#

#

#  Percent Identity  Matrix - created by Clustal2.1

#

#

 

     1: AFQ23955.1  100.00   98.60   99.30   98.95   98.25   98.25   97.90   97.05   97.87   97.90   98.25   98.25   98.25   97.90   98.25   98.25   98.25   98.25   98.25   97.90   97.55   98.60   98.60   98.60   98.60   98.25   98.25   97.90   98.60   97.79   98.60   98.25   98.25   98.15   98.25   98.25   98.60   97.79   97.90   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.52   98.25   98.60   98.25   98.25   98.25   98.25   97.55   98.25   98.25   97.55   97.55   97.55   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   97.93

     2: AJO16047.1   98.60  100.00   99.30   98.95   98.25   98.25   97.90   97.79   97.87   97.90   98.25   98.25   98.25   97.90   98.25   98.25   98.25   98.25   98.25   97.90   98.25   98.60   98.60   98.60   98.60   98.25   98.25   98.60   99.30   98.52   98.60   98.95   98.25   98.89   98.95   98.95   99.30   97.79   97.90   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.52   98.25   98.60   98.25   98.25   98.25   98.25   97.55   98.25   98.25   97.55   97.55   97.55   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.60   98.25   98.25   98.35

     3: AFQ23967.1   99.30   99.30  100.00   99.65   98.95   98.95   98.60   97.79   98.58   98.60   98.95   98.95   98.95   98.60   98.95   98.95   98.95   98.95   98.95   98.60   98.25   99.30   99.30   99.30   99.30   98.95   98.95   98.60   99.30   98.52   99.30   98.95   98.95   98.89   98.95   98.95   99.30   98.52   98.60   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.26   98.95   99.30   98.95   98.95   98.95   98.95   98.25   98.95   98.95   98.25   98.25   98.25   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.76

     4: AFQ23957.1   98.95   98.95   99.65  100.00   98.60   98.60   98.25   97.42   98.23   98.25   98.60   98.60   98.60   98.25   98.60   98.60   98.60   98.60   98.60   98.25   97.90   98.95   98.95   98.95   98.95   98.60   98.60   98.25   98.95   98.15   98.95   98.60   98.60   98.52   98.60   98.60   98.95   98.15   98.25   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.89   98.60   98.95   98.60   98.60   98.60   98.60   97.90   98.60   98.60   97.90   97.90   97.90   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.35

     5: AKK23733.1   98.25   98.25   98.95   98.60  100.00   99.30   98.95   97.42   98.23   98.25   98.60   98.60   98.60   98.25   98.60   98.60   98.60   98.60   98.60   98.25   97.90   98.25   98.25   98.60   98.60   98.60   98.60   98.25   98.25   98.15   98.95   98.60   98.60   98.52   98.60   98.60   98.95   98.15   98.25   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.89   98.60   98.95   98.60   98.60   98.60   98.60   97.90   98.60   98.60   97.90   97.90   97.90   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.35

     6: AEK48094.1   98.25   98.25   98.95   98.60   99.30  100.00   99.65   98.15   98.23   98.95   98.60   98.60   98.60   98.95   98.60   98.60   98.60   98.60   98.60   98.95   98.60   98.25   98.25   98.60   98.60   98.60   98.60   98.25   98.25   98.15   98.95   98.60   99.30   98.52   98.60   98.60   98.95   98.15   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.89   99.30   98.95   99.30   99.30   99.30   99.30   98.60   99.30   99.30   98.60   98.60   98.60   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.17

     7: ABN49110.1   97.90   97.90   98.60   98.25   98.95   99.65  100.00   97.79   97.87   98.60   98.25   98.25   98.25   98.60   98.25   98.25   98.25   98.25   98.25   98.60   98.25   97.90   97.90   98.25   98.25   98.25   98.25   97.90   97.90   97.79   98.60   98.25   98.95   98.15   98.25   98.25   98.60   97.79   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.52   98.95   98.60   98.95   98.95   98.95   98.95   98.25   98.95   98.95   98.25   98.25   98.25   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.76

     8: ACV32633.1   97.05   97.79   97.79   97.42   97.42   98.15   97.79  100.00   97.05   97.79   97.42   97.42   97.42   97.79   97.42   97.42   98.15   98.15   98.15   97.79   98.89   98.15   97.79   97.42   97.42   97.42   97.42   98.52   98.52   98.52   97.79   97.42   98.15   98.15   98.15   98.15   98.52   97.05   97.79   97.79   97.79   97.79   97.79   97.79   97.79   97.79   97.79   97.79   97.79   97.79   97.79   98.52   98.15   98.15   98.15   98.15   98.15   97.79   98.15   98.15   97.42   97.42   97.42   98.15   98.15   98.15   98.15   98.15   98.15   98.15   98.15   98.15   98.52   97.93

     9: BAM28879.1   97.87   97.87   98.58   98.23   98.23   98.23   97.87   97.05  100.00   97.87   98.23   98.23   98.23   97.87   98.23   98.23   98.23   98.23   98.23   97.87   97.52   98.23   97.87   98.23   98.23   98.23   98.23   97.87   97.87   97.79   98.58   98.94   98.94   98.15   98.23   98.23   98.58   97.79   97.87   98.58   98.58   98.58   98.58   98.58   98.58   98.58   98.58   98.58   98.58   98.58   98.52   98.58   98.94   98.23   98.23   98.23   98.23   97.52   98.23   98.23   97.52   97.52   97.52   98.23   98.23   98.23   98.23   98.23   98.23   98.23   98.23   98.23   98.23   97.93

    10: AAL68926.1   97.90   97.90   98.60   98.25   98.25   98.95   98.60   97.79   97.87  100.00   98.25   98.25   98.25   98.60   98.25   98.25   98.25   98.25   98.25   98.60   98.25   97.90   97.90   98.25   98.25   98.25   98.25   97.90   97.90   97.79   98.60   98.25   98.95   98.15   98.25   98.25   98.60   97.79   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.52   98.95   98.60   98.95   98.95   98.95   98.95   98.25   98.95   98.95   98.25   98.25   98.25   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.76

    11: AAP41944.1   98.25   98.25   98.95   98.60   98.60   98.60   98.25   97.42   98.23   98.25  100.00   98.60   98.60   98.25   98.60   98.60   98.60   98.60   98.60   98.25   97.90   98.25   98.25   98.60   98.60   98.60   98.60   98.25   98.25   98.15   98.95   98.60   98.60   98.52   98.60   98.60   98.95   98.15   98.25   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.89   98.60   98.95   98.60   98.60   98.60   98.60   97.90   98.60   98.60   97.90   97.90   97.90   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.35

    12: ABY56290.1   98.25   98.25   98.95   98.60   98.60   98.60   98.25   97.42   98.23   98.25   98.60  100.00   98.60   98.25   98.60   98.60   98.60   98.60   98.60   98.25   97.90   98.25   98.25   98.60   98.60   98.60   98.60   98.25   98.25   98.15   98.95   98.60   98.60   98.52   98.60   98.60   98.95   98.15   98.25   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.89   98.60   98.95   98.60   98.60   98.60   98.60   97.90   98.60   98.60   97.90   97.90   97.90   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.35

