#Percent IdentityMatrix - created by Clustal2.1

#

 

†††† 1: CDN33427.1|SHV2be|Enterobacter††† 100.00†† 97.90†† 98.60†† 97.90

†††† 2: CAJ47127.2|SHV2br|Klebsiella†††††† 97.90100.00†† 97.90†† 97.90

†††† 3: ACM04459.1|SHV2b|Klebsiella††††††† 98.60†† 97.90100.00†† 97.90

†††† 4: AFQ23955.1|SHVunknown|Klebsiella†† 97.90†† 97.90†† 97.90100.00

 

         



CLUSTAL O(1.2.4) multiple sequence alignment

 

 

CDN33427.1|SHV2be|Enterobacter††††††† MRYIRLCIISLLATLPLAVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRADE

CAJ47127.2|SHV2br|Klebsiella††††††††† MRYFRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADE

ACM04459.1|SHV2b|Klebsiella†††††††††† MRYIRRCIISLLATLPLAVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRADE

AFQ23955.1|SHVunknown|Klebsiella††††† MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESRLSGSVGMIEMDLASGRTLTAWRADE

††††††††††††††††††††††††††††††††††††† ***:* ************************ ***:*** *********************

 

CDN33427.1|SHV2be|Enterobacter††††††† RFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCA

CAJ47127.2|SHV2br|Klebsiella††††††††† RFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCA

ACM04459.1|SHV2b|Klebsiella†††††††††† RFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCA

AFQ23955.1|SHVunknown|Klebsiella††††† RFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCA

††††††††††††††††††††††††††††††††††††† ************************************************************

 

CDN33427.1|SHV2be|Enterobacter††††††† AAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPA

CAJ47127.2|SHV2br|Klebsiella††††††††† AAITMSDNSAANLLLATVGGPVGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPA

ACM04459.1|SHV2b|Klebsiella†††††††††† AAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPA

AFQ23955.1|SHVunknown|Klebsiella††††† AAITMSDNSAANLLLATVGGPAGLTASLRQIGDNVTRLDRWETELNEALPGDARDTTTPA

††††††††††††††††††††††††††††††††††††† *********************.**** *********************************

 

CDN33427.1|SHV2be|Enterobacter††††††† SMAAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGASKRGAR

CAJ47127.2|SHV2br|Klebsiella††††††††† SMA-ATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADRTGAGERGAR

ACM04459.1|SHV2b|Klebsiella†††††††††† SMA-ATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGAR

AFQ23955.1|SHVunknown|Klebsiella††††† SMA-ATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGAR

††††††††††††††††††††††††††††††††††††† *** **********************************************:***.:****

 

CDN33427.1|SHV2be|Enterobacter††††††† GIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR

CAJ47127.2|SHV2br|Klebsiella††††††††† GIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR

ACM04459.1|SHV2b|Klebsiella†††††††††† GIVALLGPNNKAERIVVIYLRDMPASMAERNQQIAGIGAALIEHWQR

AFQ23955.1|SHVunknown|Klebsiella††††† GIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR

††††††††††††††††††††††††††††††††††††† ********************** ************************

†††††††

 

>CAJ47127.2|SHV2br|Klebsiella pneumoniae

MRYFRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADE

RFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCA

AAITMSDNSAANLLLATVGGPVGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPA

SMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADRTGAGERGARG

IVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR

>CDN33427.1|SHV2be|Enterobacter cloacae

MRYIRLCIISLLATLPLAVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRADE

RFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCA

AAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPA

SMAAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGASKRGAR

GIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR

>ACM04459.1|SHV2b|Klebsiella pneumoniae

MRYIRRCIISLLATLPLAVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRADE

RFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCA

AAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPA

SMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARG

IVALLGPNNKAERIVVIYLRDMPASMAERNQQIAGIGAALIEHWQR

>AFQ23955.1|SHVunknown|Klebsiella pneumoniae

MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESRLSGSVGMIEMDLASGRTLTAWRADE

RFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCA

AAITMSDNSAANLLLATVGGPAGLTASLRQIGDNVTRLDRWETELNEALPGDARDTTTPA

SMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARG

IVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR