#  Percent Identity  Matrix - created by Clustal2.1

#

#

 

     1: AAB39956.1  100.00   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   99.30

     2: CAA38429.1   98.95  100.00   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.65

     3: AAR89358.1   98.95   99.30  100.00   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.65

     4: AAR89359.1   98.95   99.30   99.30  100.00   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.65

     5: CAG25427.1   98.95   99.30   99.30   99.30  100.00   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.65

     6: AAX56615.1   98.95   99.30   99.30   99.30   99.30  100.00   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.65

     7: AAK30619.1   98.95   99.30   99.30   99.30   99.30   99.30  100.00   99.30   99.30   99.30   99.30   99.30   99.30   99.65

     8: CAC67290.1   98.95   99.30   99.30   99.30   99.30   99.30   99.30  100.00   99.30   99.30   99.30   99.30   99.30   99.65

     9: ABB97007.1   98.95   99.30   99.30   99.30   99.30   99.30   99.30   99.30  100.00   99.30   99.30   99.30   99.30   99.65

    10: ACJ43254.1   98.95   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30  100.00   99.30   99.30   99.30   99.65

    11: ADR71220.1   98.95   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30  100.00   99.30   99.30   99.65

    12: AET99222.1   98.95   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30  100.00   99.30   99.65

    13: AGK82336.1   98.95   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30  100.00   99.65

    14: AAB59737.1   99.30   99.65   99.65   99.65   99.65   99.65   99.65   99.65   99.65   99.65   99.65   99.65   99.65  100.00

 

 

 

CLUSTAL O(1.2.4) multiple sequence alignment

 

                                     23                                   60

AAB39956.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

CAA38429.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDKLGARVGYIELDLNSGKILESFRP

AAR89358.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AAR89359.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

CAG25427.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AAX56615.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVEDAEDQLGARVGYIELDLNSGKILESFRP

AAK30619.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

CAC67290.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

ABB97007.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

ACJ43254.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

ADR71220.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AET99222.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AGK82336.1      MSIQHFRVTLIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AAB59737.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

                ********:**********************:****:***********************

                      68 71                                              120

AAB39956.1      EERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

CAA38429.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

AAR89358.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

AAR89359.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

CAG25427.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

AAX56615.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

AAK30619.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTGGMTVREL

CAC67290.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

ABB97007.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

ACJ43254.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLDRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

ADR71220.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

AET99222.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

AGK82336.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

AAB59737.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

                *********************:*******.**********************.*******

                     128                                                 180

AAB39956.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

CAA38429.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

AAR89358.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDNVTRLDRWEPELNEAIPNDERDTTM

AAR89359.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGEHVTRLDRWEPELNEAIPNDERDTTM

CAG25427.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTT

AAX56615.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

AAK30619.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

CAC67290.1      CSAAITMSDNTAANLLLTTIGGAKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

ABB97007.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

ACJ43254.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

ADR71220.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

AET99222.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNNERDTTM

AGK82336.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

AAB59737.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

                ********************** ***********::*****************:*****

                                                                 232     240

AAB39956.1      PVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

CAA38429.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

AAR89358.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

AAR89359.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

CAG25427.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

AAX56615.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

AAK30619.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

CAC67290.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

ABB97007.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAEPLLRSALPAGWFIADKSGAGERGS

ACJ43254.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

ADR71220.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWLIADKSGAGERGS

AET99222.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

AGK82336.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

AAB59737.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

                *.********************************* ***********:************

 

AAB39956.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

CAA38429.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AAR89358.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AAR89359.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

CAG25427.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AAX56615.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AAK30619.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

CAC67290.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

ABB97007.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

ACJ43254.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

ADR71220.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AET99222.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AGK82336.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AAB59737.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

                **********************************************