#  Percent Identity  Matrix - created by Clustal2.1

#

#

 

     1: AFC75524.1  100.00   94.76   93.71   96.85   95.10   95.45   94.76   94.41   94.76   95.10   94.76   94.70   95.45   95.45   95.45   95.45   95.80   95.10   95.10   95.80   95.80   95.80   95.80   95.80   95.80   95.80   95.80   95.80   95.80   95.80   95.80   95.80   95.80   95.80   95.80   95.80   95.80   95.80   95.45

     2: AFC75523.1   94.76  100.00   94.06   97.20   95.45   95.80   94.76   95.10   95.10   95.45   95.10   95.05   95.80   95.80   95.80   95.80   95.80   95.45   95.45   96.15   96.15   96.15   96.15   96.15   96.15   96.15   96.15   96.15   96.15   96.15   96.15   96.15   96.15   96.15   96.50   96.15   96.15   96.15   95.80

     3: ABO64442.1   93.71   94.06  100.00   96.15   96.50   96.85   95.80   97.20   96.15   96.50   96.15   96.11   96.85   96.85   96.85   96.85   96.85   96.50   96.50   97.20   97.20   97.20   97.20   97.20   97.20   97.55   97.20   97.20   97.20   97.20   97.20   97.90   97.20   97.55   97.20   97.20   97.20   97.20   96.85

     4: AFC75525.1   96.85   97.20   96.15  100.00   97.55   97.90   96.85   97.20   97.20   97.55   97.20   97.17   97.90   97.90   97.90   97.90   97.90   97.55   97.55   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   97.90

     5: AEL88240.1   95.10   95.45   96.50   97.55  100.00   98.95   97.55   97.20   97.55   97.90   97.90   97.53   98.25   98.25   98.25   98.25   98.25   97.90   97.90   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.25

     6: AEL79515.1   95.45   95.80   96.85   97.90   98.95  100.00   97.55   97.55   97.90   98.25   98.25   97.88   98.60   98.60   98.60   98.60   98.60   98.25   98.25   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.60

     7: AAM28884.1   94.76   94.76   95.80   96.85   97.55   97.55  100.00   96.50   98.25   98.60   98.25   97.53   97.55   97.55   97.55   97.55   97.55   97.20   97.20   97.90   97.90   97.90   97.90   97.90   97.90   97.90   97.90   97.90   97.90   97.90   97.90   97.90   97.90   97.90   97.90   97.90   97.90   97.90   97.55

     8: AGZ20205.1   94.41   95.10   97.20   97.20   97.20   97.55   96.50  100.00   96.85   97.20   96.85   97.53   97.55   97.55   97.55   97.55   98.25   97.90   97.90   97.90   97.90   97.90   97.90   97.90   97.90   97.90   97.90   97.90   97.90   97.90   97.90   98.60   97.90   97.90   97.90   97.90   97.90   97.90   97.55

     9: AAK85243.1   94.76   95.10   96.15   97.20   97.55   97.90   98.25   96.85  100.00   99.65   99.30   97.88   98.25   97.90   98.60   97.90   97.90   97.55   97.55   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   97.90

    10: AAK85245.1   95.10   95.45   96.50   97.55   97.90   98.25   98.60   97.20   99.65  100.00   99.65   98.23   98.25   98.25   98.95   98.25   98.25   97.90   97.90   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.25

    11: AAK85244.1   94.76   95.10   96.15   97.20   97.90   98.25   98.25   96.85   99.30   99.65  100.00   97.88   97.90   97.90   98.60   97.90   97.90   97.55   97.55   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   98.25   97.90

    12: AFN69127.1   94.70   95.05   96.11   97.17   97.53   97.88   97.53   97.53   97.88   98.23   97.88  100.00   97.88   97.88   97.88   97.88   97.88   98.59   98.59   98.23   98.23   98.23   98.23   98.23   98.23   98.23   98.23   98.23   98.23   98.23   98.23   98.23   98.94   98.23   98.23   98.23   98.23   98.23   97.88

    13: AAZ14084.2   95.45   95.80   96.85   97.90   98.25   98.60   97.55   97.55   98.25   98.25   97.90   97.88  100.00   98.60   98.60   98.60   98.60   98.25   98.25   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.60

    14: AHJ78622.1   95.45   95.80   96.85   97.90   98.25   98.60   97.55   97.55   97.90   98.25   97.90   97.88   98.60  100.00   98.60   98.60   98.60   98.25   98.25   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.60

    15: ACF32746.1   95.45   95.80   96.85   97.90   98.25   98.60   97.55   97.55   98.60   98.95   98.60   97.88   98.60   98.60  100.00   98.60   98.60   98.25   98.25   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.60