    13: AAV66328.1   98.25   98.25   98.95   98.60   98.60   98.60   98.25   97.42   98.23   98.25   98.60   98.60  100.00   98.25   98.60   98.95   98.60   98.60   98.60   98.25   97.90   98.25   98.25   98.60   98.60   98.60   98.60   98.25   98.25   98.15   98.95   98.60   98.60   98.52   98.60   98.60   98.95   98.15   98.25   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.89   98.60   98.95   98.60   98.60   98.60   98.60   97.90   98.60   98.60   97.90   97.90   97.90   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.76

    14: ADR66517.1   97.90   97.90   98.60   98.25   98.25   98.95   98.60   97.79   97.87   98.60   98.25   98.25   98.25  100.00   98.25   98.25   98.25   98.25   98.25   98.60   98.25   97.90   97.90   98.95   98.95   98.95   98.95   97.90   97.90   98.15   98.60   98.25   98.95   98.15   98.25   98.25   98.60   97.79   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.52   98.95   98.60   98.95   98.95   98.95   98.95   98.25   98.95   98.95   98.25   98.25   98.25   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.76

    15: AEI83430.1   98.25   98.25   98.95   98.60   98.60   98.60   98.25   97.42   98.23   98.25   98.60   98.60   98.60   98.25  100.00   98.60   98.60   98.60   98.60   98.25   97.90   98.25   98.25   98.60   98.60   98.60   98.60   98.25   98.25   98.15   98.95   98.60   98.60   98.52   98.60   98.60   98.95   98.15   98.25   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.89   98.60   98.95   98.60   98.60   98.60   98.60   97.90   98.60   98.60   97.90   97.90   97.90   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.35

    16: AFQ23953.1   98.25   98.25   98.95   98.60   98.60   98.60   98.25   97.42   98.23   98.25   98.60   98.60   98.95   98.25   98.60  100.00   98.60   98.60   98.60   98.25   97.90   98.25   98.25   98.60   98.60   98.60   98.60   98.25   98.25   98.15   98.95   98.60   98.60   98.52   98.60   98.60   98.95   98.15   98.25   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.89   98.60   98.95   98.60   98.60   98.60   98.60   97.90   98.60   98.60   97.90   97.90   97.90   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.76

    17: AFQ23959.1   98.25   98.25   98.95   98.60   98.60   98.60   98.25   98.15   98.23   98.25   98.60   98.60   98.60   98.25   98.60   98.60  100.00   99.30   99.30   98.25   98.60   98.95   98.95   98.60   98.60   98.60   98.60   98.95   98.95   98.89   98.95   98.60   98.60   98.52   98.60   98.60   98.95   98.15   98.25   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.89   98.60   98.95   98.60   98.60   98.60   98.60   97.90   98.60   98.60   97.90   97.90   97.90   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.76

    18: AFQ23958.1   98.25   98.25   98.95   98.60   98.60   98.60   98.25   98.15   98.23   98.25   98.60   98.60   98.60   98.25   98.60   98.60   99.30  100.00   99.30   98.25   98.60   98.95   98.95   98.60   98.60   98.60   98.60   98.95   98.95   98.89   98.95   98.60   98.60   98.52   98.60   98.60   98.95   98.15   98.25   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.89   98.60   98.95   98.60   98.60   98.60   98.60   97.90   98.60   98.60   97.90   97.90   97.90   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.35

    19: CAP58290.1   98.25   98.25   98.95   98.60   98.60   98.60   98.25   98.15   98.23   98.25   98.60   98.60   98.60   98.25   98.60   98.60   99.30   99.30  100.00   98.25   98.60   98.95   98.95   98.60   98.60   98.60   98.60   98.95   98.95   98.89   98.95   98.60   98.60   98.52   98.60   98.60   98.95   98.89   98.60   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.89   98.60   98.95   98.60   98.60   98.60   98.60   97.90   98.60   98.60   97.90   97.90   97.90   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.76

    20: AFQ23962.1   97.90   97.90   98.60   98.25   98.25   98.95   98.60   97.79   97.87   98.60   98.25   98.25   98.25   98.60   98.25   98.25   98.25   98.25   98.25  100.00   98.25   97.90   97.90   98.25   98.25   98.25   98.25   97.90   97.90   97.79   98.60   98.25   98.95   98.15   98.25   98.25   98.60   97.79   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.52   98.95   98.60   98.95   98.95   98.95   98.95   98.25   98.95   98.95   98.25   98.25   98.25   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.76

    21: AFQ23966.1   97.55   98.25   98.25   97.90   97.90   98.60   98.25   98.89   97.52   98.25   97.90   97.90   97.90   98.25   97.90   97.90   98.60   98.60   98.60   98.25  100.00   98.25   98.25   97.90   97.90   97.90   97.90   98.95   98.95   98.89   98.25   97.90   98.60   98.52   98.60   98.60   98.95   97.42   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.15   98.60   98.25   98.60   98.60   98.60   98.60   97.90   98.60   98.60   97.90   97.90   97.90   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.35

    22: AFQ23969.1   98.60   98.60   99.30   98.95   98.25   98.25   97.90   98.15   98.23   97.90   98.25   98.25   98.25   97.90   98.25   98.25   98.95   98.95   98.95   97.90   98.25  100.00   99.30   98.60   98.60   98.25   98.25   98.60   99.30   98.89   98.60   98.25   98.25   98.52   98.25   98.25   98.60   98.15   97.90   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.89   98.95   99.30   98.25   98.25   98.25   98.25   97.55   98.25   98.25   97.55   97.55   97.55   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.35

    23: AFQ23968.1   98.60   98.60   99.30   98.95   98.25   98.25   97.90   97.79   97.87   97.90   98.25   98.25   98.25   97.90   98.25   98.25   98.95   98.95   98.95   97.90   98.25   99.30  100.00   98.60   98.60   98.25   98.25   98.60   99.30   98.52   98.60   98.25   98.25   98.15   98.25   98.25   98.60   97.79   97.90   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.52   98.25   98.60   98.25   98.25   98.25   98.25   97.55   98.25   98.25   97.55   97.55   97.55   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   97.93

    24: AJO16041.1   98.60   98.60   99.30   98.95   98.60   98.60   98.25   97.42   98.23   98.25   98.60   98.60   98.60   98.95   98.60   98.60   98.60   98.60   98.60   98.25   97.90   98.60   98.60  100.00  100.00   99.30   99.30   98.25   98.60   98.15   98.95   98.60   98.60   98.52   98.60   98.60   98.95   98.15   98.25   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.89   98.60   98.95   98.60   98.60   98.60   98.60   97.90   98.60   98.60   97.90   97.90   97.90   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.35

