#  Percent Identity  Matrix - created by Clustal2.1

#

#

 

     1: CDN33427.1|SHV2be|Enterobacter       100.00   97.90   98.60   97.90   62.32   63.60   64.44   64.08   64.08

     2: CAJ47127.2|SHV2br|Klebsiella          97.90  100.00   97.90   97.90   63.03   63.96   65.14   64.79   64.79

     3: ACM04459.1|SHV2b|Klebsiella           98.60   97.90  100.00   97.90   63.03   63.96   65.14   64.79   64.79

     4: AFQ23955.1|SHVunknown|Klebsiella      97.90   97.90   97.90  100.00   61.97   63.25   64.08   63.73   63.73

     5: AFC75524.1|TEMunknown|Acinetobacter   62.32   63.03   63.03   61.97  100.00   93.33   95.10   95.45   95.10

     6: CAA65888.1|TEM-2ber|Serratia          63.60   63.96   63.96   63.25   93.33  100.00   96.14   96.49   96.14

     7: ABM54869.1|TEM-2br|Proteus            64.44   65.14   65.14   64.08   95.10   96.14  100.00   98.25   97.90

     8: AAB39956.1|TEM-2b|Staphylococcus      64.08   64.79   64.79   63.73   95.45   96.49   98.25  100.00   99.65

     9: ABI81768.1|TEM-2be|Enterobacter       64.08   64.79   64.79   63.73   95.10   96.14   97.90   99.65  100.00

 



CLUSTAL O(1.2.4) multiple sequence alignment

 

 

CDN33427.1|SHV2be|Enterobacter           --MRYIRLCIISLLATLPLAVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRA

CAJ47127.2|SHV2br|Klebsiella             --MRYFRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRA

ACM04459.1|SHV2b|Klebsiella              --MRYIRRCIISLLATLPLAVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRA

AFQ23955.1|SHVunknown|Klebsiella         --MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESRLSGSVGMIEMDLASGRTLTAWRA

AFC75524.1|TEMunknown|Acinetobacter      MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

CAA65888.1|TEM-2ber|Serratia             MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGSTSGYIELDLNSGKILESFRP

ABM54869.1|TEM-2br|Proteus               MSIQHFRVALIPFFAAFCFPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

AAB39956.1|TEM-2b|Staphylococcus         MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

ABI81768.1|TEM-2be|Enterobacter          MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

                                           ::::* .:* ::*:: : *.* *: * ::* :*.:*..  * **:** **: * ::*

 

CDN33427.1|SHV2be|Enterobacter           DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

CAJ47127.2|SHV2br|Klebsiella             DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

ACM04459.1|SHV2b|Klebsiella              DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

AFQ23955.1|SHVunknown|Klebsiella         DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL

AFC75524.1|TEMunknown|Acinetobacter      EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSRNDLVEYSPVTEKHLTDGMTVREL

CAA65888.1|TEM-2ber|Serratia             EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

ABM54869.1|TEM-2br|Proteus               EERFPMISTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

AAB39956.1|TEM-2b|Staphylococcus         EERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

ABI81768.1|TEM-2be|Enterobacter          EERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQSDLVEYSPVTEKHLTDGMTVREL

                                         :*****:*****:******:*:***:*** *:*** :.***:****:****:***** **

 

CDN33427.1|SHV2be|Enterobacter           CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTT

CAJ47127.2|SHV2br|Klebsiella             CAAAITMSDNSAANLLLATVGGPVGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTT

ACM04459.1|SHV2b|Klebsiella              CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTT

AFQ23955.1|SHVunknown|Klebsiella         CAAAITMSDNSAANLLLATVGGPAGLTASLRQIGDNVTRLDRWETELNEALPGDARDTTT

AFC75524.1|TEMunknown|Acinetobacter      CSAAITMSDNTAANILLTTIGGPKELTAFLHNMRDHVTRLDRWEPELNEAIPHDERDTTM

CAA65888.1|TEM-2ber|Serratia             CSAAITMSDNTAANLLLTTIGGSQELTAFLHNMGDHVTRLDRWEPELNEAIPNDEADTTM

ABM54869.1|TEM-2br|Proteus               CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTT

AAB39956.1|TEM-2b|Staphylococcus         CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

ABI81768.1|TEM-2be|Enterobacter          CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

