#  Percent Identity  Matrix - created by Clustal2.1

#

 

     1: ABI81768.1  100.00   98.25   98.25   97.20   97.55   97.15   98.25   98.60   97.55   97.20   97.55   97.90   98.25   98.25   97.90   97.54   97.54   97.20   97.20   97.55   96.50   97.20   97.55   97.90   96.85   97.55   97.55   97.55   97.90   98.25   97.55   97.90   97.20   97.20   96.50   97.55   98.25   98.25   97.55   97.90   98.60   97.90   98.25   98.60   97.90   98.25   97.20   97.90   97.55   97.90   98.25   97.90   98.25   98.25   97.20   98.60   98.25   98.25   98.25   98.60   98.25   98.25   98.25   98.60   97.90   97.90   97.55   97.55   97.55   97.55   97.55   97.90

     2: ACP18864.1   98.25  100.00   98.60   97.55   97.90   97.51   98.60   98.95   97.90   97.55   97.90   98.25   98.60   98.60   98.25   97.89   97.89   97.55   97.55   97.90   96.85   97.55   97.90   98.25   97.20   97.90   97.90   97.90   98.25   98.60   97.90   98.25   97.55   97.55   96.85   97.90   98.60   98.60   97.90   98.25   98.25   98.25   98.60   98.95   98.25   98.60   97.55   98.25   97.90   98.25   98.60   98.25   98.60   97.89   97.55   98.95   98.60   98.60   98.60   98.95   98.60   98.60   98.60   98.95   98.25   98.25   97.90   97.90   97.90   97.90   97.90   98.25

     3: ABX71157.1   98.25   98.60  100.00   97.55   97.90   97.51   98.60   98.95   97.90   97.55   97.90   98.25   98.60   98.60   98.25   97.89   97.89   97.55   97.55   97.90   96.85   97.55   97.90   98.25   97.20   97.90   97.90   97.90   98.25   98.60   97.90   98.25   97.55   97.55   96.85   97.90   98.60   98.60   97.90   98.25   98.25   98.25   98.60   98.95   98.25   98.60   97.55   98.25   97.90   98.25   98.60   98.25   98.60   97.89   97.55   98.95   98.60   98.60   98.60   98.95   98.60   98.60   98.60   98.95   98.25   98.25   97.90   97.90   97.90   97.90   97.90   98.25

     4: CAC43230.1   97.20   97.55   97.55  100.00   99.65   97.86   97.55   98.25   97.55   98.60   98.95   98.60   98.25   98.25   98.60   96.84   96.84   97.90   97.90   98.95   97.90   98.60   98.95   98.60   96.15   96.85   96.85   96.85   97.20   97.55   97.55   97.90   96.85   97.20   96.50   97.90   97.55   97.90   97.20   97.55   97.20   97.20   97.55   97.90   97.20   97.55   98.60   98.60   98.25   98.25   98.60   98.25   98.60   98.60   97.90   98.25   98.60   98.95   98.60   98.60   98.95   97.90   97.90   98.25   97.90   97.55   97.55   96.85   97.20   97.20   96.85   97.20

     5: CAC43229.1   97.55   97.90   97.90   99.65  100.00   98.22   97.90   98.60   97.90   98.95   99.30   98.95   98.60   98.60   98.95   97.19   97.19   98.25   98.25   98.60   97.55   98.25   98.60   98.95   96.50   97.20   97.20   97.20   97.55   97.90   97.90   98.25   97.20   97.55   96.85   98.25   97.90   98.25   97.55   97.90   97.55   97.55   97.90   98.25   97.55   97.90   98.25   98.95   98.60   98.60   98.95   98.60   98.95   98.95   97.55   98.60   98.95   99.30   98.95   98.95   99.30   98.25   98.25   98.60   98.25   97.90   97.90   97.20   97.20   97.55   97.20   97.55

     6: CAA66659.1   97.15   97.51   97.51   97.86   98.22  100.00   98.22   98.22   98.93   98.58   98.93   99.29   98.22   98.93   98.58   96.79   97.50   97.86   97.86   97.51   97.15   97.86   98.22   98.58   96.80   97.51   98.22   97.51   97.86   98.22   98.93   98.58   96.44   96.44   96.44   97.15   97.51   97.51   97.51   97.15   97.86   97.86   98.22   97.86   97.15   97.51   96.44   97.15   96.80   97.86   98.22   97.86   98.22   97.51   97.15   97.86   97.86   98.22   97.51   97.86   97.51   98.22   97.51   97.86   97.86   97.86   98.22   98.22   98.22   98.22   98.22   98.58

     7: AAS89982.1   98.25   98.60   98.60   97.55   97.90   98.22  100.00   98.95   98.60   98.25   98.60   98.95   99.30   99.30   98.95   97.89   98.60   98.25   98.25   97.90   96.85   97.55   97.90   98.25   97.90   98.60   98.60   98.60   98.95   99.30   98.60   98.95   97.55   97.55   96.85   97.90   98.60   98.60   98.60   98.25   98.95   98.95   99.30   98.95   98.25   98.60   97.55   98.25   97.90   98.25   98.60   98.25   98.60   97.89   97.55   98.95   98.60   98.60   98.60   98.95   98.60   98.60   98.60   98.95   98.25   98.25   98.60   99.30   98.60   98.60   98.60   98.95

     8: AGK40892.1   98.60   98.95   98.95   98.25   98.60   98.22   98.95  100.00   98.60   98.25   98.60   98.95   98.95   99.30   98.95   98.25   98.25   97.90   97.90   98.60   97.55   98.25   98.60   98.95   97.55   98.25   98.25   98.25   98.60   98.95   98.60   98.95   97.90   97.90   97.20   98.60   98.95   98.95   98.25   98.60   98.60   98.60   98.95   99.30   98.60   98.95   97.90   98.60   98.25   98.95   99.30   98.95   99.30   98.25   97.90   99.30   99.30   99.30   98.95   99.30   98.95   98.95   98.95   99.30   98.60   98.60   98.25   98.25   98.25   98.25   98.25   98.60

     9: AAM18924.1   97.55   97.90   97.90   97.55   97.90   98.93   98.60   98.60  100.00   98.25   98.60   98.95   98.60   99.30   98.95   97.19   97.89   97.55   97.55   97.90   97.55   98.25   98.60   98.95   97.20   97.90   98.60   97.90   98.25   98.60   99.30   98.95   96.85   96.85   96.85   97.55   97.90   97.90   97.90   97.55   98.25   98.25   98.60   98.25   97.55   97.90   96.85   97.55   97.20   98.25   98.60   98.25   98.60   97.19   97.55   98.25   98.25   98.60   97.90   98.25   97.90   98.60   97.90   98.25   98.25   98.25   98.60   98.60   98.60   98.60   98.60   98.95

    10: CAA71324.1   97.20   97.55   97.55   98.60   98.95   98.58   98.25   98.25   98.25  100.00   99.65   99.30   98.95   98.95   99.30   96.84   97.54   98.60   98.60   98.25   96.50   97.20   97.55   97.90   96.85   97.55   97.55   97.55   97.90   98.25   98.25   98.60   96.50   96.50   95.80   97.20   97.55   97.55   97.55   97.20   97.90   97.90   98.25   97.90   97.20   97.55   97.20   97.90   97.55   97.90   98.25   97.90   98.25   98.25   96.50   97.90   97.90   98.25   98.25   97.90   98.25   97.55   97.55   97.90   97.20   97.20   97.55   97.55   97.55   97.55   97.55   97.90

    11: CAA71323.1   97.55   97.90   97.90   98.95   99.30   98.93   98.60   98.60   98.60   99.65  100.00   99.65   99.30   99.30   99.65   97.19   97.89   98.95   98.95   97.90   96.85   97.55   97.90   98.25   97.20   97.90   97.90   97.90   98.25   98.60   98.60   98.95   96.85   96.85   96.15   97.55   97.90   97.90   97.90   97.55   98.25   98.25   98.60   98.25   97.55   97.90   97.55   98.25   97.90   98.25   98.60   98.25   98.60   98.60   96.85   98.25   98.25   98.60   98.60   98.25   98.60   97.90   97.90   98.25   97.55   97.55   97.90   97.90   97.90   97.90   97.90   98.25

