SWISS-MODEL Homology Modelling Report

Model Building Report

This document lists the results for the homology modelling project "Q6ZYM6|Q6ZYM6_SALTM" submitted to SWISS-MODEL workspace on Feb. 22, 2017, 2:43 p.m..The submitted primary amino acid sequence is given in Table T1.

If you use any results in your research, please cite the relevant publications:

Marco Biasini; Stefan Bienert; Andrew Waterhouse; Konstantin Arnold; Gabriel Studer; Tobias Schmidt; Florian Kiefer; Tiziano Gallo Cassarino; Martino Bertoni; Lorenza Bordoli; Torsten Schwede. (2014). SWISS-MODEL: modelling protein tertiary and quaternary structure using evolutionary information. Nucleic Acids Research (1 July 2014) 42 (W1): W252-W258; doi: 10.1093/nar/gku340.
Arnold, K., Bordoli, L., Kopp, J. and Schwede, T. (2006) The SWISS-MODEL workspace: a web-based environment for protein structure homology modelling. Bioinformatics, 22, 195-201.
Benkert, P., Biasini, M. and Schwede, T. (2011) Toward the estimation of the absolute quality of individual protein structure models. Bioinformatics, 27, 343-350

Results

The SWISS-MODEL template library (SMTL version 2017-02-08, PDB release 2017-02-03) was searched with Blast (Altschul et al., 1997) and HHBlits (Remmert, et al., 2011) for evolutionary related structures matching the target sequence in Table T1. For details on the template search, see Materials and Methods. Overall 793 templates were found (Table T2).

Models

The following models were built (see Materials and Methods "Model Building"):

Model #01

FileBuilt withOligo-StateLigandsGMQEQMEAN
PDB ProMod3 Version 1.0.2. MONOMER
None
0.970.46
QMEAN0.46
0.53
All Atom0.89
Solvation0.32
Torsion0.27
TemplateSeq IdentityOligo-stateFound byMethodResolutionSeq SimilarityRangeCoverageDescription
4qy5.1.A93.16monomerBLASTX-ray1.50Å0.57 24 - 286 0.92Beta-lactamase TEM,Beta-lactamase PSE-4
LigandAdded to ModelDescription
CL✕ - Not biologically relevant.
CHLORIDE ION
CL✕ - Not biologically relevant.
CHLORIDE ION
CL✕ - Not biologically relevant.
CHLORIDE ION
CL✕ - Not biologically relevant.
CHLORIDE ION
MG✕ - Not biologically relevant.
MAGNESIUM ION
MG✕ - Not biologically relevant.
MAGNESIUM ION
MG✕ - Not biologically relevant.
MAGNESIUM ION

Target    MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLS
4qy5.1.A -----------------------HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPLTSTFKVLLCGAVLS

Target RVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRL
4qy5.1.A RVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTDFLRQIGDKETRL

Target DRWEPELNEAIPNDERDTTTPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS
4qy5.1.A DRIEPDLNEGKLGDLRDTTTPKAIASTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS

Target RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
4qy5.1.A RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW




Model #02

FileBuilt withOligo-StateLigandsGMQEQMEAN
PDB ProMod3 Version 1.0.2. MONOMER
None
0.74-0.21
QMEAN-0.21
-0.52
All Atom0.07
Solvation0.66
Torsion-0.25
TemplateSeq IdentityOligo-stateFound byMethodResolutionSeq SimilarityRangeCoverageDescription
4dxb.1.A93.95monomerBLASTX-ray2.29Å0.58 23 - 237 0.75Maltose-binding periplasmic protein, Beta-lactamase TEM chimera
LigandAdded to ModelDescription
ZN✕ - Binding site not conserved.
ZINC ION
ZN✕ - Clashing with protein.
ZINC ION

Target    MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLS
4dxb.1.A ----------------------GHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLS

Target RVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRL
4dxb.1.A RIDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRL

Target DRWEPELNEAIPNDERDTTTPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS
4dxb.1.A DRWEPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGSATMENAQKGE---

Target RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
4dxb.1.A ----------------------------------------------




Materials and Methods

Template Search

Template search with Blast and HHBlits has been performed against the SWISS-MODEL template library (SMTL, last update: 2017-02-08, last included PDB release: 2017-02-03).

The target sequence was searched with BLAST (Altschul et al., 1997) against the primary amino acid sequence contained in the SMTL. A total of 206 templates were found.

An initial HHblits profile has been built using the procedure outlined in (Remmert, et al., 2011), followed by 1 iteration of HHblits against NR20. The obtained profile has then be searched against all profiles of the SMTL. A total of 595 templates were found.

Template Selection

For each identified template, the template's quality has been predicted from features of the target-template alignment. The templates with the highest quality have then been selected for model building.

Model Building

Models are built based on the target-template alignment using ProMod3. Coordinates which are conserved between the target and the template are copied from the template to the model. Insertions and deletions are remodelled using a fragment library. Side chains are then rebuilt. Finally, the geometry of the resulting model is regularized by using a force field. In case loop modelling with ProMod3 fails, an alternative model is built with PROMOD-II (Guex, et al., 1997).

Model Quality Estimation

The global and per-residue model quality has been assessed using the QMEAN scoring function (Benkert, et al., 2011) . For improved performance, weights of the individual QMEAN terms have been trained specifically for SWISS-MODEL.

Ligand Modelling

Ligands present in the template structure are transferred by homology to the model when the following criteria are met (Gallo -Casserino, to be published): (a) The ligands are annotated as biologically relevant in the template library, (b) the ligand is in contact with the model, (c) the ligand is not clashing with the protein, (d) the residues in contact with the ligand are conserved between the target and the template. If any of these four criteria is not satisfied, a certain ligand will not be included in the model. The model summary includes information on why and which ligand has not been included.

Oligomeric State Conservation

Homo-oligomeric structure of the target protein is predicted based on the analysis of pairwise interfaces of the identified template structures. For each relevant interface between polypeptide chains (interfaces with more than 10 residue-residue interactions), the QscoreOligomer (Mariani et al., 2011) is predicted from features such as similarity to target and frequency of observing this interface in the identified templates (Kiefer, Bertoni, Biasini, to be published). The prediction is performed with a random forest regressor using these features as input parameters to predict the probability of conservation for each interface. The QscoreOligomer of the whole complex is then calculated as the weight-averaged QscoreOligomer of the interfaces. The oligomeric state of the target is predicted to be the same as in the template when QscoreOligomer is predicted to be higher or equal to 0.5.

