#  Percent Identity  Matrix - created by Clustal2.1

#

#

 

     1: ABM54869.1  100.00   98.25   98.60   98.25   98.60   98.25   98.60   98.60   98.25   98.60   98.60   98.60   98.60   98.60   98.25   98.60   98.60   98.60   98.60   98.95   98.95

     2: AAD33116.2   98.25  100.00   97.90   97.90   98.25   97.90   98.60   98.60   98.60   98.95   98.95   98.95   98.60   98.25   97.90   98.60   98.95   98.25   98.25   98.60   98.60

     3: ADP20705.1   98.60   97.90  100.00   98.25   98.60   98.60   98.60   98.60   98.25   98.60   98.60   98.60   98.60   98.95   98.95   98.95   98.60   98.95   98.95   98.95   98.95

     4: AAM15527.1   98.25   97.90   98.25  100.00   99.65   98.95   98.60   99.30   98.25   98.60   98.60   98.60   98.95   98.60   98.60   98.60   98.60   98.95   98.95   98.95   99.30

     5: AAL29433.1   98.60   98.25   98.60   99.65  100.00   98.60   98.95   98.95   98.60   98.95   98.95   98.95   99.30   98.95   98.95   98.95   98.95   99.30   99.30   99.30   99.65

     6: AAF05612.1   98.25   97.90   98.60   98.95   98.60  100.00   98.60   99.30   98.25   98.60   98.60   98.60   98.60   98.95   98.60   98.60   98.95   98.60   99.30   99.30   98.95

     7: AAF05613.1   98.60   98.60   98.60   98.60   98.95   98.60  100.00   99.30   98.95   99.30   99.30   99.30   98.95   98.95   98.60   99.30   98.95   98.95   98.95   99.30   99.30

     8: AAL29436.1   98.60   98.60   98.60   99.30   98.95   99.30   99.30  100.00   98.95   99.30   99.30   99.30   98.95   98.95   98.60   99.30   98.95   98.95   98.95   99.30   99.30

     9: AAZ14083.2   98.25   98.60   98.25   98.25   98.60   98.25   98.95   98.95  100.00   99.30   99.30   99.30   98.95   98.60   98.25   98.95   98.60   98.60   98.60   98.95   98.95

    10: AAD22539.1   98.60   98.95   98.60   98.60   98.95   98.60   99.30   99.30   99.30  100.00   99.65   99.65   99.30   98.95   98.60   99.30   98.95   98.95   98.95   99.30   99.30

    11: CAD24670.1   98.60   98.95   98.60   98.60   98.95   98.60   99.30   99.30   99.30   99.65  100.00   99.65   99.65   98.95   98.60   99.30   98.95   98.95   98.95   99.30   99.30

    12: AAF05611.1   98.60   98.95   98.60   98.60   98.95   98.60   99.30   99.30   99.30   99.65   99.65  100.00   99.30   98.95   98.60   99.30   98.95   98.95   98.95   99.30   99.30

    13: AAF05614.1   98.60   98.60   98.60   98.95   99.30   98.60   98.95   98.95   98.95   99.30   99.65   99.30  100.00   98.95   98.95   98.95   98.95   99.30   99.30   99.30   99.65

    14: AAL29434.1   98.60   98.25   98.95   98.60   98.95   98.95   98.95   98.95   98.60   98.95   98.95   98.95   98.95  100.00   99.30   99.65   99.30   99.65   98.95   99.65   99.30

    15: AAL29435.1   98.25   97.90   98.95   98.60   98.95   98.60   98.60   98.60   98.25   98.60   98.60   98.60   98.95   99.30  100.00   99.30   98.60   99.65   99.30   98.95   99.30

    16: AAQ98890.1   98.60   98.60   98.95   98.60   98.95   98.60   99.30   99.30   98.95   99.30   99.30   99.30   98.95   99.65   99.30  100.00   98.95   99.65   98.95   99.30   99.30

    17: ABM54870.1   98.60   98.95   98.60   98.60   98.95   98.95   98.95   98.95   98.60   98.95   98.95   98.95   98.95   99.30   98.60   98.95  100.00   98.95   98.95   99.65   99.30

    18: CAA64682.1   98.60   98.25   98.95   98.95   99.30   98.60   98.95   98.95   98.60   98.95   98.95   98.95   99.30   99.65   99.65   99.65   98.95  100.00   99.30   99.30   99.65