    25: AJO16040.1   98.60   98.60   99.30   98.95   98.60   98.60   98.25   97.42   98.23   98.25   98.60   98.60   98.60   98.95   98.60   98.60   98.60   98.60   98.60   98.25   97.90   98.60   98.60  100.00  100.00   99.30   99.30   98.25   98.60   98.15   98.95   98.60   98.60   98.52   98.60   98.60   98.95   98.15   98.25   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.89   98.60   98.95   98.60   98.60   98.60   98.60   97.90   98.60   98.60   97.90   97.90   97.90   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.35

    26: AIS67769.1   98.25   98.25   98.95   98.60   98.60   98.60   98.25   97.42   98.23   98.25   98.60   98.60   98.60   98.95   98.60   98.60   98.60   98.60   98.60   98.25   97.90   98.25   98.25   99.30   99.30  100.00   99.30   98.25   98.25   98.15   98.95   98.60   98.60   98.52   98.60   98.60   98.95   98.15   98.25   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.89   98.60   98.95   98.60   98.60   98.60   98.60   97.90   98.60   98.60   97.90   97.90   97.90   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.35

    27: AAP41108.1   98.25   98.25   98.95   98.60   98.60   98.60   98.25   97.42   98.23   98.25   98.60   98.60   98.60   98.95   98.60   98.60   98.60   98.60   98.60   98.25   97.90   98.25   98.25   99.30   99.30   99.30  100.00   98.25   98.25   98.15   98.95   98.60   98.60   98.52   98.60   98.60   98.95   98.15   98.25   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.89   98.60   98.95   98.60   98.60   98.60   98.60   97.90   98.60   98.60   97.90   97.90   97.90   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.35

    28: AFQ23970.1   97.90   98.60   98.60   98.25   98.25   98.25   97.90   98.52   97.87   97.90   98.25   98.25   98.25   97.90   98.25   98.25   98.95   98.95   98.95   97.90   98.95   98.60   98.60   98.25   98.25   98.25   98.25  100.00   99.30   99.26   98.60   98.25   98.25   98.89   98.95   98.95   99.30   97.79   97.90   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.52   98.25   98.60   98.25   98.25   98.25   98.25   97.90   98.25   98.25   97.90   97.90   97.90   98.60   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   97.93

    29: AFQ23960.1   98.60   99.30   99.30   98.95   98.25   98.25   97.90   98.52   97.87   97.90   98.25   98.25   98.25   97.90   98.25   98.25   98.95   98.95   98.95   97.90   98.95   99.30   99.30   98.60   98.60   98.25   98.25   99.30  100.00   99.26   98.60   98.25   98.25   98.89   98.95   98.95   99.30   97.79   97.90   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.52   98.25   98.60   98.25   98.25   98.25   98.25   97.55   98.25   98.25   97.55   97.55   97.55   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   97.93

    30: ACV32634.1   97.79   98.52   98.52   98.15   98.15   98.15   97.79   98.52   97.79   97.79   98.15   98.15   98.15   98.15   98.15   98.15   98.89   98.89   98.89   97.79   98.89   98.89   98.52   98.15   98.15   98.15   98.15   99.26   99.26  100.00   98.52   98.15   98.15   98.89   98.89   98.89   99.26   97.79   97.79   98.52   98.52   98.52   98.52   98.52   98.52   98.52   98.52   98.52   98.52   98.52   98.52   98.52   98.89   98.15   98.15   98.15   98.15   97.79   98.15   98.15   97.42   97.42   97.42   98.15   98.15   98.15   98.15   98.15   98.15   98.15   98.15   98.15   98.52   97.93

    31: CEA29751.1   98.60   98.60   99.30   98.95   98.95   98.95   98.60   97.79   98.58   98.60   98.95   98.95   98.95   98.60   98.95   98.95   98.95   98.95   98.95   98.60   98.25   98.60   98.60   98.95   98.95   98.95   98.95   98.60   98.60   98.52  100.00   98.95   98.95   98.89   98.95   98.95   99.30   98.52   98.60   99.30   99.30   99.30   99.30   99.30   99.30  100.00   99.30   99.30   99.30   99.30   99.26   98.95   99.30   98.95   98.95   98.95   98.95   98.25   98.95   98.95   98.25   98.25   98.25   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   99.17

    32: AFW16978.1   98.25   98.95   98.95   98.60   98.60   98.60   98.25   97.42   98.94   98.25   98.60   98.60   98.60   98.25   98.60   98.60   98.60   98.60   98.60   98.25   97.90   98.25   98.25   98.60   98.60   98.60   98.60   98.25   98.25   98.15   98.95  100.00   99.30   98.52   98.60   98.60   98.95   98.15   98.25   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.89   98.60   98.95   98.60   98.60   98.60   98.60   97.90   98.60   98.60   97.90   97.90   97.90   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.95   98.60   98.60   98.76

    33: AFK93491.1   98.25   98.25   98.95   98.60   98.60   99.30   98.95   98.15   98.94   98.95   98.60   98.60   98.60   98.95   98.60   98.60   98.60   98.60   98.60   98.95   98.60   98.25   98.25   98.60   98.60   98.60   98.60   98.25   98.25   98.15   98.95   99.30  100.00   98.52   98.60   98.60   98.95   98.15   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.89   99.30   98.95   99.30   99.30   99.30   99.30   98.60   99.30   99.30   98.60   98.60   98.60   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.17

    34: ACV32636.1   98.15   98.89   98.89   98.52   98.52   98.52   98.15   98.15   98.15   98.15   98.52   98.52   98.52   98.15   98.52   98.52   98.52   98.52   98.52   98.15   98.52   98.52   98.15   98.52   98.52   98.52   98.52   98.89   98.89   98.89   98.89   98.52   98.52  100.00   99.26   99.26   99.63   98.52   98.15   98.89   98.89   98.89   98.89   98.89   98.89   98.89   98.89   98.89   98.89   98.89   98.89   98.89   99.26   98.52   98.52   98.52   98.52   98.15   98.52   98.52   97.79   97.79   97.79   98.52   98.52   98.52   98.52   98.52   98.52   98.52   98.52   98.52   98.89   98.76

    35: ABN49114.1   98.25   98.95   98.95   98.60   98.60   98.60   98.25   98.15   98.23   98.25   98.60   98.60   98.60   98.25   98.60   98.60   98.60   98.60   98.60   98.25   98.60   98.25   98.25   98.60   98.60   98.60   98.60   98.95   98.95   98.89   98.95   98.60   98.60   99.26  100.00   99.30   99.65   98.15   98.25   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.89   98.60   98.95   98.60   98.60   98.60   98.60   97.90   98.60   98.60   97.90   97.90   97.90   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.76

    36: AKK23731.1   98.25   98.95   98.95   98.60   98.60   98.60   98.25   98.15   98.23   98.25   98.60   98.60   98.60   98.25   98.60   98.60   98.60   98.60   98.60   98.25   98.60   98.25   98.25   98.60   98.60   98.60   98.60   98.95   98.95   98.89   98.95   98.60   98.60   99.26   99.30  100.00   99.65   98.15   98.25   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.89   98.60   98.95   98.60   98.60   98.60   98.60   97.90   98.60   98.60   97.90   97.90   97.90   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.76