References

Altschul, S.F., Madden, T.L., Schaffer, A.A., Zhang, J., Zhang, Z., Miller, W. and Lipman, D.J. (1997) Gapped BLAST and PSI-BLAST: a new generation of protein database search programs. Nucleic Acids Res, 25, 3389-3402.
Remmert, M., Biegert, A., Hauser, A. and Soding, J. (2012) HHblits: lightning-fast iterative protein sequence searching by HMM-HMM alignment. Nat Methods, 9, 173-175.
Guex, N. and Peitsch, M.C. (1997) SWISS-MODEL and the Swiss-PdbViewer: an environment for comparative protein modeling. Electrophoresis, 18, 2714-2723.
Sali, A. and Blundell, T.L. (1993) Comparative protein modelling by satisfaction of spatial restraints. J Mol Biol, 234, 779-815.
Benkert, P., Biasini, M. and Schwede, T. (2011) Toward the estimation of the absolute quality of individual protein structure models. Bioinformatics, 27, 343-350.
Mariani, V., Kiefer, F., Schmidt, T., Haas, J. and Schwede, T. (2011) Assessment of template based protein structure predictions in CASP9. Proteins, 79 Suppl 10, 37-58.

Table T1:

Primary amino acid sequence for which templates were searched and models were built.

MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDL
VEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTTPAAMATTLRKLLTGELLTLA
SRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

Table T2:

