#  Percent Identity  Matrix - created by Clustal2.1

#

#

 

     1: AHB36962.1  100.00   94.51   94.90   94.90   95.29

     2: CAJ47127.2   94.51  100.00   98.95   98.25   98.60

     3: ACB73258.1   94.90   98.95  100.00   99.30   98.95

     4: CAP58291.1   94.90   98.25   99.30  100.00   98.95

     5: AAS98184.1   95.29   98.60   98.95   98.95  100.00

 

CLUSTAL O(1.2.4) multiple sequence alignment

 

 

AHB36962.1      MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADE

CAJ47127.2      MRYFRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADE

ACB73258.1      MRYIRLCIISLLATLPLAVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRADE

CAP58291.1      MRYIRLCIISLLATLPLAVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRADE

AAS98184.1      MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADE

                ***:************************** *****************************

 

AHB36962.1      RFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCA

CAJ47127.2      RFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCA

ACB73258.1      RFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCA

CAP58291.1      RFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCA

AAS98184.1      RFPMISTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCA

                ****:*******************************************************

 

AHB36962.1      AAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPA

CAJ47127.2      AAITMSDNSAANLLLATVGGPVGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPA

ACB73258.1      AAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPA

CAP58291.1      AAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPA

AAS98184.1      AAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPA

                *********************.**************************************

 

AHB36962.1      SMTATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARG

CAJ47127.2      SMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADRTGAGERGARG

ACB73258.1      SMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADRTGAGERGARG

CAP58291.1      SMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKAGAGERGARG

AAS98184.1      SMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARG

                **:**********************************************::*********

 

AHB36962.1      IVACLARITKQSALW-------------------------------

CAJ47127.2      IVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR

ACB73258.1      IVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR

CAP58291.1      IVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR

AAS98184.1      IVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR

                *** *.  .* . :