    12: CAA71322.1   97.90   98.25   98.25   98.60   98.95   99.29   98.95   98.95   98.95   99.30   99.65  100.00   98.95   99.65   99.30   97.54   98.25   98.60   98.60   98.25   97.20   97.90   98.25   98.60   97.55   98.25   98.25   98.25   98.60   98.95   98.95   99.30   97.20   97.20   96.50   97.90   98.25   98.25   98.25   97.90   98.60   98.60   98.95   98.60   97.90   98.25   97.20   97.90   97.55   98.60   98.95   98.60   98.95   98.25   97.20   98.60   98.60   98.95   98.25   98.60   98.25   98.25   98.25   98.60   97.90   97.90   98.25   98.25   98.25   98.25   98.25   98.60

    13: AAO85882.1   98.25   98.60   98.60   98.25   98.60   98.22   99.30   98.95   98.60   98.95   99.30   98.95  100.00   99.30   99.65   97.89   98.60   98.95   98.95   97.90   96.85   97.55   97.90   98.25   97.90   98.60   98.60   98.60   98.95   99.30   98.60   98.95   97.55   97.55   96.85   97.90   98.60   98.60   98.60   98.25   98.95   98.95   99.30   98.95   98.25   98.60   98.25   98.95   98.60   98.25   98.60   98.25   98.60   98.60   97.55   98.95   98.60   98.60   99.30   98.95   99.30   98.60   98.60   98.95   98.25   98.25   98.60   98.60   98.60   98.60   98.60   98.95

    14: AAL03985.1   98.25   98.60   98.60   98.25   98.60   98.93   99.30   99.30   99.30   98.95   99.30   99.65   99.30  100.00   99.65   97.89   98.60   98.25   98.25   98.60   97.55   98.25   98.60   98.95   97.90   98.60   98.60   98.60   98.95   99.30   99.30   99.65   97.55   97.55   96.85   98.25   98.60   98.60   98.60   98.25   98.95   98.95   99.30   98.95   98.25   98.60   97.55   98.25   97.90   98.95   99.30   98.95   99.30   97.89   97.55   98.95   98.95   99.30   98.60   98.95   98.60   98.60   98.60   98.95   98.25   98.25   98.60   98.60   98.60   98.60   98.60   98.95

    15: AEL17198.1   97.90   98.25   98.25   98.60   98.95   98.58   98.95   98.95   98.95   99.30   99.65   99.30   99.65   99.65  100.00   97.54   98.25   98.60   98.60   98.25   97.20   97.90   98.25   98.60   97.55   98.25   98.25   98.25   98.60   98.95   98.95   99.30   97.20   97.20   96.50   97.90   98.25   98.25   98.25   97.90   98.60   98.60   98.95   98.60   97.90   98.25   97.90   98.60   98.25   98.60   98.95   98.60   98.95   98.25   97.20   98.60   98.60   98.95   98.95   98.60   98.95   98.25   98.25   98.60   97.90   97.90   98.25   98.25   98.25   98.25   98.25   98.60

    16: AAQ93491.1   97.54   97.89   97.89   96.84   97.19   96.79   97.89   98.25   97.19   96.84   97.19   97.54   97.89   97.89   97.54  100.00   99.30   97.54   98.25   97.19   98.25   97.54   97.19   97.54   98.95   99.30   98.60   98.60   98.95   98.60   97.89   98.25   98.95   98.95   96.84   98.60   98.60   98.60   98.60   98.95   98.25   98.25   98.60   98.95   98.95   99.30   98.25   98.25   98.60   98.25   97.89   97.54   97.89   97.18   97.54   98.25   97.89   97.89   97.89   98.25   97.89   97.89   97.89   98.25   98.25   98.25   97.89   97.89   97.89   97.89   97.89   98.25

    17: AAQ93490.1   97.54   97.89   97.89   96.84   97.19   97.50   98.60   98.25   97.89   97.54   97.89   98.25   98.60   98.60   98.25   99.30  100.00   98.25   98.25   97.19   97.54   97.54   97.19   97.54   98.95   99.30   98.60   98.60   98.95   98.60   97.89   98.25   98.25   98.25   96.84   97.89   97.89   98.60   98.60   98.25   98.95   98.95   99.30   98.95   98.25   98.60   97.54   98.25   97.89   97.54   97.89   97.54   97.89   97.18   97.54   98.25   97.89   97.89   97.89   98.25   97.89   97.89   97.89   98.25   98.25   98.25   98.60   98.60   98.60   98.60   98.60   98.95

    18: ACJ04051.1   97.20   97.55   97.55   97.90   98.25   97.86   98.25   97.90   97.55   98.60   98.95   98.60   98.95   98.25   98.60   97.54   98.25  100.00   99.30   96.85   96.50   97.20   96.85   97.20   97.55   98.25   98.25   98.25   98.60   98.25   97.55   97.90   97.20   97.20   96.50   97.55   97.55   98.25   98.25   97.90   98.60   98.60   98.95   98.60   97.90   98.25   97.90   98.60   98.25   97.20   97.55   97.20   97.55   98.25   97.20   97.90   97.55   97.55   98.25   97.90   98.25   97.55   98.25   97.90   97.90   97.90   98.25   98.25   98.25   98.25   98.25   98.60

    19: CAC85661.1   97.20   97.55   97.55   97.90   98.25   97.86   98.25   97.90   97.55   98.60   98.95   98.60   98.95   98.25   98.60   98.25   98.25   99.30  100.00   96.85   97.20   97.20   96.85   97.20   98.25   98.95   98.95   98.95   99.30   98.95   98.25   98.60   97.90   97.90   96.50   98.25   98.25   98.25   98.95   98.60   98.60   98.60   98.95   98.60   98.60   98.95   98.60   98.60   98.95   97.90   97.55   97.20   97.55   98.25   97.20   97.90   97.55   97.55   98.25   97.90   98.25   97.55   97.55   97.90   97.90   97.90   98.25   98.25   98.25   98.25   98.25   98.60

    20: AAV83795.1   97.55   97.90   97.90   98.95   98.60   97.51   97.90   98.60   97.90   98.25   97.90   98.25   97.90   98.60   98.25   97.19   97.19   96.85   96.85  100.00   98.25   98.95   99.30   98.95   96.50   97.20   97.20   97.20   97.55   97.90   97.90   98.25   97.20   97.55   96.85   98.25   97.90   98.25   97.55   97.90   97.55   97.55   97.90   98.25   97.55   97.90   98.25   98.25   97.90   98.60   98.95   98.60   98.95   97.54   98.25   98.60   98.95   99.30   98.25   98.95   98.60   98.25   98.25   98.60   98.25   97.90   97.90   97.20   97.55   97.55   97.20   97.55

    21: CBJ06718.1   96.50   96.85   96.85   97.90   97.55   97.15   96.85   97.55   97.55   96.50   96.85   97.20   96.85   97.55   97.20   98.25   97.54   96.50   97.20   98.25  100.00   99.30   98.95   98.60   97.55   98.25   98.25   97.55   97.90   97.55   98.25   97.90   98.25   98.60   97.20   98.60   97.55   97.90   97.90   98.25   97.20   97.20   97.55   97.90   97.90   98.25   98.60   97.90   98.25   98.25   97.90   97.55   97.90   96.49   98.60   97.55   97.90   98.25   97.20   97.90   97.55   97.90   97.20   97.55   98.60   98.25   98.25   97.55   97.90   97.90   97.55   97.90

    22: CAA46345.1   97.20   97.55   97.55   98.60   98.25   97.86   97.55   98.25   98.25   97.20   97.55   97.90   97.55   98.25   97.90   97.54   97.54   97.20   97.20   98.95   99.30  100.00   99.65   99.30   96.85   97.55   98.25   97.55   97.90   97.55   98.25   97.90   97.55   97.90   97.90   98.60   97.55   98.60   97.90   98.25   97.90   97.90   98.25   98.60   97.90   98.25   98.60   98.60   98.25   98.25   98.60   98.25   98.60   97.19   99.30   98.25   98.60   98.95   97.90   98.60   98.25   98.60   97.90   98.25   99.30   98.95   98.95   98.25   98.60   98.60   98.25   98.60

    23: AAS89984.1   97.55   97.90   97.90   98.95   98.60   98.22   97.90   98.60   98.60   97.55   97.90   98.25   97.90   98.60   98.25   97.19   97.19   96.85   96.85   99.30   98.95   99.65  100.00   99.65   96.50   97.20   97.90   97.20   97.55   97.90   98.60   98.25   97.20   97.55   97.55   98.25   97.90   98.25   97.55   97.90   97.55   97.55   97.90   98.25   97.55   97.90   98.25   98.25   97.90   98.60   98.95   98.60   98.95   97.54   98.95   98.60   98.95   99.30   98.25   98.95   98.60   98.95   98.25   98.60   98.95   98.60   98.60   97.90   98.25   98.25   97.90   98.25