    37: AEG79634.1   98.60   99.30   99.30   98.95   98.95   98.95   98.60   98.52   98.58   98.60   98.95   98.95   98.95   98.60   98.95   98.95   98.95   98.95   98.95   98.60   98.95   98.60   98.60   98.95   98.95   98.95   98.95   99.30   99.30   99.26   99.30   98.95   98.95   99.63   99.65   99.65  100.00   98.52   98.60   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.26   98.95   99.30   98.95   98.95   98.95   98.95   98.25   98.95   98.95   98.25   98.25   98.25   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.76

    38: ACV32637.1   97.79   97.79   98.52   98.15   98.15   98.15   97.79   97.05   97.79   97.79   98.15   98.15   98.15   97.79   98.15   98.15   98.15   98.15   98.89   97.79   97.42   98.15   97.79   98.15   98.15   98.15   98.15   97.79   97.79   97.79   98.52   98.15   98.15   98.52   98.15   98.15   98.52  100.00   98.15   98.52   98.52   98.52   98.52   98.52   98.52   98.52   98.52   98.52   98.89   98.52   98.52   98.52   98.89   98.15   98.15   98.15   98.15   97.79   98.15   98.15   97.42   97.42   97.42   98.15   98.15   98.15   98.15   98.15   98.15   98.15   98.15   98.15   98.52   99.17

    39: AIG51284.1   97.90   97.90   98.60   98.25   98.25   98.95   98.60   97.79   97.87   98.60   98.25   98.25   98.25   98.60   98.25   98.25   98.25   98.25   98.60   98.60   98.25   97.90   97.90   98.25   98.25   98.25   98.25   97.90   97.90   97.79   98.60   98.25   98.95   98.15   98.25   98.25   98.60   98.15  100.00   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.52   98.95   98.60   98.95   98.95   98.95   98.95   98.25   98.95   98.95   98.25   98.25   98.25   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   99.17

    40: AIS67768.1   98.60   98.60   99.30   98.95   98.95   98.95   98.60   97.79   98.58   98.60   98.95   98.95   98.95   98.60   98.95   98.95   98.95   98.95   98.95   98.60   98.25   98.60   98.60   98.95   98.95   98.95   98.95   98.60   98.60   98.52   99.30   98.95   98.95   98.89   98.95   98.95   99.30   98.52   98.60  100.00   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.26   98.95   99.30   98.95   98.95   98.95   98.95   98.25   98.95   98.95   98.25   98.25   98.25   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   99.17

    41: AHA80962.1   98.60   98.60   99.30   98.95   98.95   98.95   98.60   97.79   98.58   98.60   98.95   98.95   98.95   98.60   98.95   98.95   98.95   98.95   98.95   98.60   98.25   98.60   98.60   98.95   98.95   98.95   98.95   98.60   98.60   98.52   99.30   98.95   98.95   98.89   98.95   98.95   99.30   98.52   98.60   99.30  100.00   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.26   98.95   99.30   98.95   98.95   98.95   98.95   98.25   98.95   98.95   98.25   98.25   98.25   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.76

    42: AFQ32277.1   98.60   98.60   99.30   98.95   98.95   98.95   98.60   97.79   98.58   98.60   98.95   98.95   98.95   98.60   98.95   98.95   98.95   98.95   98.95   98.60   98.25   98.60   98.60   98.95   98.95   98.95   98.95   98.60   98.60   98.52   99.30   98.95   98.95   98.89   98.95   98.95   99.30   98.52   98.60   99.30   99.30  100.00   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.26   98.95   99.30   98.95   98.95   98.95   98.95   98.25   98.95   98.95   98.25   98.25   98.25   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.76

    43: AFQ23956.1   98.60   98.60   99.30   98.95   98.95   98.95   98.60   97.79   98.58   98.60   98.95   98.95   98.95   98.60   98.95   98.95   98.95   98.95   98.95   98.60   98.25   98.60   98.60   98.95   98.95   98.95   98.95   98.60   98.60   98.52   99.30   98.95   98.95   98.89   98.95   98.95   99.30   98.52   98.60   99.30   99.30   99.30  100.00   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.26   98.95   99.30   98.95   98.95   98.95   98.95   98.25   98.95   98.95   98.25   98.25   98.25   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.76

    44: AFN88952.1   98.60   98.60   99.30   98.95   98.95   98.95   98.60   97.79   98.58   98.60   98.95   98.95   98.95   98.60   98.95   98.95   98.95   98.95   98.95   98.60   98.25   98.60   98.60   98.95   98.95   98.95   98.95   98.60   98.60   98.52   99.30   98.95   98.95   98.89   98.95   98.95   99.30   98.52   98.60   99.30   99.30   99.30   99.30  100.00   99.30   99.30   99.30   99.30   99.30   99.30   99.26   98.95   99.30   98.95   98.95   98.95   98.95   98.25   98.95   98.95   98.25   98.25   98.25   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.76

    45: ABN49113.1   98.60   98.60   99.30   98.95   98.95   98.95   98.60   97.79   98.58   98.60   98.95   98.95   98.95   98.60   98.95   98.95   98.95   98.95   98.95   98.60   98.25   98.60   98.60   98.95   98.95   98.95   98.95   98.60   98.60   98.52   99.30   98.95   98.95   98.89   98.95   98.95   99.30   98.52   98.60   99.30   99.30   99.30   99.30   99.30  100.00   99.30   99.30   99.30   99.30   99.30   99.26   98.95   99.30   98.95   98.95   98.95   98.95   98.25   98.95   98.95   98.25   98.25   98.25   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.76

    46: CEA29750.1   98.60   98.60   99.30   98.95   98.95   98.95   98.60   97.79   98.58   98.60   98.95   98.95   98.95   98.60   98.95   98.95   98.95   98.95   98.95   98.60   98.25   98.60   98.60   98.95   98.95   98.95   98.95   98.60   98.60   98.52  100.00   98.95   98.95   98.89   98.95   98.95   99.30   98.52   98.60   99.30   99.30   99.30   99.30   99.30   99.30  100.00   99.30   99.30   99.30   99.30   99.26   98.95   99.30   98.95   98.95   98.95   98.95   98.25   98.95   98.95   98.25   98.25   98.25   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   99.17

    47: BAI94487.1   98.60   98.60   99.30   98.95   98.95   98.95   98.60   97.79   98.58   98.60   98.95   98.95   98.95   98.60   98.95   98.95   98.95   98.95   98.95   98.60   98.25   98.60   98.60   98.95   98.95   98.95   98.95   98.60   98.60   98.52   99.30   98.95   98.95   98.89   98.95   98.95   99.30   98.52   98.60   99.30   99.30   99.30   99.30   99.30   99.30   99.30  100.00   99.30   99.30   99.30   99.26   98.95   99.30   98.95   98.95   98.95   98.95   98.25   98.95   98.95   98.25   98.25   98.25   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.76