    19: AEG64812.1   98.60   98.25   98.95   98.95   99.30   99.30   98.95   98.95   98.60   98.95   98.95   98.95   99.30   98.95   99.30   98.95   98.95   99.30  100.00   99.30   99.65

    20: AGE11905.1   98.95   98.60   98.95   98.95   99.30   99.30   99.30   99.30   98.95   99.30   99.30   99.30   99.30   99.65   98.95   99.30   99.65   99.30   99.30  100.00   99.65

    21: ADL13944.1   98.95   98.60   98.95   99.30   99.65   98.95   99.30   99.30   98.95   99.30   99.30   99.30   99.65   99.30   99.30   99.30   99.30   99.65   99.65   99.65  100.00

 

CLUSTAL O(1.2.4) multiple sequence alignment

 

 

ABM54869.1      MSIQHFRVALIPFFAAFCFPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AAD33116.2      MSIQHFRVALIPFFAAFCIPVFAHPETLVKVKDAEDKLGARVGYIELDLNSGKILESFRP

ADP20705.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AAM15527.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AAL29433.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AAF05612.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AAF05613.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AAL29436.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AAZ14083.2      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AAD22539.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

CAD24670.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AAF05611.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AAF05614.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AAL29434.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AAL29435.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AAQ98890.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

ABM54870.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDKLGARVGYIELDLNSGKILESFRP

CAA64682.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AEG64812.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AGE11905.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

ADL13944.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

                ******************:*****************:***********************

 

ABM54869.1      EERFPMISTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

AAD33116.2      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

ADP20705.1      EERFPMISTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

AAM15527.1      EERFPMLSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

AAL29433.1      EERFPMLSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

AAF05612.1      EERFPMVSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

AAF05613.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

AAL29436.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

AAZ14083.2      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

AAD22539.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

CAD24670.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

AAF05611.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

AAF05614.1      EERFPMLSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

AAL29434.1      EERFPMVSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

AAL29435.1      EERFPMLSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

AAQ98890.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

ABM54870.1      EERFPMVSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

CAA64682.1      EERFPMLSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

AEG64812.1      EERFPMLSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

AGE11905.1      EERFPMVSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

ADL13944.1      EERFPMLSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

                ******:*****************************************************

 

ABM54869.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTT

AAD33116.2      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

ADP20705.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRLEPELNEAIPNDERDTTM

AAM15527.1      CSAAVTMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

AAL29433.1      CSAAVTMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

AAF05612.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRREPELNEAIPNDERDTTM

AAF05613.1      CSAAITMGDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

AAL29436.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

AAZ14083.2      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

AAD22539.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

CAD24670.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

AAF05611.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

AAF05614.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

AAL29434.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

AAL29435.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRCEPELNEAIPNDERDTTM

AAQ98890.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

ABM54870.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

CAA64682.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

AEG64812.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRREPELNEAIPNDERDTTM

AGE11905.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

ADL13944.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

                ****:**.********************************** ****************

 

ABM54869.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

AAD33116.2      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

ADP20705.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

AAM15527.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

AAL29433.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

AAF05612.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

AAF05613.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

AAL29436.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

AAZ14083.2      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLMRSALPAGWFIADKSGAGERGS

AAD22539.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

CAD24670.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

AAF05611.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

AAF05614.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

AAL29434.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

AAL29435.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

AAQ98890.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

ABM54870.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

CAA64682.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

AEG64812.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

AGE11905.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

ADL13944.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

                **************************************:*********************

 

ABM54869.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AAD33116.2      CGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

ADP20705.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDELNRQIAEIGASLIKHW

AAM15527.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERDRQIAEIGASLIKHW

AAL29433.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AAF05612.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERDRQIAEIGASLIKHW

AAF05613.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AAL29436.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERDRQIAEIGASLIKHW

AAZ14083.2      HGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AAD22539.1      LGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

CAD24670.1      SGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AAF05611.1      GGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AAF05614.1      SGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AAL29434.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDEQNRQIAEIGASLIKHW

AAL29435.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDEQNRQIAEIGASLIKHW

AAQ98890.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDEQNRQIAEIGASLIKHW

ABM54870.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

CAA64682.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDEQNRQIAEIGASLIKHW

AEG64812.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AGE11905.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

ADL13944.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

                 ***************************** :**************