    24: ABG77582.1   97.90   98.25   98.25   98.60   98.95   98.58   98.25   98.95   98.95   97.90   98.25   98.60   98.25   98.95   98.60   97.54   97.54   97.20   97.20   98.95   98.60   99.30   99.65  100.00   96.85   97.55   98.25   97.55   97.90   98.25   98.95   98.60   97.55   97.90   97.90   98.60   98.25   98.60   97.90   98.25   97.90   97.90   98.25   98.60   97.90   98.25   97.90   98.60   98.25   98.95   99.30   98.95   99.30   97.89   98.60   98.95   99.30   99.65   98.60   99.30   98.95   99.30   98.60   98.95   99.30   98.95   98.95   98.25   98.25   98.60   98.25   98.60

    25: AHA80960.1   96.85   97.20   97.20   96.15   96.50   96.80   97.90   97.55   97.20   96.85   97.20   97.55   97.90   97.90   97.55   98.95   98.95   97.55   98.25   96.50   97.55   96.85   96.50   96.85  100.00   99.30   98.60   98.60   98.95   98.60   97.90   98.25   98.25   98.25   96.15   97.90   97.90   97.90   98.60   98.25   98.25   98.25   98.60   98.25   98.25   98.60   97.55   97.55   97.90   97.55   97.20   96.85   97.20   96.49   96.85   97.55   97.20   97.20   97.20   97.55   97.20   97.20   97.20   97.55   97.55   97.55   97.90   97.90   97.90   97.90   97.90   98.25

    26: AAF66653.1   97.55   97.90   97.90   96.85   97.20   97.51   98.60   98.25   97.90   97.55   97.90   98.25   98.60   98.60   98.25   99.30   99.30   98.25   98.95   97.20   98.25   97.55   97.20   97.55   99.30  100.00   99.30   99.30   99.65   99.30   98.60   98.95   98.95   98.95   96.85   98.60   98.60   98.60   99.30   98.95   98.95   98.95   99.30   98.95   98.95   99.30   98.25   98.25   98.60   98.25   97.90   97.55   97.90   97.19   97.55   98.25   97.90   97.90   97.90   98.25   97.90   97.90   97.90   98.25   98.25   98.25   98.60   98.60   98.60   98.60   98.60   98.95

    27: AAS89983.1   97.55   97.90   97.90   96.85   97.20   98.22   98.60   98.25   98.60   97.55   97.90   98.25   98.60   98.60   98.25   98.60   98.60   98.25   98.95   97.20   98.25   98.25   97.90   98.25   98.60   99.30  100.00   99.30   99.65   99.30   99.30   98.95   98.25   98.25   97.55   98.60   98.60   98.60   99.30   98.95   98.95   98.95   99.30   98.95   98.95   99.30   98.25   98.25   98.60   98.25   97.90   97.55   97.90   97.19   98.25   98.25   97.90   97.90   97.90   98.25   97.90   98.60   97.90   98.25   98.95   98.95   99.30   99.30   99.30   99.30   99.30   99.65

    28: AAK14792.1   97.55   97.90   97.90   96.85   97.20   97.51   98.60   98.25   97.90   97.55   97.90   98.25   98.60   98.60   98.25   98.60   98.60   98.25   98.95   97.20   97.55   97.55   97.20   97.55   98.60   99.30   99.30  100.00   99.65   99.30   98.60   98.95   98.25   98.25   96.85   98.60   98.60   98.60   99.30   98.95   98.95   98.95   99.30   98.95   98.95   99.30   98.25   98.25   98.60   98.25   97.90   97.55   97.90   97.19   97.55   98.25   97.90   97.90   97.90   98.25   97.90   97.90   97.90   98.25   98.25   98.25   98.60   98.60   98.60   98.60   98.60   98.95

    29: CAA73933.1   97.90   98.25   98.25   97.20   97.55   97.86   98.95   98.60   98.25   97.90   98.25   98.60   98.95   98.95   98.60   98.95   98.95   98.60   99.30   97.55   97.90   97.90   97.55   97.90   98.95   99.65   99.65   99.65  100.00   99.65   98.95   99.30   98.60   98.60   97.20   98.95   98.95   98.95   99.65   99.30   99.30   99.30   99.65   99.30   99.30   99.65   98.60   98.60   98.95   98.60   98.25   97.90   98.25   97.54   97.90   98.60   98.25   98.25   98.25   98.60   98.25   98.25   98.25   98.60   98.60   98.60   98.95   98.95   98.95   98.95   98.95   99.30

    30: CAA76793.1   98.25   98.60   98.60   97.55   97.90   98.22   99.30   98.95   98.60   98.25   98.60   98.95   99.30   99.30   98.95   98.60   98.60   98.25   98.95   97.90   97.55   97.55   97.90   98.25   98.60   99.30   99.30   99.30   99.65  100.00   99.30   99.65   98.25   98.25   96.85   98.60   99.30   98.60   99.30   98.95   98.95   98.95   99.30   98.95   98.95   99.30   98.25   98.25   98.60   98.95   98.60   98.25   98.60   97.89   97.55   98.95   98.60   98.60   98.60   98.95   98.60   98.60   98.60   98.95   98.25   98.25   98.60   98.60   98.60   98.60   98.60   98.95

    31: AAF19151.1   97.55   97.90   97.90   97.55   97.90   98.93   98.60   98.60   99.30   98.25   98.60   98.95   98.60   99.30   98.95   97.89   97.89   97.55   98.25   97.90   98.25   98.25   98.60   98.95   97.90   98.60   99.30   98.60   98.95   99.30  100.00   99.65   97.55   97.55   96.85   98.25   98.60   97.90   98.60   98.25   98.25   98.25   98.60   98.25   98.25   98.60   97.55   97.55   97.90   98.95   98.60   98.25   98.60   97.19   97.55   98.25   98.25   98.60   97.90   98.25   97.90   98.60   97.90   98.25   98.25   98.25   98.60   98.60   98.60   98.60   98.60   98.95

    32: CAC85660.1   97.90   98.25   98.25   97.90   98.25   98.58   98.95   98.95   98.95   98.60   98.95   99.30   98.95   99.65   99.30   98.25   98.25   97.90   98.60   98.25   97.90   97.90   98.25   98.60   98.25   98.95   98.95   98.95   99.30   99.65   99.65  100.00   97.90   97.90   96.50   98.60   98.95   98.25   98.95   98.60   98.60   98.60   98.95   98.60   98.60   98.95   97.90   97.90   98.25   99.30   98.95   98.60   98.95   97.54   97.20   98.60   98.60   98.95   98.25   98.60   98.25   98.25   98.25   98.60   97.90   97.90   98.25   98.25   98.25   98.25   98.25   98.60

    33: AAG44570.1   97.20   97.55   97.55   96.85   97.20   96.44   97.55   97.90   96.85   96.50   96.85   97.20   97.55   97.55   97.20   98.95   98.25   97.20   97.90   97.20   98.25   97.55   97.20   97.55   98.25   98.95   98.25   98.25   98.60   98.25   97.55   97.90  100.00   98.95   96.85   98.60   98.25   98.60   98.60   98.95   97.90   97.90   98.25   98.60   98.60   98.95   98.25   98.25   98.60   98.60   98.25   97.55   97.90   97.19   97.55   98.60   97.90   97.90   97.90   98.25   97.90   97.90   97.90   98.25   98.25   98.25   97.90   97.55   97.55   97.90   97.55   97.90

    34: CCA61905.1   97.20   97.55   97.55   97.20   97.55   96.44   97.55   97.90   96.85   96.50   96.85   97.20   97.55   97.55   97.20   98.95   98.25   97.20   97.90   97.55   98.60   97.90   97.55   97.90   98.25   98.95   98.25   98.25   98.60   98.25   97.55   97.90   98.95  100.00   97.20   98.95   98.25   98.60   98.60   98.95   97.90   97.90   98.25   98.60   98.60   98.95   98.60   98.60   98.95   98.25   97.90   97.55   97.90   97.19   97.90   98.25   98.25   98.25   97.90   98.60   98.25   97.90   97.90   98.25   98.60   98.25   98.25   97.55   97.55   97.90   97.55   97.90