    48: ABV72593.1   98.60   98.60   99.30   98.95   98.95   98.95   98.60   97.79   98.58   98.60   98.95   98.95   98.95   98.60   98.95   98.95   98.95   98.95   98.95   98.60   98.25   98.60   98.60   98.95   98.95   98.95   98.95   98.60   98.60   98.52   99.30   98.95   98.95   98.89   98.95   98.95   99.30   98.52   98.60   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30  100.00   99.30   99.30   99.26   98.95   99.30   98.95   98.95   98.95   98.95   98.25   98.95   99.30   98.25   98.25   98.25   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.76

    49: ABS72351.1   98.60   98.60   99.30   98.95   98.95   98.95   98.60   97.79   98.58   98.60   98.95   98.95   98.95   98.60   98.95   98.95   98.95   98.95   98.95   98.60   98.25   98.60   98.60   98.95   98.95   98.95   98.95   98.60   98.60   98.52   99.30   98.95   98.95   98.89   98.95   98.95   99.30   98.89   98.60   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30  100.00   99.30   99.26   98.95   99.30   98.95   98.95   98.95   98.95   98.25   98.95   98.95   98.25   98.25   98.25   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   99.17

    50: ABA06587.1   98.60   98.60   99.30   98.95   98.95   98.95   98.60   97.79   98.58   98.60   98.95   98.95   98.95   98.60   98.95   98.95   98.95   98.95   98.95   98.60   98.25   98.60   98.60   98.95   98.95   98.95   98.95   98.60   98.60   98.52   99.30   98.95   98.95   98.89   98.95   98.95   99.30   98.52   98.60   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30  100.00   99.26   98.95   99.30   98.95   98.95   98.95   98.95   98.25   98.95   98.95   98.25   98.25   98.25   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.76

    51: ACV32635.1   98.52   98.52   99.26   98.89   98.89   98.89   98.52   97.79   98.52   98.52   98.89   98.89   98.89   98.52   98.89   98.89   98.89   98.89   98.89   98.52   98.15   98.89   98.52   98.89   98.89   98.89   98.89   98.52   98.52   98.52   99.26   98.89   98.89   98.89   98.89   98.89   99.26   98.52   98.52   99.26   99.26   99.26   99.26   99.26   99.26   99.26   99.26   99.26   99.26   99.26  100.00   99.26   99.63   98.89   98.89   98.89   98.89   98.52   98.89   98.89   98.15   98.15   98.15   98.89   98.89   98.89   98.89   98.89   98.89   98.89   98.89   98.89   99.26   99.17

    52: AFQ23961.1   98.25   98.25   98.95   98.60   98.60   99.30   98.95   98.52   98.58   98.95   98.60   98.60   98.60   98.95   98.60   98.60   98.60   98.60   98.60   98.95   98.60   98.95   98.25   98.60   98.60   98.60   98.60   98.25   98.25   98.52   98.95   98.60   99.30   98.89   98.60   98.60   98.95   98.52   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   99.26  100.00   99.65   99.30   99.30   99.30   99.30   98.60   99.30   99.30   98.60   98.60   98.60   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.59

    53: AFQ23954.1   98.60   98.60   99.30   98.95   98.95   98.95   98.60   98.15   98.94   98.60   98.95   98.95   98.95   98.60   98.95   98.95   98.95   98.95   98.95   98.60   98.25   99.30   98.60   98.95   98.95   98.95   98.95   98.60   98.60   98.89   99.30   98.95   98.95   99.26   98.95   98.95   99.30   98.89   98.60   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.63   99.65  100.00   98.95   98.95   98.95   98.95   98.25   98.95   98.95   98.25   98.25   98.25   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   99.17

    54: ABA06589.1   98.25   98.25   98.95   98.60   98.60   99.30   98.95   98.15   98.23   98.95   98.60   98.60   98.60   98.95   98.60   98.60   98.60   98.60   98.60   98.95   98.60   98.25   98.25   98.60   98.60   98.60   98.60   98.25   98.25   98.15   98.95   98.60   99.30   98.52   98.60   98.60   98.95   98.15   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.89   99.30   98.95  100.00   99.30   99.30   99.30   98.60   99.30   99.30   98.60   98.60   98.60   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.17

    55: ABA06590.1   98.25   98.25   98.95   98.60   98.60   99.30   98.95   98.15   98.23   98.95   98.60   98.60   98.60   98.95   98.60   98.60   98.60   98.60   98.60   98.95   98.60   98.25   98.25   98.60   98.60   98.60   98.60   98.25   98.25   98.15   98.95   98.60   99.30   98.52   98.60   98.60   98.95   98.15   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.89   99.30   98.95   99.30  100.00   99.30   99.30   98.60   99.30   99.30   98.60   98.60   98.60   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.17

    56: CAP58292.1   98.25   98.25   98.95   98.60   98.60   99.30   98.95   98.15   98.23   98.95   98.60   98.60   98.60   98.95   98.60   98.60   98.60   98.60   98.60   98.95   98.60   98.25   98.25   98.60   98.60   98.60   98.60   98.25   98.25   98.15   98.95   98.60   99.30   98.52   98.60   98.60   98.95   98.15   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.89   99.30   98.95   99.30   99.30  100.00   99.30   98.60   99.30   99.30   98.60   98.60   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.17

    57: AHA80963.1   98.25   98.25   98.95   98.60   98.60   99.30   98.95   98.15   98.23   98.95   98.60   98.60   98.60   98.95   98.60   98.60   98.60   98.60   98.60   98.95   98.60   98.25   98.25   98.60   98.60   98.60   98.60   98.25   98.25   98.15   98.95   98.60   99.30   98.52   98.60   98.60   98.95   98.15   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.89   99.30   98.95   99.30   99.30   99.30  100.00   98.60   99.30   99.30   98.60   98.60   98.60   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.17

    58: AAL82593.1   97.55   97.55   98.25   97.90   97.90   98.60   98.25   97.79   97.52   98.25   97.90   97.90   97.90   98.25   97.90   97.90   97.90   97.90   97.90   98.25   97.90   97.55   97.55   97.90   97.90   97.90   97.90   97.90   97.55   97.79   98.25   97.90   98.60   98.15   97.90   97.90   98.25   97.79   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.52   98.60   98.25   98.60   98.60   98.60   98.60  100.00   98.60   98.60   99.30   99.30   98.60   99.30   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.76

    59: ABN49111.1   98.25   98.25   98.95   98.60   98.60   99.30   98.95   98.15   98.23   98.95   98.60   98.60   98.60   98.95   98.60   98.60   98.60   98.60   98.60   98.95   98.60   98.25   98.25   98.60   98.60   98.60   98.60   98.25   98.25   98.15   98.95   98.60   99.30   98.52   98.60   98.60   98.95   98.15   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.89   99.30   98.95   99.30   99.30   99.30   99.30   98.60  100.00   99.30   98.60   98.60   98.60   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.17