                                         *:********:***:**:*:**   *** *::: *:******** *****:* *  ***

 

CDN33427.1|SHV2be|Enterobacter           PASMAAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGASKRG

CAJ47127.2|SHV2br|Klebsiella             PASMA-ATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADRTGAGERG

ACM04459.1|SHV2b|Klebsiella              PASMA-ATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERG

AFQ23955.1|SHVunknown|Klebsiella         PASMA-ATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERG

AFC75524.1|TEMunknown|Acinetobacter      PAPVA-TTLRTLLTVELLTLASRPRLIDWMEADKVAGPILRSALPAGWFIADKSGAGERG

CAA65888.1|TEM-2ber|Serratia             PAAMA-TTLRKLLTGELLTLASRQQLIDWMA-DKVAGPLLRSALPAGWFIADKSGARERG

ABM54869.1|TEM-2br|Proteus               PAAMA-TTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERG

AAB39956.1|TEM-2b|Staphylococcus         PVAMA-TTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERG

ABI81768.1|TEM-2be|Enterobacter          PVAMA-TTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERG

                                         *. :* :***.*** : *:  *: :*::**  *:****::**.*********::** :**

 

CDN33427.1|SHV2be|Enterobacter           ARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR

CAJ47127.2|SHV2br|Klebsiella             ARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR

ACM04459.1|SHV2b|Klebsiella              ARGIVALLGPNNKAERIVVIYLRDMPASMAERNQQIAGIGAALIEHWQR

AFQ23955.1|SHVunknown|Klebsiella         ARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR

AFC75524.1|TEMunknown|Acinetobacter      SRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW--

CAA65888.1|TEM-2ber|Serratia             SRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW--

ABM54869.1|TEM-2br|Proteus               SRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW--

AAB39956.1|TEM-2b|Staphylococcus         SRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW--

ABI81768.1|TEM-2be|Enterobacter          SRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW--

                                         :***:* ***:.* .******  .  *:* ***:*** ***:**:** 

       

 

>AAB39956.1|TEM-2b|Staphylococcus aureus

MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

EERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

PVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

>ABI81768.1|TEM-2be|Enterobacter cloacae

MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

EERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQSDLVEYSPVTEKHLTDGMTVREL

CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM

PVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

>CAA65888.1|TEM-2ber|Serratia marcescens

MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGSTSGYIELDLNSGKILESFRP

EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

CSAAITMSDNTAANLLLTTIGGSQELTAFLHNMGDHVTRLDRWEPELNEAIPNDEADTTM

PAAMATTLRKLLTGELLTLASRQQLIDWMADKVAGPLLRSALPAGWFIADKSGARERGSR

GIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

>ABM54869.1|TEM-2br|Proteus mirabilis

MSIQHFRVALIPFFAAFCFPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

EERFPMISTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL

CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTT

PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

>AFC75524.1|TEMunknown|Acinetobacter baumannii

MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP

EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSRNDLVEYSPVTEKHLTDGMTVREL

CSAAITMSDNTAANILLTTIGGPKELTAFLHNMRDHVTRLDRWEPELNEAIPHDERDTTM

PAPVATTLRTLLTVELLTLASRPRLIDWMEADKVAGPILRSALPAGWFIADKSGAGERGS

RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

>CAJ47127.2|SHV2br|Klebsiella pneumoniae

MRYFRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADE

RFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCA

AAITMSDNSAANLLLATVGGPVGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPA

SMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADRTGAGERGARG

IVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR

>CDN33427.1|SHV2be|Enterobacter cloacae

MRYIRLCIISLLATLPLAVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRADE

RFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCA

AAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPA

SMAAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGASKRGAR

GIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR

>ACM04459.1|SHV2b|Klebsiella pneumoniae

MRYIRRCIISLLATLPLAVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRADE

RFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCA

AAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPA

SMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARG

IVALLGPNNKAERIVVIYLRDMPASMAERNQQIAGIGAALIEHWQR

>AFQ23955.1|SHVunknown|Klebsiella pneumoniae

MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESRLSGSVGMIEMDLASGRTLTAWRADE

RFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCA

AAITMSDNSAANLLLATVGGPAGLTASLRQIGDNVTRLDRWETELNEALPGDARDTTTPA

SMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARG

IVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR