQWMVEDRVAGPLIRSVLPAGWFIADKTGAGERGARG

CAJ47137.2      SMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARG

AEK80394.1      SMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARG

CAJ47138.2      SMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARG

AFC60795.1      SMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGASERGARG

AAP03063.1      SMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARG

AAP82228.1      SMAATLRKLLTSQRLSARSQLQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARG

ABA60809.1      SMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARG

ABC54571.1      SMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARG

CAI30649.2      SMTATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARG

CAI30651.2      SMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARG

CAJ47129.2      SMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARG

CAJ47130.2      SMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARG

CAJ47132.2      SMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARG

CAJ47133.2      SMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARG

CAJ47134.2      SMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARG

CAJ47135.2      SMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARG

CAJ47136.2      SMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARG

CAA66729.1      SMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARG

CCK86744.1      SMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGEQGARG

AAD37412.1      SMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARG

                **:***************** *******:********************:***.*:****

 

CAJ47128.2      IVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR

ACM04459.1      IVALLGPNNKAERIVVIYLRDMPASMAERNQQIAGIGAALIEHWQR

CAI30650.2      IVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR

AAG17550.1      IVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR

AAK69828.1      IVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR

AAL40899.1      IVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR

CAJ47126.2      IVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR

CAJ47131.2      IVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR

CAJ47137.2      IVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR

AEK80394.1      IVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR

CAJ47138.2      IVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR

AFC60795.1      IVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR

AAP03063.1      IVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR

AAP82228.1      IVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR

ABA60809.1      IVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR

ABC54571.1      IVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR

CAI30649.2      IVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR

CAI30651.2      IVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR

CAJ47129.2      IVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR

CAJ47130.2      IVALLGPHNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR

CAJ47132.2      IVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR

CAJ47133.2      IVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR

CAJ47134.2      IVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR

CAJ47135.2      IVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR

CAJ47136.2      IVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR

CAA66729.1      IVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR

CCK86744.1      IVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR

AAD37412.1      IVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR

                *******:************* ************************