TemplateSeq IdentityOligo-stateFound byMethodResolutionSeq SimilarityCoverageDescription
1zg4.1.A98.95monomerHHblitsX-ray1.55Å0.601.00Beta-lactamase TEM
3p98.1.A98.95monomerHHblitsX-ray2.10Å0.601.00Beta-lactamase TEM-72
1zg6.1.A98.60monomerHHblitsX-ray2.10Å0.601.00Beta-lactamase TEM
4zj1.1.A98.60monomerBLASTX-ray1.54Å0.601.00Beta-lactamase TEM
4zj2.1.A98.25monomerBLASTX-ray1.80Å0.601.00Beta-lactamase TEM
4zj3.1.A97.90monomerBLASTX-ray1.70Å0.591.00Beta-lactamase TEM
4zj1.1.A98.60monomerHHblitsX-ray1.54Å0.601.00Beta-lactamase TEM
4zj2.1.A98.25monomerHHblitsX-ray1.80Å0.591.00Beta-lactamase TEM
4zj3.1.A97.89monomerHHblitsX-ray1.70Å0.591.00Beta-lactamase TEM
1m40.1.A100.00monomerBLASTX-ray0.85Å0.600.92BETA-LACTAMASE TEM
1pzo.1.A100.00monomerBLASTX-ray1.90Å0.600.92Beta-lactamase TEM
1li0.1.A99.62monomerBLASTX-ray1.61Å0.600.92Class A beta-Lactamase- TEM-32
1xpb.1.A99.62monomerBLASTX-ray1.90Å0.600.92BETA-LACTAMASE
1s0w.1.A99.62hetero-oligomerBLASTX-ray2.30Å0.600.92beta-lactamase TEM
1esu.1.A99.24monomerBLASTX-ray2.00Å0.600.92BETA-LACTAMASE
1yt4.1.A99.24monomerBLASTX-ray1.40Å0.600.92Beta-lactamase TEM
1jtd.1.A99.24hetero-oligomerBLASTX-ray2.30Å0.600.92TEM-1 beta-lactamase
1li9.1.A99.24monomerBLASTX-ray1.52Å0.600.92Class A beta-Lactamase- TEM-34
1htz.1.A99.24monomerBLASTX-ray2.40Å0.600.92BETA-LACTAMASE MUTANT TEM52
1jwz.1.A99.24monomerBLASTX-ray1.80Å0.600.92Beta-lactamase TEM
1bt5.1.A98.86monomerBLASTX-ray1.80Å0.600.92PROTEIN (BETA-LACTAMASE)
3c7u.1.A98.86hetero-oligomerBLASTX-ray2.20Å0.600.92Beta-lactamase
1fqg.1.A99.24monomerBLASTX-ray1.70Å0.600.92TEM-1 BETA-LACTAMASE
3jyi.1.A99.24monomerHHblitsX-ray2.70Å0.600.92Beta-lactamase TEM
3cmz.1.A99.24monomerBLASTX-ray1.92Å0.600.92Beta-lactamase TEM
1jwv.1.A99.24monomerBLASTX-ray1.85Å0.600.92BETA-LACTAMASE TEM
1lhy.1.A99.24monomerBLASTX-ray2.00Å0.600.92Class A beta-Lactamase- TEM 30
1pzp.1.A99.24monomerBLASTX-ray1.45Å0.600.92Beta-lactamase TEM
1jvj.1.A99.24monomerBLASTX-ray1.73Å0.600.92BETA-LACTAMASE TEM
1m40.1.A100.00monomerHHblitsX-ray0.85Å0.600.92BETA-LACTAMASE TEM
1pzo.1.A100.00monomerHHblitsX-ray1.90Å0.600.92Beta-lactamase TEM
4mez.1.A98.86monomerBLASTX-ray2.05Å0.600.92Beta-lactamase TEM
1ck3.1.A98.48monomerHHblitsX-ray2.28Å0.600.92BETA-LACTAMASE
1xxm.1.A98.48hetero-oligomerBLASTX-ray1.90Å0.600.92Beta-lactamase TEM
1li0.1.A99.62monomerHHblitsX-ray1.61Å0.600.92Class A beta-Lactamase- TEM-32
1xpb.1.A99.62monomerHHblitsX-ray1.90Å0.600.92BETA-LACTAMASE
1s0w.1.A99.62hetero-oligomerHHblitsX-ray2.30Å0.600.92beta-lactamase TEM
2b5r.1.A98.48homo-dimerBLASTX-ray1.65Å0.590.92Beta-lactamase TEM
1esu.1.A99.24monomerHHblitsX-ray2.00Å0.600.92BETA-LACTAMASE
1yt4.1.A99.24monomerHHblitsX-ray1.40Å0.600.92Beta-lactamase TEM
1jtd.1.A99.24hetero-oligomerHHblitsX-ray2.30Å0.600.92TEM-1 beta-lactamase
1jwz.1.A99.24monomerHHblitsX-ray1.80Å0.600.92Beta-lactamase TEM
1htz.1.A99.24monomerHHblitsX-ray2.40Å0.600.92BETA-LACTAMASE MUTANT TEM52
1li9.1.A99.24monomerHHblitsX-ray1.52Å0.600.92Class A beta-Lactamase- TEM-34
4rx2.1.A98.86monomerBLASTX-ray2.32Å0.590.92Beta-lactamase TEM
1bt5.1.A98.85monomerHHblitsX-ray1.80Å0.600.92PROTEIN (BETA-LACTAMASE)
3c7u.1.A98.85hetero-oligomerHHblitsX-ray2.20Å0.600.92Beta-lactamase
1fqg.1.A99.24monomerHHblitsX-ray1.70Å0.600.92TEM-1 BETA-LACTAMASE
1pzp.1.A99.24monomerHHblitsX-ray1.45Å0.600.92Beta-lactamase TEM
3cmz.1.A99.24monomerHHblitsX-ray1.92Å0.600.92Beta-lactamase TEM
1jwv.1.A99.24monomerHHblitsX-ray1.85Å0.600.92BETA-LACTAMASE TEM
1lhy.1.A99.24monomerHHblitsX-ray2.00Å0.600.92Class A beta-Lactamase- TEM 30
1jvj.1.A99.24monomerHHblitsX-ray1.73Å0.600.92BETA-LACTAMASE TEM
4mez.1.A98.85monomerHHblitsX-ray2.05Å0.600.92Beta-lactamase TEM
1xxm.1.A98.47hetero-oligomerHHblitsX-ray1.90Å0.600.92Beta-lactamase TEM
4ibx.1.A97.72monomerBLASTX-ray2.68Å0.590.92Beta-lactamase TEM
4rx3.1.A98.10monomerBLASTX-ray1.39Å0.590.92Beta-lactamase TEM
4rva.1.A98.10monomerBLASTX-ray1.44Å0.590.92Beta-lactamase TEM
2b5r.1.A98.47homo-dimerHHblitsX-ray1.65Å0.590.92Beta-lactamase TEM
3gmw.1.A99.23hetero-oligomerBLASTX-ray2.10Å0.600.91B-lactamase
4op8.1.A97.34monomerBLASTX-ray1.95Å0.590.92TEM-94 ES-beta-lactamase
4op5.1.A97.34monomerBLASTX-ray1.05Å0.590.92Extended spectrum beta-lactamase TEM-63
