#  Percent Identity  Matrix - created by Clustal2.1

#

     1: CAA65888.1  100.00   96.14   95.09   96.03   95.79   95.79   96.14   95.44   96.49   96.14

     2: CAB92324.1   96.14  100.00   97.20   97.84   97.20   97.90   97.55   96.85   97.90   97.55

     3: AAQ01671.1   95.09   97.20  100.00   97.84   96.85   97.55   97.90   96.85   97.90   97.55

     4: AAK71474.1   96.03   97.84   97.84  100.00   97.48   97.12   98.20   96.76   97.84   97.48

     5: ABI74448.1   95.79   97.20   96.85   97.48  100.00   99.30   98.60   98.25   98.60   98.95

     6: ABI74447.1   95.79   97.90   97.55   97.12   99.30  100.00   98.60   98.25   98.60   98.95

     7: AAT46413.1   96.14   97.55   97.90   98.20   98.60   98.60  100.00   98.25   99.30   98.95

     8: AAT46414.1   95.44   96.85   96.85   96.76   98.25   98.25   98.25  100.00   98.95   99.30

     9: ACO07310.1   96.49   97.90   97.90   97.84   98.60   98.60   99.30   98.95  100.00   99.65

    10: ABQ00181.1   96.14   97.55   97.55   97.48   98.95   98.95   98.95   99.30   99.65  100.00

 

CLUSTAL O(1.2.4) multiple sequence alignment

 

 

CAA65888.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGSTSGYIELDLNSGKILESFRP

CAB92324.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AAQ01671.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDKLGARVGYIELDLNSGKILESFRP

AAK71474.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDKLGARVGYIELDLNSGKILESFRP

ABI74448.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

ABI74447.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AAT46413.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AAT46414.1      MSIQHFRVALIPFLAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

ACO07310.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

ABQ00181.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

                *************:**********************:**:  ******************

 

CAA65888.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

CAB92324.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

AAQ01671.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVREL

AAK71474.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVREL

ABI74448.1      EERFPMVSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

ABI74447.1      EERFPMVSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

AAT46413.1      EERFPMLSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVREL

AAT46414.1      EERFPMLSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

ACO07310.1      EERFPMLSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

ABQ00181.1      EERFPMLSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

                ******:**********************************:******************

 

CAA65888.1      CSAAITMSDNTAANLLLTTIGGSQELTAFLHNMGDHVTRLDRWEPELNEAIPNDEADTTM

CAB92324.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

AAQ01671.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDSWEPELNEAIPNDERDTTM

AAK71474.1      CSAAITMGDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

ABI74448.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDHWEPELNEAIPNDERDTTM

ABI74447.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDHWEPELNEAIPNDERDTTM

AAT46413.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDHWEPELNEAIPNDERDTTM

AAT46414.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDSREPELNEAIPNDERDTTM

ACO07310.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDSWEPELNEAIPNDERDTTM

ABQ00181.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDSWEPELNEAIPNDERDTTM

                *******.************** :*****************  ************ ****

 

CAA65888.1      PAAMATTLRKLLTGELLTLASRQQLIDWMA-DKVAGPLLRSALPAGWFIADKSGARERGS

CAB92324.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGASKRGS

AAQ01671.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGTGKRGS

AAK71474.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGASERGS

ABI74448.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

ABI74447.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGKRGS

AAT46413.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

AAT46414.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

ACO07310.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

ABQ00181.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

                *****************************  ***********************: :***

 

CAA65888.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

CAB92324.1      RGIIAALGPDGKPSRIVVIYMTGSQATMDELNRQIAEIGASLIKHW

AAQ01671.1      SGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AAK71474.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEI--------

ABI74448.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERDRQIAEIGGSLIKHW

ABI74447.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERDRQIAEIGASLIKHW

AAT46413.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AAT46414.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERDRQIAEIGASLIKHW

ACO07310.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

ABQ00181.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERDRQIAEIGASLIKHW

                 ******************* ********* :******