    16: AFS44742.1   95.45   95.80   96.85   97.90   98.25   98.60   97.55   97.55   97.90   98.25   97.90   97.88   98.60   98.60   98.60  100.00   98.60   98.25   98.25   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.60

    17: AIW68620.1   95.80   95.80   96.85   97.90   98.25   98.60   97.55   98.25   97.90   98.25   97.90   97.88   98.60   98.60   98.60   98.60  100.00   98.25   98.25   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.60

    18: AAL77062.1   95.10   95.45   96.50   97.55   97.90   98.25   97.20   97.90   97.55   97.90   97.55   98.59   98.25   98.25   98.25   98.25   98.25  100.00   99.65   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   99.30   98.95

    19: ABD60314.1   95.10   95.45   96.50   97.55   97.90   98.25   97.20   97.90   97.55   97.90   97.55   98.59   98.25   98.25   98.25   98.25   98.25   99.65  100.00   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   98.60   99.30   98.95

    20: AJO16045.1   95.80   96.15   97.20   98.25   98.60   98.95   97.90   97.90   98.25   98.60   98.25   98.23   98.95   98.95   98.95   98.95   98.95   98.60   98.60  100.00   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   98.95

    21: AJO16044.1   95.80   96.15   97.20   98.25   98.60   98.95   97.90   97.90   98.25   98.60   98.25   98.23   98.95   98.95   98.95   98.95   98.95   98.60   98.60   99.30  100.00   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   98.95

    22: AIS39742.1   95.80   96.15   97.20   98.25   98.60   98.95   97.90   97.90   98.25   98.60   98.25   98.23   98.95   98.95   98.95   98.95   98.95   98.60   98.60   99.30   99.30  100.00   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   98.95

    23: CDN33426.1   95.80   96.15   97.20   98.25   98.60   98.95   97.90   97.90   98.25   98.60   98.25   98.23   98.95   98.95   98.95   98.95   98.95   98.60   98.60   99.30   99.30   99.30  100.00   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   98.95

    24: AHA58207.1   95.80   96.15   97.20   98.25   98.60   98.95   97.90   97.90   98.25   98.60   98.25   98.23   98.95   98.95   98.95   98.95   98.95   98.60   98.60   99.30   99.30   99.30   99.30  100.00   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   98.95

    25: AGW25367.1   95.80   96.15   97.20   98.25   98.60   98.95   97.90   97.90   98.25   98.60   98.25   98.23   98.95   98.95   98.95   98.95   98.95   98.60   98.60   99.30   99.30   99.30   99.30   99.30  100.00   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   98.95

    26: AGL39384.1   95.80   96.15   97.55   98.25   98.60   98.95   97.90   97.90   98.25   98.60   98.25   98.23   98.95   98.95   98.95   98.95   98.95   98.60   98.60   99.30   99.30   99.30   99.30   99.30   99.30  100.00   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   98.95

    27: BAL68178.1   95.80   96.15   97.20   98.25   98.60   98.95   97.90   97.90   98.25   98.60   98.25   98.23   98.95   98.95   98.95   98.95   98.95   98.60   98.60   99.30   99.30   99.30   99.30   99.30   99.30   99.30  100.00   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   98.95

    28: ADB90239.1   95.80   96.15   97.20   98.25   98.60   98.95   97.90   97.90   98.25   98.60   98.25   98.23   98.95   98.95   98.95   98.95   98.95   98.60   98.60   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30  100.00   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   98.95

    29: ACI25375.1   95.80   96.15   97.20   98.25   98.60   98.95   97.90   97.90   98.25   98.60   98.25   98.23   98.95   98.95   98.95   98.95   98.95   98.60   98.60   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30  100.00   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   98.95

    30: AAM22276.1   95.80   96.15   97.20   98.25   98.60   98.95   97.90   97.90   98.25   98.60   98.25   98.23   98.95   98.95   98.95   98.95   98.95   98.60   98.60   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30  100.00   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   98.95

    31: AAF01046.1   95.80   96.15   97.20   98.25   98.60   98.95   97.90   97.90   98.25   98.60   98.25   98.23   98.95   98.95   98.95   98.95   98.95   98.60   98.60   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30  100.00   99.30   99.30   99.30   99.30   99.30   99.30   99.30   98.95

    32: ADA79630.1   95.80   96.15   97.90   98.25   98.60   98.95   97.90   98.60   98.25   98.60   98.25   98.23   98.95   98.95   98.95   98.95   98.95   98.60   98.60   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30  100.00   99.30   99.30   99.30   99.30   99.30   99.30   98.95

    33: CAQ00120.1   95.80   96.15   97.20   98.25   98.60   98.95   97.90   97.90   98.25   98.60   98.25   98.94   98.95   98.95   98.95   98.95   98.95   98.60   98.60   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30  100.00   99.30   99.30   99.30   99.30   99.30   98.95