4oqh.1.A97.34monomerBLASTX-ray1.70Å0.590.92Extended spectrum beta-lactamase TEM-63
4rx2.1.A98.85monomerHHblitsX-ray2.32Å0.590.92Beta-lactamase TEM
3dtm.1.A96.20monomerBLASTX-ray2.00Å0.590.92Beta-lactamase
4ibr.1.A96.96monomerBLASTX-ray2.20Å0.590.92TEM-94 ES-beta-lactamase
4opq.1.A96.96monomerBLASTX-ray1.70Å0.590.92TEM-94 ES-beta-lactamase
4ibx.1.A97.71monomerHHblitsX-ray2.68Å0.590.92Beta-lactamase TEM
4rx3.1.A98.09monomerHHblitsX-ray1.39Å0.590.92Beta-lactamase TEM
3gmw.1.A99.23hetero-oligomerHHblitsX-ray2.10Å0.600.91B-lactamase
4rva.1.A98.09monomerHHblitsX-ray1.44Å0.590.92Beta-lactamase TEM
4op8.1.A97.33monomerHHblitsX-ray1.95Å0.590.92TEM-94 ES-beta-lactamase
4op5.1.A97.33monomerHHblitsX-ray1.05Å0.590.92Extended spectrum beta-lactamase TEM-63
4oqh.1.A97.33monomerHHblitsX-ray1.70Å0.590.92Extended spectrum beta-lactamase TEM-63
3dtm.1.A96.18monomerHHblitsX-ray2.00Å0.590.92Beta-lactamase
4ibr.1.A96.95monomerHHblitsX-ray2.20Å0.590.92TEM-94 ES-beta-lactamase
4opq.1.A96.95monomerHHblitsX-ray1.70Å0.590.92TEM-94 ES-beta-lactamase
2v1z.1.A95.80monomerBLASTX-ray1.60Å0.590.92BETA-LACTAMASE TEM
5aqb.1.A92.86hetero-oligomerBLASTX-ray1.37Å0.570.933G61_DB15V4
2v1z.1.A95.79monomerHHblitsX-ray1.60Å0.590.91BETA-LACTAMASE TEM
4id4.1.A93.92monomerBLASTX-ray1.05Å0.570.92Beta-lactamase TEM, Beta-lactamase PSE-4
4qy5.1.A93.16monomerBLASTX-ray1.50Å0.570.92Beta-lactamase TEM,Beta-lactamase PSE-4
4id4.1.A93.89monomerHHblitsX-ray1.05Å0.570.92Beta-lactamase TEM, Beta-lactamase PSE-4
4qy5.1.A93.13monomerHHblitsX-ray1.50Å0.570.92Beta-lactamase TEM,Beta-lactamase PSE-4
5aq8.1.A93.46monomerBLASTX-ray1.62Å0.580.91OFF7_DB12V4
5aq9.1.A93.08monomerBLASTX-ray1.86Å0.580.91OFF7_DB08V4
5aqb.1.A94.55hetero-oligomerHHblitsX-ray1.37Å0.580.903G61_DB15V4
5aq8.1.A94.16monomerHHblitsX-ray1.62Å0.580.90OFF7_DB12V4
5aq9.1.A93.75monomerHHblitsX-ray1.86Å0.580.90OFF7_DB08V4
5aq7.1.A87.40monomerBLASTX-ray2.10Å0.560.92D12_DB04V3
5aq7.2.A87.40monomerBLASTX-ray2.10Å0.560.92D12_DB04V3
5aqa.1.A87.74monomerBLASTX-ray2.60Å0.560.91OFF7_DB04V3
5aqa.2.A87.74monomerBLASTX-ray2.60Å0.560.91OFF7_DB04V3
3d4f.1.A65.85monomerHHblitsX-ray1.55Å0.490.99Beta-lactamase SHV-1
3opr.1.A65.49monomerHHblitsX-ray1.65Å0.490.99Beta-lactamase SHV-1
3opp.1.A65.49monomerHHblitsX-ray1.80Å0.490.99Beta-lactamase SHV-1
3zdj.1.A80.92monomerBLASTX-ray2.40Å0.540.92ENCA BETA-LACTAMASE
3toi.1.A96.33monomerHHblitsX-ray1.90Å0.590.86Ampicillin resistance protein
3toi.1.A96.33monomerBLASTX-ray1.90Å0.590.86Ampicillin resistance protein
5aq7.1.A89.29monomerHHblitsX-ray2.10Å0.560.88D12_DB04V3
5aq7.2.A89.29monomerHHblitsX-ray2.10Å0.560.88D12_DB04V3
3zdj.1.A80.77monomerHHblitsX-ray2.40Å0.540.91ENCA BETA-LACTAMASE
5aqa.1.A89.64monomerHHblitsX-ray2.60Å0.560.88OFF7_DB04V3
5aqa.2.A89.64monomerHHblitsX-ray2.60Å0.560.88OFF7_DB04V3
3n4i.1.A69.47hetero-oligomerBLASTX-ray1.56Å0.500.92Beta-lactamase SHV-1
2zd8.1.A69.08monomerBLASTX-ray1.05Å0.500.92Beta-lactamase SHV-1
3c4p.1.A69.08hetero-oligomerBLASTX-ray1.75Å0.500.92Beta-lactamase SHV-1
1vm1.1.A69.08monomerBLASTX-ray2.02Å0.500.92BETA-LACTAMASE SHV-1
2g2w.1.A69.08hetero-oligomerBLASTX-ray1.80Å0.500.92Beta-lactamase SHV-1
4fcf.1.A68.70monomerBLASTX-ray1.09Å0.500.92Beta-lactamase SHV-1
1tdg.1.A68.70monomerBLASTX-ray1.80Å0.500.92Beta-lactamase SHV-1
3v5m.1.A68.70monomerBLASTX-ray1.30Å0.500.92Beta-lactamase
4fh2.1.A68.70monomerBLASTX-ray1.44Å0.500.92Beta-lactamase SHV-1
2a3u.1.A68.70monomerBLASTX-ray1.34Å0.500.92Beta-lactamase SHV-1
1n9b.1.A68.70monomerBLASTX-ray0.90Å0.500.92BETA-LACTAMASE SHV-2
2a49.1.A68.70monomerBLASTX-ray1.43Å0.500.92Beta-lactamase SHV-1
1rcj.1.A68.70monomerBLASTX-ray1.63Å0.500.92Beta-lactamase SHV-1
2h10.1.A68.32monomerBLASTX-ray1.75Å0.500.92Beta-lactamase SHV-1
2zd8.1.A69.50monomerHHblitsX-ray1.05Å0.500.91Beta-lactamase SHV-1
3c4p.1.A69.50hetero-oligomerHHblitsX-ray1.75Å0.500.91Beta-lactamase SHV-1
1vm1.1.A69.50monomerHHblitsX-ray2.02Å0.500.91BETA-LACTAMASE SHV-1
2g2w.1.A69.50hetero-oligomerHHblitsX-ray1.80Å0.500.91Beta-lactamase SHV-1
4dxb.1.A80.48monomerHHblitsX-ray2.29Å0.530.88Maltose-binding periplasmic protein, Beta-lactamase TEM chimera