    60: ABN49112.1   98.25   98.25   98.95   98.60   98.60   99.30   98.95   98.15   98.23   98.95   98.60   98.60   98.60   98.95   98.60   98.60   98.60   98.60   98.60   98.95   98.60   98.25   98.25   98.60   98.60   98.60   98.60   98.25   98.25   98.15   98.95   98.60   99.30   98.52   98.60   98.60   98.95   98.15   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   99.30   98.95   98.95   98.89   99.30   98.95   99.30   99.30   99.30   99.30   98.60   99.30  100.00   98.60   98.60   98.60   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.17

    61: AEI83429.1   97.55   97.55   98.25   97.90   97.90   98.60   98.25   97.42   97.52   98.25   97.90   97.90   97.90   98.25   97.90   97.90   97.90   97.90   97.90   98.25   97.90   97.55   97.55   97.90   97.90   97.90   97.90   97.90   97.55   97.42   98.25   97.90   98.60   97.79   97.90   97.90   98.25   97.42   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.15   98.60   98.25   98.60   98.60   98.60   98.60   99.30   98.60   98.60  100.00  100.00   98.60   99.30   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.35

    62: ACV53157.1   97.55   97.55   98.25   97.90   97.90   98.60   98.25   97.42   97.52   98.25   97.90   97.90   97.90   98.25   97.90   97.90   97.90   97.90   97.90   98.25   97.90   97.55   97.55   97.90   97.90   97.90   97.90   97.90   97.55   97.42   98.25   97.90   98.60   97.79   97.90   97.90   98.25   97.42   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.15   98.60   98.25   98.60   98.60   98.60   98.60   99.30   98.60   98.60  100.00  100.00   98.60   99.30   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.35

    63: AEJ08681.1   97.55   97.55   98.25   97.90   97.90   98.60   98.25   97.42   97.52   98.25   97.90   97.90   97.90   98.25   97.90   97.90   97.90   97.90   97.90   98.25   97.90   97.55   97.55   97.90   97.90   97.90   97.90   97.90   97.55   97.42   98.25   97.90   98.60   97.79   97.90   97.90   98.25   97.42   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.15   98.60   98.25   98.60   98.60   99.30   98.60   98.60   98.60   98.60   98.60   98.60  100.00   99.30   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.35

    64: AEX99752.1   98.25   98.25   98.95   98.60   98.60   99.30   98.95   98.15   98.23   98.95   98.60   98.60   98.60   98.95   98.60   98.60   98.60   98.60   98.60   98.95   98.60   98.25   98.25   98.60   98.60   98.60   98.60   98.60   98.25   98.15   98.95   98.60   99.30   98.52   98.60   98.60   98.95   98.15   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.89   99.30   98.95   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30  100.00   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.17

    65: AFQ23963.1   98.25   98.25   98.95   98.60   98.60   99.30   98.95   98.15   98.23   98.95   98.60   98.60   98.60   98.95   98.60   98.60   98.60   98.60   98.60   98.95   98.60   98.25   98.25   98.60   98.60   98.60   98.60   98.25   98.25   98.15   98.95   98.60   99.30   98.52   98.60   98.60   98.95   98.15   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.89   99.30   98.95   99.30   99.30   99.30   99.30   98.60   99.30   99.30   98.60   98.60   98.60   99.30  100.00   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.17

    66: AFQ23964.1   98.25   98.25   98.95   98.60   98.60   99.30   98.95   98.15   98.23   98.95   98.60   98.60   98.60   98.95   98.60   98.60   98.60   98.60   98.60   98.95   98.60   98.25   98.25   98.60   98.60   98.60   98.60   98.25   98.25   98.15   98.95   98.60   99.30   98.52   98.60   98.60   98.95   98.15   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.89   99.30   98.95   99.30   99.30   99.30   99.30   98.60   99.30   99.30   98.60   98.60   98.60   99.30   99.30  100.00   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.17

    67: AFQ23965.1   98.25   98.25   98.95   98.60   98.60   99.30   98.95   98.15   98.23   98.95   98.60   98.60   98.60   98.95   98.60   98.60   98.60   98.60   98.60   98.95   98.60   98.25   98.25   98.60   98.60   98.60   98.60   98.25   98.25   98.15   98.95   98.60   99.30   98.52   98.60   98.60   98.95   98.15   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.89   99.30   98.95   99.30   99.30   99.30   99.30   98.60   99.30   99.30   98.60   98.60   98.60   99.30   99.30   99.30  100.00   99.30   99.30   99.30   99.30   99.30   99.30   99.17

    68: AHA80959.1   98.25   98.25   98.95   98.60   98.60   99.30   98.95   98.15   98.23   98.95   98.60   98.60   98.60   98.95   98.60   98.60   98.60   98.60   98.60   98.95   98.60   98.25   98.25   98.60   98.60   98.60   98.60   98.25   98.25   98.15   98.95   98.60   99.30   98.52   98.60   98.60   98.95   98.15   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.89   99.30   98.95   99.30   99.30   99.30   99.30   98.60   99.30   99.30   98.60   98.60   98.60   99.30   99.30   99.30   99.30  100.00   99.30   99.30   99.30   99.30   99.30   99.17

    69: AJO16042.1   98.25   98.25   98.95   98.60   98.60   99.30   98.95   98.15   98.23   98.95   98.60   98.60   98.60   98.95   98.60   98.60   98.60   98.60   98.60   98.95   98.60   98.25   98.25   98.60   98.60   98.60   98.60   98.25   98.25   98.15   98.95   98.60   99.30   98.52   98.60   98.60   98.95   98.15   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.89   99.30   98.95   99.30   99.30   99.30   99.30   98.60   99.30   99.30   98.60   98.60   98.60   99.30   99.30   99.30   99.30   99.30  100.00   99.30   99.30   99.30   99.30   99.17

    70: ALI16958.1   98.25   98.25   98.95   98.60   98.60   99.30   98.95   98.15   98.23   98.95   98.60   98.60   98.60   98.95   98.60   98.60   98.60   98.60   98.60   98.95   98.60   98.25   98.25   98.60   98.60   98.60   98.60   98.25   98.25   98.15   98.95   98.60   99.30   98.52   98.60   98.60   98.95   98.15   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.89   99.30   98.95   99.30   99.30   99.30   99.30   98.60   99.30   99.30   98.60   98.60   98.60   99.30   99.30   99.30   99.30   99.30   99.30  100.00   99.30   99.30   99.30   99.17

    71: AAL82592.1   98.25   98.60   98.95   98.60   98.60   99.30   98.95   98.15   98.23   98.95   98.60   98.60   98.60   98.95   98.60   98.60   98.60   98.60   98.60   98.95   98.60   98.25   98.25   98.60   98.60   98.60   98.60   98.25   98.25   98.15   98.95   98.95   99.30   98.52   98.60   98.60   98.95   98.15   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.89   99.30   98.95   99.30   99.30   99.30   99.30   98.60   99.30   99.30   98.60   98.60   98.60   99.30   99.30   99.30   99.30   99.30   99.30   99.30  100.00   99.30   99.30   99.59