    35: AAC05975.1   96.50   96.85   96.85   96.50   96.85   96.44   96.85   97.20   96.85   95.80   96.15   96.50   96.85   96.85   96.50   96.84   96.84   96.50   96.50   96.85   97.20   97.90   97.55   97.90   96.15   96.85   97.55   96.85   97.20   96.85   96.85   96.50   96.85   97.20  100.00   97.55   96.85   97.90   97.20   97.55   97.20   97.20   97.55   97.90   97.20   97.55   97.20   97.90   97.55   96.85   97.20   96.85   97.20   96.49   97.90   97.55   97.55   97.55   97.20   97.90   97.55   97.90   97.20   97.55   98.60   98.25   98.25   97.55   97.55   97.90   97.55   97.90

    36: ABC96711.1   97.55   97.90   97.90   97.90   98.25   97.15   97.90   98.60   97.55   97.20   97.55   97.90   97.90   98.25   97.90   98.60   97.89   97.55   98.25   98.25   98.60   98.60   98.25   98.60   97.90   98.60   98.60   98.60   98.95   98.60   98.25   98.60   98.60   98.95   97.55  100.00   98.60   98.95   98.95   99.30   98.25   98.25   98.60   98.95   98.95   99.30   98.95   98.95   99.30   98.95   98.60   98.25   98.60   97.54   98.25   98.60   98.95   98.95   98.25   98.95   98.60   98.25   98.25   98.60   98.95   98.60   98.60   97.90   97.90   98.25   97.90   98.25

    37: AAT45742.1   98.25   98.60   98.60   97.55   97.90   97.51   98.60   98.95   97.90   97.55   97.90   98.25   98.60   98.60   98.25   98.60   97.89   97.55   98.25   97.90   97.55   97.55   97.90   98.25   97.90   98.60   98.60   98.60   98.95   99.30   98.60   98.95   98.25   98.25   96.85   98.60  100.00   98.60   98.60   98.95   98.25   98.25   98.60   98.95   98.95   99.30   98.25   98.25   98.60   98.95   98.60   98.25   98.60   97.89   97.55   98.95   98.60   98.60   98.60   98.95   98.60   98.60   98.60   98.95   98.25   98.25   97.90   97.90   97.90   97.90   97.90   98.25

    38: CAA41038.1   98.25   98.60   98.60   97.90   98.25   97.51   98.60   98.95   97.90   97.55   97.90   98.25   98.60   98.60   98.25   98.60   98.60   98.25   98.25   98.25   97.90   98.60   98.25   98.60   97.90   98.60   98.60   98.60   98.95   98.60   97.90   98.25   98.60   98.60   97.90   98.95   98.60  100.00   99.30   99.65   98.95   98.95   99.30   99.65   98.95   99.30   98.60   99.30   98.95   98.60   98.95   98.95   99.30   98.60   98.60   99.30   98.95   98.95   99.30   99.30   98.95   99.30   99.30   99.65   99.30   99.65   98.95   98.60   98.60   99.30   98.60   98.95

    39: AAM52215.1   97.55   97.90   97.90   97.20   97.55   97.51   98.60   98.25   97.90   97.55   97.90   98.25   98.60   98.60   98.25   98.60   98.60   98.25   98.95   97.55   97.90   97.90   97.55   97.90   98.60   99.30   99.30   99.30   99.65   99.30   98.60   98.95   98.60   98.60   97.20   98.95   98.60   99.30  100.00   99.65   98.95   98.95   99.30   98.95   98.95   99.30   98.60   98.60   98.95   98.60   98.25   98.25   98.60   97.89   97.90   98.60   98.25   98.25   98.60   98.60   98.25   98.60   98.60   98.95   98.60   98.95   98.95   98.60   98.60   99.30   98.60   98.95

    40: AAC32889.2   97.90   98.25   98.25   97.55   97.90   97.15   98.25   98.60   97.55   97.20   97.55   97.90   98.25   98.25   97.90   98.95   98.25   97.90   98.60   97.90   98.25   98.25   97.90   98.25   98.25   98.95   98.95   98.95   99.30   98.95   98.25   98.60   98.95   98.95   97.55   99.30   98.95   99.65   99.65  100.00   98.60   98.60   98.95   99.30   99.30   99.65   98.95   98.95   99.30   98.95   98.60   98.60   98.95   98.25   98.25   98.95   98.60   98.60   98.95   98.95   98.60   98.95   98.95   99.30   98.95   99.30   98.60   98.25   98.25   98.95   98.25   98.60

    41: AEK48085.1   98.60   98.25   98.25   97.20   97.55   97.86   98.95   98.60   98.25   97.90   98.25   98.60   98.95   98.95   98.60   98.25   98.95   98.60   98.60   97.55   97.20   97.90   97.55   97.90   98.25   98.95   98.95   98.95   99.30   98.95   98.25   98.60   97.90   97.90   97.20   98.25   98.25   98.95   98.95   98.60  100.00   99.30   99.65   99.30   98.60   98.95   97.90   98.60   98.25   97.90   98.25   97.90   98.25   98.25   97.90   98.60   98.25   98.25   98.25   98.60   98.25   98.25   98.25   98.60   98.60   98.60   98.95   98.95   98.95   98.95   98.95   99.30

    42: AAW47922.1   97.90   98.25   98.25   97.20   97.55   97.86   98.95   98.60   98.25   97.90   98.25   98.60   98.95   98.95   98.60   98.25   98.95   98.60   98.60   97.55   97.20   97.90   97.55   97.90   98.25   98.95   98.95   98.95   99.30   98.95   98.25   98.60   97.90   97.90   97.20   98.25   98.25   98.95   98.95   98.60   99.30  100.00   99.65   99.30   98.60   98.95   97.90   98.60   98.25   97.90   98.25   97.90   98.25   97.54   97.90   98.60   98.25   98.25   98.25   98.60   98.25   98.25   98.25   98.60   98.60   98.60   98.95   98.95   98.95   98.95   98.95   99.30

    43: CAO98721.1   98.25   98.60   98.60   97.55   97.90   98.22   99.30   98.95   98.60   98.25   98.60   98.95   99.30   99.30   98.95   98.60   99.30   98.95   98.95   97.90   97.55   98.25   97.90   98.25   98.60   99.30   99.30   99.30   99.65   99.30   98.60   98.95   98.25   98.25   97.55   98.60   98.60   99.30   99.30   98.95   99.65   99.65  100.00   99.65   98.95   99.30   98.25   98.95   98.60   98.25   98.60   98.25   98.60   97.89   98.25   98.95   98.60   98.60   98.60   98.95   98.60   98.60   98.60   98.95   98.95   98.95   99.30   99.30   99.30   99.30   99.30   99.65

    44: CAA74912.2   98.60   98.95   98.95   97.90   98.25   97.86   98.95   99.30   98.25   97.90   98.25   98.60   98.95   98.95   98.60   98.95   98.95   98.60   98.60   98.25   97.90   98.60   98.25   98.60   98.25   98.95   98.95   98.95   99.30   98.95   98.25   98.60   98.60   98.60   97.90   98.95   98.95   99.65   98.95   99.30   99.30   99.30   99.65  100.00   99.30   99.65   98.60   99.30   98.95   98.60   98.95   98.60   98.95   98.25   98.60   99.30   98.95   98.95   98.95   99.30   98.95   98.95   98.95   99.30   99.30   99.30   98.95   98.95   98.95   98.95   98.95   99.30

    45: AGA83484.1   97.90   98.25   98.25   97.20   97.55   97.15   98.25   98.60   97.55   97.20   97.55   97.90   98.25   98.25   97.90   98.95   98.25   97.90   98.60   97.55   97.90   97.90   97.55   97.90   98.25   98.95   98.95   98.95   99.30   98.95   98.25   98.60   98.60   98.60   97.20   98.95   98.95   98.95   98.95   99.30   98.60   98.60   98.95   99.30  100.00   99.65   98.60   98.60   98.95   98.60   98.25   97.90   98.25   97.54   97.90   98.60   98.25   98.25   98.25   98.60   98.25   98.25   98.25   98.60   98.60   98.60   98.25   98.25   98.25   98.25   98.25   98.60