4dxc.1.A80.48monomerHHblitsX-ray2.30Å0.530.88Maltose-binding periplasmic protein, Beta-lactamase TEM chimera
4fcf.1.A69.11monomerHHblitsX-ray1.09Å0.500.91Beta-lactamase SHV-1
1tdg.1.A69.11monomerHHblitsX-ray1.80Å0.500.91Beta-lactamase SHV-1
3v5m.1.A69.11monomerHHblitsX-ray1.30Å0.500.91Beta-lactamase
4fh2.1.A69.11monomerHHblitsX-ray1.44Å0.500.91Beta-lactamase SHV-1
2a3u.1.A69.11monomerHHblitsX-ray1.34Å0.500.91Beta-lactamase SHV-1
1n9b.1.A69.11monomerHHblitsX-ray0.90Å0.500.91BETA-LACTAMASE SHV-2
2a49.1.A69.11monomerHHblitsX-ray1.43Å0.500.91Beta-lactamase SHV-1
3n4i.1.A69.77hetero-oligomerHHblitsX-ray1.56Å0.500.90Beta-lactamase SHV-1
1rcj.1.A68.99monomerHHblitsX-ray1.63Å0.500.90Beta-lactamase SHV-1
2h10.1.A68.60monomerHHblitsX-ray1.75Å0.500.90Beta-lactamase SHV-1
4b88.1.A55.38monomerHHblitsX-ray2.05Å0.450.91BETA-LACTAMASE
5fqm.1.A55.38monomerHHblitsX-ray1.50Å0.450.91GNCA BETA LACTAMASE
4uhu.1.A55.00monomerHHblitsX-ray1.30Å0.450.91GNCA LACTAMASE W229D
5fqi.1.A54.41monomerHHblitsX-ray1.40Å0.440.91GNCA4 LACTAMASE W229D AND F290W
4c75.1.A55.38monomerHHblitsX-ray2.20Å0.440.91BETA-LACTAMASE
5fqq.1.A54.62monomerHHblitsX-ray2.12Å0.440.91GNCA4 LACTAMASE
4c6y.1.A54.23monomerHHblitsX-ray1.80Å0.440.91BETA-LACTAMASE
4c6y.2.A54.23monomerHHblitsX-ray1.80Å0.440.91BETA-LACTAMASE
3dw0.1.A38.21monomerHHblitsX-ray1.60Å0.380.98Class A carbapenemase KPC-2
4uhu.1.A55.86monomerBLASTX-ray1.30Å0.450.90GNCA LACTAMASE W229D
4b88.1.A56.69monomerBLASTX-ray2.05Å0.460.89BETA-LACTAMASE
5fqm.1.A56.69monomerBLASTX-ray1.50Å0.460.89GNCA BETA LACTAMASE
5fqi.1.A55.47monomerBLASTX-ray1.40Å0.450.90GNCA4 LACTAMASE W229D AND F290W
4dxb.1.A93.95monomerBLASTX-ray2.29Å0.580.75Maltose-binding periplasmic protein, Beta-lactamase TEM chimera
4dxc.1.A93.95monomerBLASTX-ray2.30Å0.580.75Maltose-binding periplasmic protein, Beta-lactamase TEM chimera
4qu3.1.A34.16monomerHHblitsX-ray1.40Å0.370.98Beta-lactamase GES-2
3v3r.1.A33.81monomerHHblitsX-ray1.90Å0.360.98Extended spectrum class A beta-lactamase GES-11
3v3s.1.A33.45monomerHHblitsX-ray1.90Å0.360.98Extended spectrum beta-lactamase GES-18
3tsg.1.A33.93monomerHHblitsX-ray1.90Å0.370.98Extended-spectrum beta-lactamase GES-14
4c6y.1.A56.63monomerBLASTX-ray1.80Å0.450.87BETA-LACTAMASE
4c6y.2.A56.63monomerBLASTX-ray1.80Å0.450.87BETA-LACTAMASE
5fqq.1.A57.26monomerBLASTX-ray2.12Å0.450.87GNCA4 LACTAMASE
4c75.1.A59.50monomerBLASTX-ray2.20Å0.460.85BETA-LACTAMASE
1g6a.1.A43.89monomerHHblitsX-ray1.75Å0.400.92BETA-LACTAMASE PSE-4
1g68.1.A43.51monomerHHblitsX-ray1.95Å0.400.92BETA-LACTAMASE PSE-4
1o7e.1.A40.60monomerHHblitsX-ray1.51Å0.380.93L2 BETA LACTAMASE
3v3s.1.A38.49monomerBLASTX-ray1.90Å0.390.93Extended spectrum beta-lactamase GES-18
5f82.1.A38.87monomerBLASTX-ray0.96Å0.390.93Beta-lactamase
5f82.2.A38.87monomerBLASTX-ray0.96Å0.390.93Beta-lactamase
3w4o.1.A41.70monomerHHblitsX-ray1.18Å0.400.91Beta-lactamase
4eqi.1.A40.00monomerHHblitsX-ray1.38Å0.400.91Carbapenem-hydrolizing beta-lactamase SFC-1
4euz.1.A39.62monomerHHblitsX-ray1.08Å0.400.91Carbapenem-hydrolizing beta-lactamase SFC-1
4ev4.1.A39.62monomerHHblitsX-ray1.30Å0.400.91Carbapenem-hydrolizing beta-lactamase SFC-1
5e43.1.A40.93monomerHHblitsX-ray1.71Å0.400.91Beta-lactamase
3byd.1.A39.62monomerHHblitsX-ray1.93Å0.390.91Beta-lactamase OXY-1
1dy6.1.A35.50monomerHHblitsX-ray2.13Å0.390.92CARBAPENEM-HYDROLYSING BETA-LACTAMASE SME-1
5e2e.1.A37.55monomerHHblitsX-ray1.90Å0.390.91Beta-lactamase
5eec.1.A39.62monomerHHblitsX-ray1.87Å0.390.91Carbapenem-hydrolyzing beta-lactamase KPC
3qhy.1.A39.23hetero-oligomerHHblitsX-ray2.06Å0.390.91Beta-lactamase
3w4q.1.A42.58monomerHHblitsX-ray1.20Å0.400.90Beta-lactamase
3c5a.1.A39.77monomerHHblitsX-ray1.23Å0.390.91Class A carbapenemase KPC-2
4ua6.1.A38.08monomerHHblitsX-ray0.79Å0.390.91Beta-lactamase CTX-M-14
2zq8.1.A36.54monomerHHblitsX-ray1.03Å0.380.91Beta-lactamase Toho-1
4pm9.1.A38.08monomerHHblitsX-ray1.45Å0.380.91Beta-lactamase CTX-M-14
3g32.1.A38.08monomerHHblitsX-ray1.31Å0.380.91Beta-lactamase CTX-M-9a
3g32.2.A38.08monomerHHblitsX-ray1.31Å0.380.91Beta-lactamase CTX-M-9a
3g2y.1.A38.08monomerHHblitsX-ray1.31Å0.380.91Beta-lactamase CTX-M-9a
1bul.1.A35.00monomerHHblitsX-ray1.89Å0.380.91NMC-A BETA-LACTAMASE