    34: CAJ66089.1   95.80   96.15   97.55   98.25   98.60   98.95   97.90   97.90   98.25   98.60   98.25   98.23   98.95   98.95   98.95   98.95   98.95   98.60   98.60   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30  100.00   99.30   99.30   99.30   99.30   98.95

    35: CAJ32372.1   95.80   96.50   97.20   98.25   98.60   98.95   97.90   97.90   98.25   98.60   98.25   98.23   98.95   98.95   98.95   98.95   98.95   98.60   98.60   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30  100.00   99.30   99.30   99.30   98.95

    36: AAM61953.1   95.80   96.15   97.20   98.25   98.60   98.95   97.90   97.90   98.25   98.60   98.25   98.23   98.95   98.95   98.95   98.95   98.95   98.60   98.60   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30  100.00   99.30   99.30   98.95

    37: AAM61952.1   95.80   96.15   97.20   98.25   98.60   98.95   97.90   97.90   98.25   98.60   98.25   98.23   98.95   98.95   98.95   98.95   98.95   98.60   98.60   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30  100.00   99.30   98.95

    38: ACR22829.1   95.80   96.15   97.20   98.25   98.60   98.95   97.90   97.90   98.25   98.60   98.25   98.23   98.95   98.95   98.95   98.95   98.95   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30   99.30  100.00   99.65

    39: AAL68923.1   95.45   95.80   96.85   97.90   98.25   98.60   97.55   97.55   97.90   98.25   97.90   97.88   98.60   98.60   98.60   98.60   98.60   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   98.95   99.65  100.00

 

CLUSTAL O(1.2.4) multiple sequence alignment

 

 

AFC75524.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AFC75523.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

ABO64442.1      MSIQHFRVALIPFFAAFCLPVFAHPKTLVKVKDAENQLGARVGYIELDLNSGKILESFRP

AFC75525.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AEL88240.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AEL79515.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AAM28884.1      MDPQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AGZ20205.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AAK85243.1      MDPQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AAK85245.1      MDPQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AAK85244.1      MDPQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AFN69127.1      ---QHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDKLGARVGYIELDLNSGKILESFRP

AAZ14084.2      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AHJ78622.1      MSIQHFRVSLIPFFAAFCLPVFAHPETLVKVKDAEDQLGAPVGYIELDLNSGKILESFRP

ACF32746.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AFS44742.1      MSIQHFRVALIPFFAAFCLPVFAHPETVVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AIW68620.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AAL77062.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

ABD60314.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AJO16045.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AJO16044.1      MSIQHFRVALFPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AIS39742.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

CDN33426.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AHA58207.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AGW25367.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLDARVGYIELDLNSGKILESFRP

AGL39384.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

BAL68178.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

ADB90239.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

ACI25375.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AAM22276.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AAF01046.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

ADA79630.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

CAQ00120.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

CAJ66089.1      MSIQHFRVALIPFFAAFCLPVFAHPDTLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

CAJ32372.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AAM61953.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AAM61952.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

ACR22829.1      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AAL68923.1      MSIQHFRVALIPFFAAFCFPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

                   *****:*:*******:******.*:*******::*.* *******************

 

AFC75524.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSRNDLVEYSPVTEKHLTDGMTVREL

AFC75523.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

ABO64442.1      EKRFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQSDVVEYSPVTEKHLTDGMTVREL

AFC75525.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSRNDLVEYSPVTEKHLTDGMTVREL

AEL88240.1      EERFPMLSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

AEL79515.1      EERFPMLSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

AAM28884.1      EERFPMMSTFKVLLCGAELSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

AGZ20205.1      EERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVREL

AAK85243.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

AAK85245.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

AAK85244.1      EERFPMVSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

AFN69127.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVREL

AAZ14084.2      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLPDGMTVREL

AHJ78622.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

ACF32746.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

AFS44742.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

AIW68620.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

AAL77062.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVREL

ABD60314.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVREL

AJO16045.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

AJO16044.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

AIS39742.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

CDN33426.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

AHA58207.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEFSPVTEKHLTDGMTVREL

AGW25367.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

AGL39384.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDFVEYSPVTEKHLTDGMTVREL

BAL68178.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

ADB90239.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

ACI25375.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVGEL

AAM22276.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

AAF01046.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

ADA79630.1      EERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

CAQ00120.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

CAJ66089.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

CAJ32372.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

AAM61953.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

AAM61952.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

ACR22829.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

AAL68923.1      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

                *:****:********** ***:**************:.*.*::******** ***** **

 