    46: AAM52207.1   98.25   98.60   98.60   97.55   97.90   97.51   98.60   98.95   97.90   97.55   97.90   98.25   98.60   98.60   98.25   99.30   98.60   98.25   98.95   97.90   98.25   98.25   97.90   98.25   98.60   99.30   99.30   99.30   99.65   99.30   98.60   98.95   98.95   98.95   97.55   99.30   99.30   99.30   99.30   99.65   98.95   98.95   99.30   99.65   99.65  100.00   98.95   98.95   99.30   98.95   98.60   98.25   98.60   97.89   98.25   98.95   98.60   98.60   98.60   98.95   98.60   98.60   98.60   98.95   98.95   98.95   98.60   98.60   98.60   98.60   98.60   98.95

    47: AAR10958.1   97.20   97.55   97.55   98.60   98.25   96.44   97.55   97.90   96.85   97.20   97.55   97.20   98.25   97.55   97.90   98.25   97.54   97.90   98.60   98.25   98.60   98.60   98.25   97.90   97.55   98.25   98.25   98.25   98.60   98.25   97.55   97.90   98.25   98.60   97.20   98.95   98.25   98.60   98.60   98.95   97.90   97.90   98.25   98.60   98.60   98.95  100.00   99.30   99.65   98.25   97.90   97.55   97.90   97.89   98.60   98.25   98.25   98.25   98.60   98.60   98.95   97.90   97.90   98.25   98.60   98.25   98.25   97.55   97.90   97.90   97.55   97.90

    48: AAS19171.1   97.90   98.25   98.25   98.60   98.95   97.15   98.25   98.60   97.55   97.90   98.25   97.90   98.95   98.25   98.60   98.25   98.25   98.60   98.60   98.25   97.90   98.60   98.25   98.60   97.55   98.25   98.25   98.25   98.60   98.25   97.55   97.90   98.25   98.60   97.90   98.95   98.25   99.30   98.60   98.95   98.60   98.60   98.95   99.30   98.60   98.95   99.30  100.00   99.65   98.25   98.60   98.25   98.60   98.60   98.60   98.95   98.95   98.95   99.30   99.30   99.65   98.60   98.60   98.95   99.30   98.95   98.95   98.25   98.25   98.60   98.25   98.60

    49: AAK17194.1   97.55   97.90   97.90   98.25   98.60   96.80   97.90   98.25   97.20   97.55   97.90   97.55   98.60   97.90   98.25   98.60   97.89   98.25   98.95   97.90   98.25   98.25   97.90   98.25   97.90   98.60   98.60   98.60   98.95   98.60   97.90   98.25   98.60   98.95   97.55   99.30   98.60   98.95   98.95   99.30   98.25   98.25   98.60   98.95   98.95   99.30   99.65   99.65  100.00   98.60   98.25   97.90   98.25   98.25   98.25   98.60   98.60   98.60   98.95   98.95   99.30   98.25   98.25   98.60   98.95   98.60   98.60   97.90   97.90   98.25   97.90   98.25

    50: BAB16308.1   97.90   98.25   98.25   98.25   98.60   97.86   98.25   98.95   98.25   97.90   98.25   98.60   98.25   98.95   98.60   98.25   97.54   97.20   97.90   98.60   98.25   98.25   98.60   98.95   97.55   98.25   98.25   98.25   98.60   98.95   98.95   99.30   98.60   98.25   96.85   98.95   98.95   98.60   98.60   98.95   97.90   97.90   98.25   98.60   98.60   98.95   98.25   98.25   98.60  100.00   99.65   98.95   99.30   97.89   97.55   99.30   98.95   99.30   98.60   98.95   98.60   98.60   98.60   98.95   98.25   98.25   97.90   97.55   97.55   97.90   97.55   97.90

    51: CAJ17558.1   98.25   98.60   98.60   98.60   98.95   98.22   98.60   99.30   98.60   98.25   98.60   98.95   98.60   99.30   98.95   97.89   97.89   97.55   97.55   98.95   97.90   98.60   98.95   99.30   97.20   97.90   97.90   97.90   98.25   98.60   98.60   98.95   98.25   97.90   97.20   98.60   98.60   98.95   98.25   98.60   98.25   98.25   98.60   98.95   98.25   98.60   97.90   98.60   98.25   99.65  100.00   99.30   99.65   98.25   97.90   99.65   99.30   99.65   98.95   99.30   98.95   98.95   98.95   99.30   98.60   98.60   98.25   97.90   97.90   98.25   97.90   98.25

    52: AAR84298.1   97.90   98.25   98.25   98.25   98.60   97.86   98.25   98.95   98.25   97.90   98.25   98.60   98.25   98.95   98.60   97.54   97.54   97.20   97.20   98.60   97.55   98.25   98.60   98.95   96.85   97.55   97.55   97.55   97.90   98.25   98.25   98.60   97.55   97.55   96.85   98.25   98.25   98.95   98.25   98.60   97.90   97.90   98.25   98.60   97.90   98.25   97.55   98.25   97.90   98.95   99.30  100.00   99.65   98.25   97.55   98.95   98.95   99.30   98.95   98.95   98.60   98.95   98.95   99.30   98.25   98.60   97.90   97.55   97.55   98.25   97.55   97.90

    53: AAC32891.1   98.25   98.60   98.60   98.60   98.95   98.22   98.60   99.30   98.60   98.25   98.60   98.95   98.60   99.30   98.95   97.89   97.89   97.55   97.55   98.95   97.90   98.60   98.95   99.30   97.20   97.90   97.90   97.90   98.25   98.60   98.60   98.95   97.90   97.90   97.20   98.60   98.60   99.30   98.60   98.95   98.25   98.25   98.60   98.95   98.25   98.60   97.90   98.60   98.25   99.30   99.65   99.65  100.00   98.60   97.90   99.30   99.30   99.65   99.30   99.30   98.95   99.30   99.30   99.65   98.60   98.95   98.25   97.90   97.90   98.60   97.90   98.25

    54: ADM61585.1   98.25   97.89   97.89   98.60   98.95   97.51   97.89   98.25   97.19   98.25   98.60   98.25   98.60   97.89   98.25   97.18   97.18   98.25   98.25   97.54   96.49   97.19   97.54   97.89   96.49   97.19   97.19   97.19   97.54   97.89   97.19   97.54   97.19   97.19   96.49   97.54   97.89   98.60   97.89   98.25   98.25   97.54   97.89   98.25   97.54   97.89   97.89   98.60   98.25   97.89   98.25   98.25   98.60  100.00   97.19   98.60   98.25   98.25   99.30   98.60   98.95   98.60   98.60   98.95   97.89   98.25   97.54   97.19   97.19   97.89   97.19   97.54

    55: CAI29263.1   97.20   97.55   97.55   97.90   97.55   97.15   97.55   97.90   97.55   96.50   96.85   97.20   97.55   97.55   97.20   97.54   97.54   97.20   97.20   98.25   98.60   99.30   98.95   98.60   96.85   97.55   98.25   97.55   97.90   97.55   97.55   97.20   97.55   97.90   97.90   98.25   97.55   98.60   97.90   98.25   97.90   97.90   98.25   98.60   97.90   98.25   98.60   98.60   98.25   97.55   97.90   97.55   97.90   97.19  100.00   98.25   98.25   98.25   97.90   98.60   98.25   98.60   97.90   98.25   99.30   98.95   98.95   98.25   98.60   98.60   98.25   98.60

    56: AAY85632.1   98.60   98.95   98.95   98.25   98.60   97.86   98.95   99.30   98.25   97.90   98.25   98.60   98.95   98.95   98.60   98.25   98.25   97.90   97.90   98.60   97.55   98.25   98.60   98.95   97.55   98.25   98.25   98.25   98.60   98.95   98.25   98.60   98.60   98.25   97.55   98.60   98.95   99.30   98.60   98.95   98.60   98.60   98.95   99.30   98.60   98.95   98.25   98.95   98.60   99.30   99.65   98.95   99.30   98.60   98.25  100.00   99.30   99.30   99.30   99.65   99.30   99.30   99.30   99.65   98.95   98.95   98.60   98.25   98.25   98.60   98.25   98.60

    57: CAL08007.1   98.25   98.60   98.60   98.60   98.95   97.86   98.60   99.30   98.25   97.90   98.25   98.60   98.60   98.95   98.60   97.89   97.89   97.55   97.55   98.95   97.90   98.60   98.95   99.30   97.20   97.90   97.90   97.90   98.25   98.60   98.25   98.60   97.90   98.25   97.55   98.95   98.60   98.95   98.25   98.60   98.25   98.25   98.60   98.95   98.25   98.60   98.25   98.95   98.60   98.95   99.30   98.95   99.30   98.25   98.25   99.30  100.00   99.65   98.95   99.65   99.30   98.95   98.95   99.30   98.95   98.60   98.60   97.90   97.90   98.25   97.90   98.25