5fa7.1.A37.31monomerHHblitsX-ray1.67Å0.380.91Beta-lactamase
4xuz.1.A37.31monomerHHblitsX-ray1.50Å0.380.91Beta-lactamase
1g6a.1.A45.63monomerBLASTX-ray1.75Å0.410.88BETA-LACTAMASE PSE-4
4x69.1.A36.15monomerHHblitsX-ray1.42Å0.380.91Beta-lactamase Toho-1
2zq7.1.A36.15monomerHHblitsX-ray0.94Å0.380.91Beta-lactamase Toho-1
1iys.1.A36.15monomerHHblitsX-ray1.65Å0.380.91BETA-LACTAMASE TOHO-1
3zny.1.A37.31monomerHHblitsX-ray1.20Å0.380.91CTX-M-12A ENZYME
1bsg.1.A38.61monomerHHblitsX-ray1.85Å0.390.91BETA LACTAMASE
1ylt.1.A38.22monomerHHblitsX-ray1.10Å0.390.91beta-lactamase CTX-M-14
4pm7.1.A38.22monomerHHblitsX-ray1.29Å0.390.91Beta-lactamase CTX-M-14
1g68.1.A45.24monomerBLASTX-ray1.95Å0.410.88BETA-LACTAMASE PSE-4
3e2k.1.A40.08hetero-oligomerHHblitsX-ray2.10Å0.390.90Carbapenemase
2ov5.1.A40.08monomerHHblitsX-ray1.85Å0.390.90Carbapenemase
2xqz.1.A36.68monomerHHblitsneutron diff.2.10Å0.390.91BETA-LACTAMSE TOHO-1
4bd0.1.A36.68monomerHHblitsX-ray1.21Å0.390.91BETA-LACTAMASE TOHO-1
4pma.1.A38.22monomerHHblitsX-ray1.40Å0.390.91Beta-lactamase CTX-M-14
1ylp.1.A38.22monomerHHblitsX-ray1.20Å0.390.91beta-lactamase CTX-M-27
1w7f.1.A37.45monomerHHblitsX-ray1.80Å0.390.91BETA-LACTAMASE
4pm5.1.A37.84monomerHHblitsX-ray1.26Å0.390.91Beta-lactamase CTX-M-14
1i2w.1.A37.45homo-dimerHHblitsX-ray1.70Å0.390.91BETA-LACTAMASE
3bfe.1.A39.00monomerHHblitsX-ray2.40Å0.390.91Class A beta-lactamase Sed1
1bza.1.A35.77monomerHHblitsX-ray1.80Å0.380.91BETA-LACTAMASE
4xxr.1.A37.84monomerHHblitsX-ray1.18Å0.380.91CTX-M-14 Class A Beta-Lactamase
4yfm.1.A37.74monomerHHblitsX-ray1.40Å0.390.90Beta-lactamase
3huo.1.A37.84monomerHHblitsX-ray1.50Å0.380.91CTX-M-9 extended-spectrum beta-lactamase
3hvf.2.A37.84monomerHHblitsX-ray1.50Å0.380.91CTX-M-9 extended-spectrum beta-lactamase
1ylw.1.A38.22monomerHHblitsX-ray1.74Å0.380.91CTX-M-16 beta-lactamase
1we4.1.A35.77monomerHHblitsX-ray1.70Å0.380.91Beta-lactamase Toho-1
5ksc.1.A36.29monomerHHblitsneutron diff.2.10Å0.380.91Beta-lactamase Toho-1
3e2l.1.A39.69hetero-oligomerHHblitsX-ray1.87Å0.390.90Carbapenemase
4hbt.1.A37.45monomerHHblitsX-ray1.10Å0.380.91Beta-lactamase
3b3x.1.A37.60homo-dimerHHblitsX-ray2.50Å0.390.90Beta-lactamase
1hzo.1.A37.16monomerHHblitsX-ray1.75Å0.380.91BETA-LACTAMASE
3bfd.1.A38.61monomerHHblitsX-ray2.00Å0.380.91Class A beta-lactamase Sed1
3bff.1.A38.61monomerHHblitsX-ray1.90Å0.380.91Class A beta-lactamase Sed1
5eoo.1.A37.69monomerHHblitsX-ray1.48Å0.380.91Beta-lactamase
5eoo.4.A37.69monomerHHblitsX-ray1.48Å0.380.91Beta-lactamase
4blm.1.A36.68monomerHHblitsX-ray2.00Å0.380.91BETA-LACTAMASE
5ghx.1.A36.29monomerHHblitsX-ray1.24Å0.380.91Beta-lactamase
4n92.1.A36.29homo-dimerHHblitsX-ray1.93Å0.380.91Beta-lactamase
5f82.1.A35.63monomerHHblitsX-ray0.96Å0.370.91Beta-lactamase
5f82.2.A35.63monomerHHblitsX-ray0.96Å0.370.91Beta-lactamase
5eoe.1.A37.84monomerHHblitsX-ray1.60Å0.380.91Beta-lactamase
3sh7.1.A36.29monomerHHblitsX-ray2.50Å0.380.91Beta-lactamase
3sh9.2.A36.29monomerHHblitsX-ray1.90Å0.380.91Beta-lactamase
4gnu.1.A35.77monomerHHblitsX-ray1.09Å0.380.91Beta-lactamase GES-5
5hw3.1.A39.06monomerHHblitsX-ray1.45Å0.390.90Beta-lactamase
5hx9.1.A37.07monomerHHblitsX-ray1.80Å0.380.91Beta-lactamase
3ni9.1.A36.29monomerHHblitsX-ray2.00Å0.380.91Beta-lactamase GES-2
5eoe.1.A39.37monomerBLASTX-ray1.60Å0.390.89Beta-lactamase
5eoo.1.A39.37monomerBLASTX-ray1.48Å0.390.89Beta-lactamase
5eoo.4.A39.37monomerBLASTX-ray1.48Å0.390.89Beta-lactamase
3lez.1.A38.28monomerHHblitsX-ray1.25Å0.380.90Beta-lactamase
5e43.1.A42.57monomerBLASTX-ray1.71Å0.410.87Beta-lactamase
3w4o.1.A43.72monomerBLASTX-ray1.18Å0.410.86Beta-lactamase
2qpn.1.A35.91monomerHHblitsX-ray1.10Å0.380.91Beta-lactamase GES-1
4m3k.1.A36.58hetero-oligomerHHblitsX-ray1.48Å0.380.90Beta-lactamase
4n1h.2.A36.58hetero-oligomerHHblitsX-ray3.00Å0.380.90Beta-lactamase
5f83.1.A35.91monomerHHblitsX-ray1.38Å0.380.91Beta-lactamase
2cc1.1.A39.69monomerHHblitsX-ray2.13Å0.380.90BETA-LACTAMASE
2wyx.1.A36.86monomerHHblitsneutron diff.2.10Å0.390.89BETA-LACTAMSE TOHO-1
3zny.1.A40.24monomerBLASTX-ray1.20Å0.400.88CTX-M-12A ENZYME
5ihv.1.A36.58monomerHHblitsX-ray1.10Å0.380.90Beta-lactamase
3m2j.1.A36.47monomerHHblitsX-ray1.80Å0.380.89Beta-lactamase