    72: AHA80958.1   98.25   98.25   98.95   98.60   98.60   99.30   98.95   98.15   98.23   98.95   98.60   98.60   98.60   98.95   98.60   98.60   98.60   98.60   98.60   98.95   98.60   98.25   98.25   98.60   98.60   98.60   98.60   98.25   98.25   98.15   98.95   98.60   99.30   98.52   98.60   98.60   98.95   98.15   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.89   99.30   98.95   99.30   99.30   99.30   99.30   98.60   99.30   99.30   98.60   98.60   98.60   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30  100.00   99.30   99.59

    73: AKK23732.1   98.25   98.25   98.95   98.60   98.60   99.30   98.95   98.52   98.23   98.95   98.60   98.60   98.60   98.95   98.60   98.60   98.60   98.60   98.60   98.95   98.60   98.25   98.25   98.60   98.60   98.60   98.60   98.25   98.25   98.52   98.95   98.60   99.30   98.89   98.60   98.60   98.95   98.52   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   99.26   99.30   98.95   99.30   99.30   99.30   99.30   98.60   99.30   99.30   98.60   98.60   98.60   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30  100.00   99.59

    74: AAT01223.1   97.93   98.35   98.76   98.35   98.35   99.17   98.76   97.93   97.93   98.76   98.35   98.35   98.76   98.76   98.35   98.76   98.76   98.35   98.76   98.76   98.35   98.35   97.93   98.35   98.35   98.35   98.35   97.93   97.93   97.93   99.17   98.76   99.17   98.76   98.76   98.76   98.76   99.17   99.17   99.17   98.76   98.76   98.76   98.76   98.76   99.17   98.76   98.76   99.17   98.76   99.17   99.59   99.17   99.17   99.17   99.17   99.17   98.76   99.17   99.17   98.35   98.35   98.35   99.17   99.17   99.17   99.17   99.17   99.17   99.17   99.59   99.59   99.59  100.00

 

CLUSTAL O(1.2.4) multiple sequence alignment

 

 

AFQ23955.1      --MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESRLSGSVGMIEMDLASGRTLTAWRA

AJO16047.1      --MRYFRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGSVGMIEMDLASGRTLTAWRA

AFQ23967.1      --MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGSVGMIEMDLASGRTLTAWRA

AFQ23957.1      --MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQPSGSVGMIEMDLASGRTLTAWRA

AKK23733.1      --MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLVSGRTLTAWRA

AEK48094.1      --MRYIRLCIISLLATLPLAVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRA

ABN49110.1      --MRYIRLCIISLLATLPLAVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRA

ACV32633.1      --MRYIRLCIISLLATLPLAVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRA

BAM28879.1      --MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRA

AAL68926.1      --MRYIRLCIISLLATLPLAVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRA

AAP41944.1      --MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRA

ABY56290.1      --MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRA

AAV66328.1      --MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRA

ADR66517.1      --MRYIRLCIISLLATLPLAVHASPQPLKQIKQSESQLSGRVGMIEMDLASGRTLTAWRA

AEI83430.1      --MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRA

AFQ23953.1      --MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRA

AFQ23959.1      --MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRA

AFQ23958.1      --MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTARRA

CAP58290.1      --MRFIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRA

AFQ23962.1      --MRYIRLCIISLLATLPLAVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRA

AFQ23966.1      --MRYIRLCIISLLATLPLAVHASPQPLEQIKQSEGQLSGRVGMIEMDLASGRTLTAWRA

AFQ23969.1      --MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGSVGMIEMDLASGRTLTAWRA

AFQ23968.1      --MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGSVGMVEMDLASGRTLTAWRA

AJO16041.1      --MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGHVGMIEMDLASGRTLTAWRA

AJO16040.1      --MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGHVGMIEMDLASGRTLTAWRA

AIS67769.1      --MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRA

AAP41108.1      --MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRA

AFQ23970.1      --MRYIRLCIISLLAPLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRA

AFQ23960.1      --MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGSVGMIEMDLASGRTLTAWRA

ACV32634.1      --MRYIRLCIISLLATLPLAVHASPQPLDQIKLSESQLSGRVGMIEMDLASGRTLTAWRA

CEA29751.1      MVKRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRA

AFW16978.1      --MRYFRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRA

AFK93491.1      --MRYIRLCIISLLATLPLAVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRA

ACV32636.1      --MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRA

ABN49114.1      --MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRA

AKK23731.1      --MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRA

AEG79634.1      --MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRA

ACV32637.1      --MRFIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRA

AIG51284.1      --MRHIRLCIISLLATLPLAVQASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRA

AIS67768.1      --MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRA

AHA80962.1      --MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRA

AFQ32277.1      --MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRA

AFQ23956.1      --MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRA

AFN88952.1      --MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRA

ABN49113.1      --MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRA

CEA29750.1      MVKRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRA

BAI94487.1      --MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRA

ABV72593.1      --MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRA

ABS72351.1      --MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRA

ABA06587.1      --MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRA

ACV32635.1      --MRYIRLNIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRA

AFQ23961.1      --MRYIRLCIISLLATLPLAVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRA

AFQ23954.1      --MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRA

ABA06589.1      --MRYIRLCIISLLATLPLAVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWCA

ABA06590.1      --MRYIRLCIISLLATLPLAVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRA

CAP58292.1      --MRYIRLCIISLLATLPLAVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRA

AHA80963.1      --MRYIRLCIISLLATLPLAVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRA

AAL82593.1      --MRYIRLCIISLLAALPLAVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRA

ABN49111.1      --MRYIRLCIISLLATLPLAVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRA

ABN49112.1      --MRYIRLCIISLLATLPLAVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRA

AEI83429.1      --MRYIRLCIISLLAALPLVVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRA

ACV53157.1      --MRYIRLCIISLLAALPLVVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRA

AEJ08681.1      --MRYIRLCIISLLAALPLAVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRA

AEX99752.1      --MRYIRLCIISLLAALPLAVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRA

AFQ23963.1      --MRYIRLCIISLLATLPLAVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRA

AFQ23964.1      --MRYIRLCIISLLATLPLAVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLAAWRA

AFQ23965.1      --MRYIRLCIISLLATLPLAVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRA

AHA80959.1      --MRYIRLCIISLLATLPLAVHASPQPLEQIKQSESQLSGRVGMIEMDQASGRTLTAWRA

AJO16042.1      --MRYIRLCIISLLATLPLAVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRA

ALI16958.1      --MRYIRLCIISLLATLPLAVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRA

AAL82592.1      --MRYVRLCIISLLATLPLAVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRA

AHA80958.1      --MRYIRLCIISLLATLPLAVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRA

AKK23732.1      --MRYIRLCIISLLATLPLAVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRA

AAT01223.1      ---------IISLLATLPLAVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRA

                         ****** ***.*:******.*** **.: ** ***:*** .*****:*  *

 

AFQ23955.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

AJO16047.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

AFQ23967.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

AFQ23957.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

AKK23733.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

AEK48094.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

ABN49110.1      DERFPMMSTFKVVLCGTVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