    58: AAC72362.1   98.25   98.60   98.60   98.95   99.30   98.22   98.60   99.30   98.60   98.25   98.60   98.95   98.60   99.30   98.95   97.89   97.89   97.55   97.55   99.30   98.25   98.95   99.30   99.65   97.20   97.90   97.90   97.90   98.25   98.60   98.60   98.95   97.90   98.25   97.55   98.95   98.60   98.95   98.25   98.60   98.25   98.25   98.60   98.95   98.25   98.60   98.25   98.95   98.60   99.30   99.65   99.30   99.65   98.25   98.25   99.30   99.65  100.00   98.95   99.65   99.30   98.95   98.95   99.30   98.95   98.60   98.60   97.90   97.90   98.25   97.90   98.25

    59: AAN04881.1   98.25   98.60   98.60   98.60   98.95   97.51   98.60   98.95   97.90   98.25   98.60   98.25   99.30   98.60   98.95   97.89   97.89   98.25   98.25   98.25   97.20   97.90   98.25   98.60   97.20   97.90   97.90   97.90   98.25   98.60   97.90   98.25   97.90   97.90   97.20   98.25   98.60   99.30   98.60   98.95   98.25   98.25   98.60   98.95   98.25   98.60   98.60   99.30   98.95   98.60   98.95   98.95   99.30   99.30   97.90   99.30   98.95   98.95  100.00   99.30   99.65   99.30   99.30   99.65   98.60   98.95   98.25   97.90   97.90   98.60   97.90   98.25

    60: AAA25053.1   98.60   98.95   98.95   98.60   98.95   97.86   98.95   99.30   98.25   97.90   98.25   98.60   98.95   98.95   98.60   98.25   98.25   97.90   97.90   98.95   97.90   98.60   98.95   99.30   97.55   98.25   98.25   98.25   98.60   98.95   98.25   98.60   98.25   98.60   97.90   98.95   98.95   99.30   98.60   98.95   98.60   98.60   98.95   99.30   98.60   98.95   98.60   99.30   98.95   98.95   99.30   98.95   99.30   98.60   98.60   99.65   99.65   99.65   99.30  100.00   99.65   99.30   99.30   99.65   99.30   98.95   98.95   98.25   98.25   98.60   98.25   98.60

    61: AAD22538.1   98.25   98.60   98.60   98.95   99.30   97.51   98.60   98.95   97.90   98.25   98.60   98.25   99.30   98.60   98.95   97.89   97.89   98.25   98.25   98.60   97.55   98.25   98.60   98.95   97.20   97.90   97.90   97.90   98.25   98.60   97.90   98.25   97.90   98.25   97.55   98.60   98.60   98.95   98.25   98.60   98.25   98.25   98.60   98.95   98.25   98.60   98.95   99.65   99.30   98.60   98.95   98.60   98.95   98.95   98.25   99.30   99.30   99.30   99.65   99.65  100.00   98.95   98.95   99.30   98.95   98.60   98.60   97.90   97.90   98.25   97.90   98.25

    62: AAW66604.1   98.25   98.60   98.60   97.90   98.25   98.22   98.60   98.95   98.60   97.55   97.90   98.25   98.60   98.60   98.25   97.89   97.89   97.55   97.55   98.25   97.90   98.60   98.95   99.30   97.20   97.90   98.60   97.90   98.25   98.60   98.60   98.25   97.90   97.90   97.90   98.25   98.60   99.30   98.60   98.95   98.25   98.25   98.60   98.95   98.25   98.60   97.90   98.60   98.25   98.60   98.95   98.95   99.30   98.60   98.60   99.30   98.95   98.95   99.30   99.30   98.95  100.00   99.30   99.65   99.30   99.65   98.95   98.60   98.60   99.30   98.60   98.95

    63: ABB84515.1   98.25   98.60   98.60   97.90   98.25   97.51   98.60   98.95   97.90   97.55   97.90   98.25   98.60   98.60   98.25   97.89   97.89   98.25   97.55   98.25   97.20   97.90   98.25   98.60   97.20   97.90   97.90   97.90   98.25   98.60   97.90   98.25   97.90   97.90   97.20   98.25   98.60   99.30   98.60   98.95   98.25   98.25   98.60   98.95   98.25   98.60   97.90   98.60   98.25   98.60   98.95   98.95   99.30   98.60   97.90   99.30   98.95   98.95   99.30   99.30   98.95   99.30  100.00   99.65   98.60   98.95   98.25   97.90   97.90   98.60   97.90   98.25

    64: CAA76796.1   98.60   98.95   98.95   98.25   98.60   97.86   98.95   99.30   98.25   97.90   98.25   98.60   98.95   98.95   98.60   98.25   98.25   97.90   97.90   98.60   97.55   98.25   98.60   98.95   97.55   98.25   98.25   98.25   98.60   98.95   98.25   98.60   98.25   98.25   97.55   98.60   98.95   99.65   98.95   99.30   98.60   98.60   98.95   99.30   98.60   98.95   98.25   98.95   98.60   98.95   99.30   99.30   99.65   98.95   98.25   99.65   99.30   99.30   99.65   99.65   99.30   99.65   99.65  100.00   98.95   99.30   98.60   98.25   98.25   98.95   98.25   98.60

    65: CAG34105.1   97.90   98.25   98.25   97.90   98.25   97.86   98.25   98.60   98.25   97.20   97.55   97.90   98.25   98.25   97.90   98.25   98.25   97.90   97.90   98.25   98.60   99.30   98.95   99.30   97.55   98.25   98.95   98.25   98.60   98.25   98.25   97.90   98.25   98.60   98.60   98.95   98.25   99.30   98.60   98.95   98.60   98.60   98.95   99.30   98.60   98.95   98.60   99.30   98.95   98.25   98.60   98.25   98.60   97.89   99.30   98.95   98.95   98.95   98.60   99.30   98.95   99.30   98.60   98.95  100.00   99.65   99.65   98.95   98.95   99.30   98.95   99.30

    66: CAA46346.1   97.90   98.25   98.25   97.55   97.90   97.86   98.25   98.60   98.25   97.20   97.55   97.90   98.25   98.25   97.90   98.25   98.25   97.90   97.90   97.90   98.25   98.95   98.60   98.95   97.55   98.25   98.95   98.25   98.60   98.25   98.25   97.90   98.25   98.25   98.25   98.60   98.25   99.65   98.95   99.30   98.60   98.60   98.95   99.30   98.60   98.95   98.25   98.95   98.60   98.25   98.60   98.60   98.95   98.25   98.95   98.95   98.60   98.60   98.95   98.95   98.60   99.65   98.95   99.30   99.65  100.00   99.30   98.95   98.95   99.65   98.95   99.30

    67: CAA46344.1   97.55   97.90   97.90   97.55   97.90   98.22   98.60   98.25   98.60   97.55   97.90   98.25   98.60   98.60   98.25   97.89   98.60   98.25   98.25   97.90   98.25   98.95   98.60   98.95   97.90   98.60   99.30   98.60   98.95   98.60   98.60   98.25   97.90   98.25   98.25   98.60   97.90   98.95   98.95   98.60   98.95   98.95   99.30   98.95   98.25   98.60   98.25   98.95   98.60   97.90   98.25   97.90   98.25   97.54   98.95   98.60   98.60   98.60   98.25   98.95   98.60   98.95   98.25   98.60   99.65   99.30  100.00   99.30   99.30   99.65   99.30   99.65

    68: CAA76794.1   97.55   97.90   97.90   96.85   97.20   98.22   99.30   98.25   98.60   97.55   97.90   98.25   98.60   98.60   98.25   97.89   98.60   98.25   98.25   97.20   97.55   98.25   97.90   98.25   97.90   98.60   99.30   98.60   98.95   98.60   98.60   98.25   97.55   97.55   97.55   97.90   97.90   98.60   98.60   98.25   98.95   98.95   99.30   98.95   98.25   98.60   97.55   98.25   97.90   97.55   97.90   97.55   97.90   97.19   98.25   98.25   97.90   97.90   97.90   98.25   97.90   98.60   97.90   98.25   98.95   98.95   99.30  100.00   99.30   99.30   99.30   99.65