3ly4.1.A36.47monomerHHblitsX-ray1.80Å0.380.89Beta-lactamase
3ly3.1.A36.47monomerHHblitsX-ray1.80Å0.380.89Beta-lactamase
1iys.1.A40.32monomerBLASTX-ray1.65Å0.400.87BETA-LACTAMASE TOHO-1
4x69.1.A40.32monomerBLASTX-ray1.42Å0.400.87Beta-lactamase Toho-1
3zhh.1.A35.52monomerHHblitsX-ray2.85Å0.370.91BETA-LACTAMASE
2xqz.1.A39.92monomerBLASTneutron diff.2.10Å0.400.87BETA-LACTAMSE TOHO-1
4bd0.1.A39.92monomerBLASTX-ray1.21Å0.400.87BETA-LACTAMASE TOHO-1
2zq8.1.A39.92monomerBLASTX-ray1.03Å0.400.87Beta-lactamase Toho-1
3soi.1.A35.94monomerHHblitsX-ray1.73Å0.380.90Beta-lactamase
1mbl.1.A36.61monomerHHblitsX-ray2.00Å0.380.89BETA-LACTAMASE
1bza.1.A39.92monomerBLASTX-ray1.80Å0.400.87BETA-LACTAMASE
5ksc.1.A39.52monomerBLASTneutron diff.2.10Å0.400.87Beta-lactamase Toho-1
2zq7.1.A39.52monomerBLASTX-ray0.94Å0.400.87Beta-lactamase Toho-1
1we4.1.A39.92monomerBLASTX-ray1.70Å0.400.87Beta-lactamase Toho-1
4qb8.1.A35.27monomerHHblitsX-ray1.76Å0.370.90Beta-lactamase
3vff.1.A35.27monomerHHblitsX-ray2.78Å0.370.90Beta-lactamase
3byd.1.A42.45monomerBLASTX-ray1.93Å0.410.86Beta-lactamase OXY-1
4jlf.1.A35.80monomerHHblitsX-ray2.10Å0.370.90Beta-lactamase
4qhc.1.A35.80monomerHHblitsX-ray1.90Å0.370.90Beta-lactamase
3dwz.1.A35.80monomerHHblitsX-ray1.80Å0.370.90Beta-lactamase
2gdn.1.A35.80monomerHHblitsX-ray1.72Å0.370.90Beta-lactamase
3ndg.1.A35.41monomerHHblitsX-ray1.90Å0.370.90Beta-lactamase
3ny4.1.A35.41monomerHHblitsX-ray1.22Å0.370.90Beta-lactamase
5hw3.1.A40.89monomerBLASTX-ray1.45Å0.400.86Beta-lactamase
1dy6.1.A37.25monomerBLASTX-ray2.13Å0.400.86CARBAPENEM-HYDROLYSING BETA-LACTAMASE SME-1
4x6t.1.A35.55monomerHHblitsX-ray1.40Å0.370.90Beta-lactamase
3w4q.1.A45.23monomerBLASTX-ray1.20Å0.410.84Beta-lactamase
1blc.1.A33.33homo-dimerHHblitsX-ray2.20Å0.370.89BETA-LACTAMASE
3blm.1.A33.33monomerHHblitsX-ray2.00Å0.370.89BETA-LACTAMASE
1pio.1.A33.33homo-dimerHHblitsX-ray2.80Å0.370.89BETA-LACTAMASE
1pio.1.B33.33homo-dimerHHblitsX-ray2.80Å0.370.89BETA-LACTAMASE
3lez.1.A42.45monomerBLASTX-ray1.25Å0.400.86Beta-lactamase
3qhy.1.A41.06hetero-oligomerBLASTX-ray2.06Å0.400.86Beta-lactamase
1ome.1.A33.33homo-dimerHHblitsX-ray2.30Å0.370.89BETA-LACTAMASE
1ome.1.B33.33homo-dimerHHblitsX-ray2.30Å0.370.89BETA-LACTAMASE
1djc.1.A32.94homo-dimerHHblitsX-ray2.00Å0.370.89BETA-LACTAMASE
1djb.1.A32.94monomerHHblitsX-ray2.10Å0.370.89BETA-LACTAMASE
1blp.1.A32.94monomerHHblitsX-ray2.30Å0.370.89BETA-LACTAMASE
3p09.1.A28.08monomerBLASTX-ray1.90Å0.350.91Beta-lactamase
4ua6.1.A40.82monomerBLASTX-ray0.79Å0.400.86Beta-lactamase CTX-M-14
1kgf.1.A32.94monomerHHblitsX-ray2.20Å0.370.89BETA-LACTAMASE
4pm7.1.A40.82monomerBLASTX-ray1.29Å0.400.86Beta-lactamase CTX-M-14
1dja.1.A32.94monomerHHblitsX-ray1.90Å0.370.89BETA-LACTAMASE
3g2y.1.A40.82monomerBLASTX-ray1.31Å0.400.86Beta-lactamase CTX-M-9a
3g32.1.A40.82monomerBLASTX-ray1.31Å0.400.86Beta-lactamase CTX-M-9a
3g32.2.A40.82monomerBLASTX-ray1.31Å0.400.86Beta-lactamase CTX-M-9a
1kgg.1.A32.55monomerHHblitsX-ray2.30Å0.370.89PROTEIN (BETA-LACTAMASE)
1kge.1.A32.94monomerHHblitsX-ray2.00Å0.370.89BETA-LACTAMASE
1ghm.1.A32.55monomerHHblitsX-ray1.86Å0.370.89BETA-LACTAMASE
1ghi.1.A32.55monomerHHblitsX-ray2.30Å0.370.89BETA-LACTAMASE
4xxr.1.A40.41monomerBLASTX-ray1.18Å0.400.86CTX-M-14 Class A Beta-Lactamase
5fa7.1.A40.41monomerBLASTX-ray1.67Å0.400.86Beta-lactamase
4xuz.1.A40.41monomerBLASTX-ray1.50Å0.400.86Beta-lactamase
1bul.1.A36.44monomerBLASTX-ray1.89Å0.390.86NMC-A BETA-LACTAMASE
3huo.1.A40.41monomerBLASTX-ray1.50Å0.400.86CTX-M-9 extended-spectrum beta-lactamase
3hvf.2.A40.41monomerBLASTX-ray1.50Å0.400.86CTX-M-9 extended-spectrum beta-lactamase
1o7e.1.A43.44monomerBLASTX-ray1.51Å0.400.85L2 BETA LACTAMASE
3p09.1.A25.38monomerHHblitsX-ray1.90Å0.340.92Beta-lactamase
1blc.1.A35.06homo-dimerBLASTX-ray2.20Å0.370.88BETA-LACTAMASE
3blm.1.A35.06monomerBLASTX-ray2.00Å0.370.88BETA-LACTAMASE
1pio.1.A34.66homo-dimerBLASTX-ray2.80Å0.370.88BETA-LACTAMASE
1pio.1.B34.66homo-dimerBLASTX-ray2.80Å0.370.88BETA-LACTAMASE
1ome.1.A35.06homo-dimerBLASTX-ray2.30Å0.370.88BETA-LACTAMASE
1ome.1.B35.06homo-dimerBLASTX-ray2.30Å0.370.88BETA-LACTAMASE
1blp.1.A34.66monomerBLASTX-ray2.30Å0.370.88BETA-LACTAMASE
1kgf.1.A34.66monomerBLASTX-ray2.20Å0.370.88BETA-LACTAMASE