AFC75524.1      CSAAITMSDNTAANILLTTIGGPKELTAFLHNMRDHVTRLDRWEPELNEAIPHDERDTTM

AFC75523.1      CSAAITMSDNTAAHLFLTTIGGPKELTAFLHNMGDHVTRLDCWGPKLTEAIPHDERDTTM

ABO64442.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

AFC75525.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDCWEPELNEAIPHDERDTTM

AEL88240.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRGEPELNEAIPNDERDTTM

AEL79515.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

AAM28884.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

AGZ20205.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDSWEPELNEAIPNDERDTTT

AAK85243.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

AAK85245.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

AAK85244.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

AFN69127.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNIGDHVTRLDRWEPELNEAIPNDERDTTM

AAZ14084.2      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

AHJ78622.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

ACF32746.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

AFS44742.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

AIW68620.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTT

AAL77062.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

ABD60314.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

AJO16045.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLRNMGDHVTRLDRWEPELNEAIPNDERDTTM

AJO16044.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

AIS39742.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

CDN33426.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

AHA58207.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

AGW25367.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

AGL39384.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

BAL68178.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

ADB90239.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

ACI25375.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

AAM22276.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLGRWEPELNEAIPNDERDTTM

AAF01046.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

ADA79630.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

CAQ00120.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNIGDHVTRLDRWEPELNEAIPNDERDTTM

CAJ66089.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

CAJ32372.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

AAM61953.1      CNAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

AAM61952.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

ACR22829.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

AAL68923.1      CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

                *.***********:::**************:*: ******.   *:*.****:******

 

AFC75524.1      PAPVATTLRTLLTVELLTLASRPRLIDWMEADKVAGPILRSALPAGWFIADKSGAGERGS

AFC75523.1      PAAVANTLRKLLTGELLTLASRQQLIDWMEADKVAGPILRSALPAGWFIADKSGAGERGS

ABO64442.1      PVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

AFC75525.1      PAAVATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

AEL88240.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

AEL79515.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGKRGS

AAM28884.1      PAAMATTLRKLLTSELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

AGZ20205.1      PVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

AAK85243.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

AAK85245.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

AAK85244.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

AFN69127.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGASERGS

AAZ14084.2      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

AHJ78622.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

ACF32746.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

AFS44742.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

AIW68620.1      PATMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

AAL77062.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGADERGS

ABD60314.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGANERGS

AJO16045.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

AJO16044.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

AIS39742.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

CDN33426.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

AHA58207.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

AGW25367.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

AGL39384.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

BAL68178.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

ADB90239.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSVLPAGWFIADKSGAGERGS

ACI25375.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

AAM22276.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

AAF01046.1      PAAMATTLRKLLTGELLTLASQQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

ADA79630.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

CAQ00120.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

CAJ66089.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

CAJ32372.1      PAAMAKTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

AAM61953.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

AAM61952.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

ACR22829.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

AAL68923.1      PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

                *. :*.***.*** *******: :*************:***.*************.:***

 

AFC75524.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AFC75523.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

ABO64442.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AFC75525.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AEL88240.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERDRQIAEIGASLIKHW

AEL79515.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AAM28884.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERSRQIAEIGASLIKHW

AGZ20205.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AAK85243.1      SGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKLW

AAK85245.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKLW

AAK85244.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKLW

AFN69127.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AAZ14084.2      HGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AHJ78622.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

ACF32746.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDEQNRQIAEIGASLIKLW

AFS44742.1      RGIIAALGPDGKPSRIVVIYTTGGQATMDERNRQIAEIGASLIKHW

AIW68620.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AAL77062.1      RGIIAALGPDGKPSRIVVIYMTGSQATMDERNRQIAEIGASLIKHW

ABD60314.1      RGIIAALGPDGKPSRIVVIYMTGSQATMDERNRQIAEIGASLIKHW

AJO16045.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AJO16044.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AIS39742.1      RGIIAALGPDGKPSRIVFIYTTGSQATMDERNRQIAEIGASLIKHW

CDN33426.1      RGIIAALGPDGKPSRIVVMYTTGSQATMDERNRQIAEIGASLIKHW

AHA58207.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AGW25367.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AGL39384.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

BAL68178.1      RGIIAALGPDGKPSRIVVIYTTGSQAIMDERNRQIAEIGASLIKHW

ADB90239.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

ACI25375.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AAM22276.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AAF01046.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

ADA79630.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

CAQ00120.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

CAJ66089.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

CAJ32372.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AAM61953.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

AAM61952.1      RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIVEIGASLIKHW

ACR22829.1      RGIIAALGPDGKPSRIVVIYMTGSQATMDERNRQIAEIGASLIKHW

AAL68923.1      RGIIAALGPDGKPSRIVVIYMTGSQATMDERNRQIAEIGASLIKHW

                 ****************.:* **.** ***:.***.******** *