    69: CAA76795.1   97.55   97.90   97.90   97.20   97.20   98.22   98.60   98.25   98.60   97.55   97.90   98.25   98.60   98.60   98.25   97.89   98.60   98.25   98.25   97.55   97.90   98.60   98.25   98.25   97.90   98.60   99.30   98.60   98.95   98.60   98.60   98.25   97.55   97.55   97.55   97.90   97.90   98.60   98.60   98.25   98.95   98.95   99.30   98.95   98.25   98.60   97.90   98.25   97.90   97.55   97.90   97.55   97.90   97.19   98.60   98.25   97.90   97.90   97.90   98.25   97.90   98.60   97.90   98.25   98.95   98.95   99.30   99.30  100.00   99.30   99.30   99.65

    70: AAS79107.1   97.55   97.90   97.90   97.20   97.55   98.22   98.60   98.25   98.60   97.55   97.90   98.25   98.60   98.60   98.25   97.89   98.60   98.25   98.25   97.55   97.90   98.60   98.25   98.60   97.90   98.60   99.30   98.60   98.95   98.60   98.60   98.25   97.90   97.90   97.90   98.25   97.90   99.30   99.30   98.95   98.95   98.95   99.30   98.95   98.25   98.60   97.90   98.60   98.25   97.90   98.25   98.25   98.60   97.89   98.60   98.60   98.25   98.25   98.60   98.60   98.25   99.30   98.60   98.95   99.30   99.65   99.65   99.30   99.30  100.00   99.30   99.65

    71: AAZ23494.1   97.55   97.90   97.90   96.85   97.20   98.22   98.60   98.25   98.60   97.55   97.90   98.25   98.60   98.60   98.25   97.89   98.60   98.25   98.25   97.20   97.55   98.25   97.90   98.25   97.90   98.60   99.30   98.60   98.95   98.60   98.60   98.25   97.55   97.55   97.55   97.90   97.90   98.60   98.60   98.25   98.95   98.95   99.30   98.95   98.25   98.60   97.55   98.25   97.90   97.55   97.90   97.55   97.90   97.19   98.25   98.25   97.90   97.90   97.90   98.25   97.90   98.60   97.90   98.25   98.95   98.95   99.30   99.30   99.30   99.30  100.00   99.65

    72: CAA45828.1   97.90   98.25   98.25   97.20   97.55   98.58   98.95   98.60   98.95   97.90   98.25   98.60   98.95   98.95   98.60   98.25   98.95   98.60   98.60   97.55   97.90   98.60   98.25   98.60   98.25   98.95   99.65   98.95   99.30   98.95   98.95   98.60   97.90   97.90   97.90   98.25   98.25   98.95   98.95   98.60   99.30   99.30   99.65   99.30   98.60   98.95   97.90   98.60   98.25   97.90   98.25   97.90   98.25   97.54   98.60   98.60   98.25   98.25   98.25   98.60   98.25   98.95   98.25   98.60   99.30   99.30   99.65   99.65   99.65   99.65   99.65  100.00

 

 

 

CLUSTAL O(1.2.4) multiple sequence alignment

 

 

ABI81768.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

ACP18864.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

ABX71157.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQVGARVGYIELDLNSGKILESFRP

CAC43230.1      MSIQHFRVALIPFFAAFCFPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

CAC43229.1      MSIQHFRVALIPFFAAFCFPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

CAA66659.1      ---QHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDKLGVRVGYIELDLNSGKILESFRP

AAS89982.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AGK40892.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AAM18924.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDKLGARVGYIELDLNSGKILESFRP

CAA71324.1      MSIQHFRVALIPFFAAFCFPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

CAA71323.1      MSIQHFRVALIPFFAAFCFPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

CAA71322.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AAO85882.1      MSIQHFRVALIPFFAAFCFPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AAL03985.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AEL17198.1      MSIQHFRVALIPFFAAFCFPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AAQ93491.1      MSIKHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AAQ93490.1      MSIKHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

ACJ04051.1      MSIQHFRVALIPFFAAFCFPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

CAC85661.1      MSIQHFRVALIPFFAAFCFPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AAV83795.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

CBJ06718.1      MSIKHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDKLGARVGYIELDLNSGKILESFRP

CAA46345.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDKLGARVGYIELDLNSGKILESFRP

AAS89984.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDKLGARVGYIELDLNSGKILESFRP

ABG77582.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDKLGARVGYIELDLNSGKILESFRP

AHA80960.1      MSIKHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AAF66653.1      MSIKHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AAS89983.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDKLGARVGYIELDLNSGKILESFRP

AAK14792.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

CAA73933.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

CAA76793.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AAF19151.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDKLGARVGYIELDLNSGKILESFRP

CAC85660.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AAG44570.1      MSIKHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

CCA61905.1      MSIKHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AAC05975.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDKLGARVGYIELDPNSGKILESFRP

ABC96711.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AAT45742.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

CAA41038.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AAM52215.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AAC32889.2      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AEK48085.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AAW47922.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

CAO98721.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

CAA74912.2      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AGA83484.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AAM52207.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AAR10958.1      MSIQHFRVALIPFFAAFCFPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AAS19171.1      MSIQHFRVALIPFFAAFCFPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AAK17194.1      MSIQHFRVALIPFFAAFCFPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

BAB16308.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

CAJ17558.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AAR84298.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AAC32891.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

ADM61585.1      MSIQHFRVALIPFFAAFCFPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

CAI29263.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKPAEDKLGARVGYIELDLNSGKILESFRP

AAY85632.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

CAL08007.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AAC72362.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AAN04881.1      MSIQHFRVALIPFFAAFCFPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AAA25053.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AAD22538.1      MSIQHFRVALIPFFAAFCFPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AAW66604.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDKLGARVGYIELDLNSGKILESFRP

ABB84515.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

CAA76796.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

CAG34105.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDKLGARVGYIELDLNSGKILESFRP

CAA46346.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDKLGARVGYIELDLNSGKILESFRP

CAA46344.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDKLGARVGYIELDLNSGKILESFRP

CAA76794.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDKLGARVGYIELDLNSGKILESFRP

CAA76795.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDKLGARVGYIELDLNSGKILESFRP

AAS79107.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDKLGARVGYIELDLNSGKILESFRP

AAZ23494.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDKLGARVGYIEMDLNSGKILESFRP

CAA45828.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDKLGARVGYIELDLNSGKILESFRP

                   :**************:************* ***::*.******:* ***********

 

ABI81768.1      EERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQSDLVEYSPVTEKHLTDGMTVREL

ACP18864.1      EERFPMLSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

ABX71157.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

CAC43230.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

CAC43229.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

CAA66659.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

AAS89982.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

AGK40892.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

AAM18924.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

CAA71324.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

CAA71323.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

CAA71322.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

AAO85882.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

AAL03985.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

AEL17198.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

AAQ93491.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVREL

AAQ93490.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVREL

ACJ04051.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVREL

CAC85661.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVREL

AAV83795.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

CBJ06718.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVREL

CAA46345.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVREL

AAS89984.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

ABG77582.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

AHA80960.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVREL

AAF66653.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVREL

AAS89983.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVREL

AAK14792.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVREL

CAA73933.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVREL

CAA76793.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

AAF19151.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

CAC85660.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

AAG44570.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVREL

CCA61905.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVREL

AAC05975.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVREL

ABC96711.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVREL

AAT45742.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

CAA41038.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVREL

AAM52215.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVREL

AAC32889.2      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVREL

AEK48085.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVREL

AAW47922.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVREL

CAO98721.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVREL

CAA74912.2      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVREL

AGA83484.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVREL

AAM52207.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVREL

AAR10958.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVREL

AAS19171.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVREL

AAK17194.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVREL

BAB16308.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

CAJ17558.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

AAR84298.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

AAC32891.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

ADM61585.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

CAI29263.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVREL

AAY85632.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

CAL08007.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

AAC72362.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

AAN04881.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

AAA25053.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

AAD22538.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

AAW66604.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

ABB84515.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

CAA76796.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

CAG34105.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVREL

CAA46346.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVREL

CAA46344.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVREL

CAA76794.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVREL

CAA76795.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVREL

AAS79107.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVREL

AAZ23494.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVREL

CAA45828.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVREL

                ******:**************:***************.***:******************

 

ABI81768.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

ACP18864.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRGEPELNEAIPNDERDTTM

ABX71157.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

CAC43230.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDSWEPELNEAIPNDERDTTM

CAC43229.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDSWEPELNEAIPNDERDTTM

CAA66659.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

AAS89982.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLRNMGDHVTRLDRWEPELNEAIPNDERDTTM

AGK40892.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

AAM18924.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

CAA71324.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

CAA71323.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

CAA71322.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

AAO85882.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

AAL03985.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

AEL17198.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

AAQ93491.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTT

AAQ93490.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

ACJ04051.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

CAC85661.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTT

AAV83795.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDSWEPELNEAIPNDERDTTM

CBJ06718.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDSWEPELNEAIPNDERDTTT

CAA46345.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDSWEPELNEAIPNDERDTTM

AAS89984.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDSWEPELNEAIPNDERDTTM

ABG77582.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDSWEPELNEAIPNDERDTTM

AHA80960.1      CSAAITMTDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTT

AAF66653.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTT

AAS89983.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTT

AAK14792.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTT

CAA73933.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTT

CAA76793.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTT

AAF19151.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTT

CAC85660.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTT

AAG44570.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLHCWEPELNEAIPNDERDTTT

CCA61905.1      CSAAVTMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDSWEPELNEAIPNDERDTTT

AAC05975.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDSWEPELNEAIPNDERDTTM

ABC96711.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDSWEPELNEAIPNDERDTTT

AAT45742.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERETTT

CAA41038.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDHWEPELNEAIPNDERDTTM

AAM52215.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDHWEPELNEAIPNDERDTTT

AAC32889.2      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDHWEPELNEAIPNDERDTTT

AEK48085.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

AAW47922.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPIDERDTTM

CAO98721.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

CAA74912.2      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

AGA83484.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTT

AAM52207.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTT

AAR10958.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDSWEPELNEAIPNDERDTTT

AAS19171.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDSWEPELNEAIPNDERDTTM

AAK17194.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDSWEPELNEAIPNDERDTTT

BAB16308.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDCWEPELNEAIPNDERDTTT

CAJ17558.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDCWEPELNEAIPNDERDTTM

AAR84298.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDHWEPELNEAVPNDERDTTM

AAC32891.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDHWEPELNEAIPNDERDTTM

ADM61585.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDHWEPELNEAIPNDERDTTM

CAI29263.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDSWEPELNEAIPNDERDTTM

AAY85632.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDCWEPELNEAIPNDERDTTM

CAL08007.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDSWEPELNEAIPNDERDTTM

AAC72362.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDSWEPELNEAIPNDERDTTM

AAN04881.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDHWEPELNEAIPNDERDTTM

AAA25053.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDSWEPELNEAIPNDERDTTM

AAD22538.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDSWEPELNEAIPNDERDTTM

AAW66604.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDHWEPELNEAIPNDERDTTM

ABB84515.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDHWEPELNEAIPNDERDTTM

CAA76796.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDHWEPELNEAIPNDERDTTM

CAG34105.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDSWEPELNEAIPNDERDTTM

CAA46346.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDHWEPELNEAIPNDERDTTM

CAA46344.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDSWEPELNEAIPNDERDTTM

CAA76794.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLRNMGDHVTRLDRWEPELNEAIPNDERDTTM

CAA76795.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

AAS79107.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDHWEPELNEAIPNDERDTTM

AAZ23494.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

CAA45828.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

                ****:**:**********************:*********.  *******:* ***:**

 

ABI81768.1      PVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

ACP18864.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

ABX71157.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

CAC43230.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGTGKRGS

CAC43229.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGKRGS

CAA66659.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGASKRGS

AAS89982.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGASERGS

AGK40892.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGGRGS

AAM18924.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGASKRGS

CAA71324.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGASKRGS

CAA71323.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGASKRGS

CAA71322.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGASKRGS

AAO85882.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGASERGS

AAL03985.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGASKRGS

AEL17198.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGASKRGS

AAQ93491.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

AAQ93490.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGASERGS

ACJ04051.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSVLPAGWFIADKSGASERGS

CAC85661.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGASERGS

AAV83795.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGTGKRGS

CBJ06718.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGTGKRGS

CAA46345.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGTGKRGS

AAS89984.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGTGKRGS

ABG77582.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGKRGS

AHA80960.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGASERGS

AAF66653.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGASERGS

AAS89983.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGASERGS

AAK14792.1      PAAMATTLRKLLTDELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGASERGS

CAA73933.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGASERGS

CAA76793.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGASERGS

AAF19151.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGASKRGS

CAC85660.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGASKRGS

AAG44570.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

CCA61905.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

AAC05975.1      PAAMRTTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRCALPAGWLIADKSGAGERGS

ABC96711.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGVRGS

AAT45742.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

CAA41038.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

AAM52215.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGASERGS

AAC32889.2      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

AEK48085.1      PVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGASERGS

AAW47922.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGASERGS

CAO98721.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGASERGS

CAA74912.2      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

AGA83484.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

AAM52207.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

AAR10958.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGTGERGS

AAS19171.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

AAK17194.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

BAB16308.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGKRGS

CAJ17558.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGKRGS

AAR84298.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGKRGS

AAC32891.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGKRGS

ADM61585.1      PVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

CAI29263.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGTGERGS

AAY85632.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

CAL08007.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGRRGS

AAC72362.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGKRGS

AAN04881.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

AAA25053.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

AAD22538.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

AAW66604.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

ABB84515.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSVLPAGWFIADKSGAGERGS

CAA76796.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

CAG34105.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

CAA46346.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

CAA46344.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGASERGS

CAA76794.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGASERGS

CAA76795.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGGSERGS

AAS79107.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGASERGS

AAZ23494.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGASERGS

CAA45828.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGASERGS

                *.** ********.**************************..*****:****** . ***

 

ABI81768.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

ACP18864.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

ABX71157.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQTAEIGASLIKHW

CAC43230.1      RGIIAALGPDGKPSRIVVIYMTGSQATMDERNRQIAEIGASLIKHW

CAC43229.1      RGIIAALGPDGKPSRIVVIYMTGSQATMDERNRQIAEIGASLIKHW

CAA66659.1      RGIIAALGPDGKPSRIVVIYMTGSQATMDERNRQIAEIGASLIK--

AAS89982.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AGK40892.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AAM18924.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIVEIGASLIKHW

CAA71324.1      RGIIAALGPDGKPSRIVVIYMTGGQATMDERNRQIAEIGASLIKHW

CAA71323.1      RGIIAALGPDGKPSRIVVIYMTGSQATMDERNRQIAEIGASLIKHW

CAA71322.1      RGIIAALGPDGKPSRIVVIYMTGSQATMDERNRQIAEIGASLIKHW

AAO85882.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AAL03985.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AEL17198.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AAQ93491.1      RGII-ALGPDGKPSRIVVIYTTGSQATMDEANRQIAEIGASLIKHW

AAQ93490.1      RGII-ALGPDGKPSRIVVIYTTGSQATMDEANRQIAEIGASLIKHW

ACJ04051.1      RGIIAALGPDGKPSRIVVIYMTGSQATMDERNRQIAEIGASLIKHW

CAC85661.1      RGIIAALGPDGKPSRIVVIYMTGSQATMDERNRQIAEIGASLIKHW

AAV83795.1      RGIIAALGPDGKPSRIVVIYTTGGQATMDERNRQIAEIGASLIKHW

CBJ06718.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

CAA46345.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AAS89984.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

ABG77582.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AHA80960.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDELNRQIAEIGASLIKHW

AAF66653.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AAS89983.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AAK14792.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

CAA73933.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

CAA76793.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AAF19151.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

CAC85660.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AAG44570.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

CCA61905.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AAC05975.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

ABC96711.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AAT45742.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

CAA41038.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AAM52215.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AAC32889.2      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AEK48085.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AAW47922.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

CAO98721.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

CAA74912.2      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AGA83484.1      RGIIAALGPDGKPSRIVVIYTTVSQATMDERNRQIAEIGASLIKHW

AAM52207.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AAR10958.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AAS19171.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AAK17194.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

BAB16308.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

CAJ17558.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AAR84298.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AAC32891.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

ADM61585.1      RGIIAALGPDGKPSRIVVIYMTGSQATMDERNRQIAEIGASLIKH-

CAI29263.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AAY85632.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

CAL08007.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AAC72362.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AAN04881.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AAA25053.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AAD22538.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AAW66604.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

ABB84515.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

CAA76796.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

CAG34105.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

CAA46346.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

CAA46344.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

CAA76794.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

CAA76795.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AAS79107.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AAZ23494.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

CAA45828.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

                **** *************** * .****** *** .********