ACV32633.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

BAM28879.1      DERFPMMSTFKVVLCGAVLARVDADDEQLERKIHYRQQDLVDYSPVSEKYLADGMTVGEL

AAL68926.1      DERFPMMSTFKVVLCGAVLARVDAGDKQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

AAP41944.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

ABY56290.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

AAV66328.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

ADR66517.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

AEI83430.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

AFQ23953.1      DERFPMMSAFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

AFQ23959.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

AFQ23958.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

CAP58290.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

AFQ23962.1      DERFPMMSTFKVVLCGAVLARVDAGDEQPERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

AFQ23966.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

AFQ23969.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

AFQ23968.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

AJO16041.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

AJO16040.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

AIS67769.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

AAP41108.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

AFQ23970.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

AFQ23960.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

ACV32634.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

CEA29751.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

AFW16978.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

AFK93491.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

ACV32636.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

ABN49114.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

AKK23731.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

AEG79634.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

ACV32637.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

AIG51284.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

AIS67768.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

AHA80962.1      DERFPMMNTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

AFQ32277.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

AFQ23956.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

AFN88952.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGER

ABN49113.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

CEA29750.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

BAI94487.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

ABV72593.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

ABS72351.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

ABA06587.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

ACV32635.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

AFQ23961.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

AFQ23954.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

ABA06589.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

ABA06590.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLTDGMTVGEL

CAP58292.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

AHA80963.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

AAL82593.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

ABN49111.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQHLVDYSPVSEKHLADGMTVGEL

ABN49112.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

AEI83429.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

ACV53157.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

AEJ08681.1      DERFPMISTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

AEX99752.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

AFQ23963.1      DERFPMMSTFKVMLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

AFQ23964.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

AFQ23965.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

AHA80959.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

AJO16042.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYTPVSEKHLADGMTVGEL

ALI16958.1      DELFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

AAL82592.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

AHA80958.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

AKK23732.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

AAT01223.1      DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

                ** ***:.:***:***:*******.*:* *********.****:*****:*:*******

 

AFQ23955.1      CAAAITMSDNSAANLLLATVGGPAGLTASLRQIGDNVTRLDRWETE--LNEALPGDARDT

AJO16047.1      CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

AFQ23967.1      CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

AFQ23957.1      CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

AKK23733.1      CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIDDNVTRLDRWETE--LNEALPGDARDT

AEK48094.1      CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIDDNVTRLDRWETE--LNEALPGDARDT

ABN49110.1      CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIDDNVTRLDRWETE--LNEALPGDARDT

ACV32633.1      CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

BAM28879.1      CAAAITMSDNSAANLLLATVGGPVGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

AAL68926.1      CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

AAP41944.1      CAAAITMSDNSAANLLLATVGGLAGLTAFLRQIGDNVTRLDRWETE--LNEALPADARDT

ABY56290.1      CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGENVTRLDRWETE--LNEALPGDARDT

AAV66328.1      CAAAITMSDNSVANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

ADR66517.1      CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

AEI83430.1      CAAAITMSDNSAANLLLATVGGPAALTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

AFQ23953.1      CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

AFQ23959.1      CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

AFQ23958.1      CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

CAP58290.1      CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

AFQ23962.1      CAAAITMSDNSAANLLLATVGGPAGLTTFLRQIGDNVTRLDRWETE--LNEALPGDARDT

AFQ23966.1      CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

AFQ23969.1      CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

AFQ23968.1      CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

AJO16041.1      CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

AJO16040.1      CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

AIS67769.1      CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

AAP41108.1      CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

AFQ23970.1      CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

AFQ23960.1      CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

ACV32634.1      CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

CEA29751.1      CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELKLNEALPGDARDT

AFW16978.1      CAAAITMSDNSAANLLLATVGGPVGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

AFK93491.1      CAAAITMSDNSAANLLLATVGGPVGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

ACV32636.1      CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

ABN49114.1      CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

AKK23731.1      CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

AEG79634.1      CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

ACV32637.1      CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

AIG51284.1      CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

AIS67768.1      CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

AHA80962.1      CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

AFQ32277.1      CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDLWETE--LNEALPGDARDT

AFQ23956.1      CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

AFN88952.1      CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

ABN49113.1      CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

CEA29750.1      CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

BAI94487.1      CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

ABV72593.1      CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

ABS72351.1      CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

ABA06587.1      CTAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

ACV32635.1      CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

AFQ23961.1      CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

AFQ23954.1      CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

ABA06589.1      CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

ABA06590.1      CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

CAP58292.1      CAAAITMSDNSAANLLLAIVGGPAGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

AHA80963.1      CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

AAL82593.1      CAAAITVSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

ABN49111.1      CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

ABN49112.1      CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

AEI83429.1      CAAAITVSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

ACV53157.1      CAAAITVSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

AEJ08681.1      CAAAITMSDNSAANLLLAIVGGPAGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

AEX99752.1      CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

AFQ23963.1      CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

AFQ23964.1      CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

AFQ23965.1      CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

AHA80959.1      CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

AJO16042.1      CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

ALI16958.1      CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

AAL82592.1      CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

AHA80958.1      CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

AKK23732.1      CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

AAT01223.1      CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETE--LNEALPGDARDT

                *:****:****.****** *** ..**: ****.:****** ****  ******.*****

 

AFQ23955.1      TTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGER

AJO16047.1      TTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGKR

AFQ23967.1      TTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGER

AFQ23957.1      TTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGER

AKK23733.1      TTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGER

AEK48094.1      TTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGER

ABN49110.1      TTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGER

ACV32633.1      TTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGASKR

BAM28879.1      TTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGER

AAL68926.1      TTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGER

AAP41944.1      TTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGER

ABY56290.1      TTPASMAATLRKLLTNQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGER

AAV66328.1      TTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGER

ADR66517.1      TTPASMTATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGER

AEI83430.1      TTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGER

AFQ23953.1      TTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGER

AFQ23959.1      TTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGASER

AFQ23958.1      TTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGASER

CAP58290.1      TTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGASER

AFQ23962.1      TTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGER

AFQ23966.1      TTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGASKR

AFQ23969.1      TTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGASER

AFQ23968.1      TTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGASER

AJO16041.1      TTPASMTATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGER

AJO16040.1      TTPASMTATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGER

AIS67769.1      TTPASMTATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGER

AAP41108.1      TTPASMTATLRKLLTSQRLSARSQRHLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGER

AFQ23970.1      TTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGASKR

AFQ23960.1      TTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGASKR

ACV32634.1      TTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGASKR

CEA29751.1      TTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGER

AFW16978.1      TTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGER

AFK93491.1      TTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGER

ACV32636.1      TTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGKR

ABN49114.1      TTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGKR

AKK23731.1      TTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGKR

AEG79634.1      TTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGKR

ACV32637.1      TTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGER

AIG51284.1      TTPASMAATLRKLLTSQRLSARSQR