1djc.1.A34.66homo-dimerBLASTX-ray2.00Å0.370.88BETA-LACTAMASE
1djb.1.A34.66monomerBLASTX-ray2.10Å0.370.88BETA-LACTAMASE
1kge.1.A34.66monomerBLASTX-ray2.00Å0.370.88BETA-LACTAMASE
1dja.1.A34.66monomerBLASTX-ray1.90Å0.370.88BETA-LACTAMASE
1kgg.1.A34.26monomerBLASTX-ray2.30Å0.370.88PROTEIN (BETA-LACTAMASE)
1ghm.1.A34.26monomerBLASTX-ray1.86Å0.370.88BETA-LACTAMASE
1ghi.1.A34.26monomerBLASTX-ray2.30Å0.370.88BETA-LACTAMASE
3ni9.1.A39.51monomerBLASTX-ray2.00Å0.390.85Beta-lactamase GES-2
4qu3.1.A39.51monomerBLASTX-ray1.40Å0.390.85Beta-lactamase GES-2
3tsg.1.A39.09monomerBLASTX-ray1.90Å0.390.85Extended-spectrum beta-lactamase GES-14
1ylt.1.A41.25monomerBLASTX-ray1.10Å0.400.84beta-lactamase CTX-M-14
4gnu.1.A39.09monomerBLASTX-ray1.09Å0.390.85Beta-lactamase GES-5
3v3r.1.A39.09monomerBLASTX-ray1.90Å0.390.85Extended spectrum class A beta-lactamase GES-11
4pma.1.A41.25monomerBLASTX-ray1.40Å0.400.84Beta-lactamase CTX-M-14
4pm9.1.A41.25monomerBLASTX-ray1.45Å0.400.84Beta-lactamase CTX-M-14
2qpn.1.A39.09monomerBLASTX-ray1.10Å0.390.85Beta-lactamase GES-1
5f83.1.A39.09monomerBLASTX-ray1.38Å0.390.85Beta-lactamase
1ylp.1.A41.25monomerBLASTX-ray1.20Å0.400.84beta-lactamase CTX-M-27
4pm5.1.A40.83monomerBLASTX-ray1.26Å0.400.84Beta-lactamase CTX-M-14
2wyx.1.A40.00monomerBLASTneutron diff.2.10Å0.400.84BETA-LACTAMSE TOHO-1
4hbt.1.A40.83monomerBLASTX-ray1.10Å0.400.84Beta-lactamase
1ylw.1.A41.25monomerBLASTX-ray1.74Å0.400.84CTX-M-16 beta-lactamase
4eqi.1.A43.83monomerBLASTX-ray1.38Å0.420.82Carbapenem-hydrolizing beta-lactamase SFC-1
4euz.1.A43.40monomerBLASTX-ray1.08Å0.410.82Carbapenem-hydrolizing beta-lactamase SFC-1
4ev4.1.A43.40monomerBLASTX-ray1.30Å0.410.82Carbapenem-hydrolizing beta-lactamase SFC-1
3bfe.1.A42.74monomerBLASTX-ray2.40Å0.400.82Class A beta-lactamase Sed1
3bff.1.A42.31monomerBLASTX-ray1.90Å0.400.82Class A beta-lactamase Sed1
4d2o.1.A23.37monomerHHblitsX-ray2.20Å0.320.91PER-2 BETA-LACTAMASE
4d2o.2.A23.37monomerHHblitsX-ray2.20Å0.320.91PER-2 BETA-LACTAMASE
1e25.1.A22.31monomerHHblitsX-ray1.90Å0.310.91EXTENDED-SPECTRUM BETA-LACTAMASE PER-1
3e2k.1.A45.13hetero-oligomerBLASTX-ray2.10Å0.420.79Carbapenemase
5e2e.1.A44.89monomerBLASTX-ray1.90Å0.420.79Beta-lactamase
2ov5.1.A45.13monomerBLASTX-ray1.85Å0.420.79Carbapenemase
5eec.1.A45.13monomerBLASTX-ray1.87Å0.420.79Carbapenem-hydrolyzing beta-lactamase KPC
3c5a.1.A45.13monomerBLASTX-ray1.23Å0.420.79Class A carbapenemase KPC-2
3dw0.1.A45.13monomerBLASTX-ray1.60Å0.420.79Class A carbapenemase KPC-2
3e2l.1.A44.69hetero-oligomerBLASTX-ray1.87Å0.410.79Carbapenemase
3bfd.1.A42.79monomerBLASTX-ray2.00Å0.400.80Class A beta-lactamase Sed1
1alq.1.A34.45monomerHHblitsX-ray1.80Å0.370.83CP254 BETA-LACTAMASE
1bsg.1.A42.92monomerBLASTX-ray1.85Å0.410.79BETA LACTAMASE
5tfq.1.A20.08monomerHHblitsX-ray1.07Å0.300.91Beta-lactamase
4yfm.1.A41.96monomerBLASTX-ray1.40Å0.410.78Beta-lactamase
2cc1.1.A49.54monomerBLASTX-ray2.13Å0.430.76BETA-LACTAMASE
3b3x.1.A43.24homo-dimerBLASTX-ray2.50Å0.410.78Beta-lactamase
1i2w.1.A43.24homo-dimerBLASTX-ray1.70Å0.410.78BETA-LACTAMASE
1w7f.1.A43.24monomerBLASTX-ray1.80Å0.410.78BETA-LACTAMASE
4m3k.1.A42.79hetero-oligomerBLASTX-ray1.48Å0.410.78Beta-lactamase
4n1h.2.A42.79hetero-oligomerBLASTX-ray3.00Å0.410.78Beta-lactamase
4blm.1.A42.34monomerBLASTX-ray2.00Å0.410.78BETA-LACTAMASE
3vff.1.A41.15monomerBLASTX-ray2.78Å0.390.79Beta-lactamase
3ny4.1.A41.15monomerBLASTX-ray1.22Å0.390.79Beta-lactamase
4n92.1.A41.89homo-dimerBLASTX-ray1.93Å0.410.78Beta-lactamase
5ghx.1.A41.89monomerBLASTX-ray1.24Å0.410.78Beta-lactamase
1mbl.1.A41.89monomerBLASTX-ray2.00Å0.410.78BETA-LACTAMASE
4ewf.1.A22.62monomerHHblitsX-ray2.00Å0.310.88Beta-lactamase
3m2j.1.A41.89monomerBLASTX-ray1.80Å0.410.78Beta-lactamase
3ly4.1.A41.89monomerBLASTX-ray1.80Å0.410.78Beta-lactamase
3ly3.1.A41.89monomerBLASTX-ray1.80Å0.410.78Beta-lactamase
3sh7.1.A41.89monomerBLASTX-ray2.50Å0.410.78Beta-lactamase
3sh9.2.A41.89monomerBLASTX-ray1.90Å0.410.78Beta-lactamase
2j7v.1.A22.31monomerHHblitsX-ray1.90Å0.310.88TLL2115 PROTEIN
2j8y.3.A22.31monomerHHblitsX-ray1.90Å0.310.88TLL2115 PROTEIN
3soi.1.A41.44monomerBLASTX-ray1.73Å0.400.78Beta-lactamase
2jbf.1.A22.80monomerHHblitsX-ray1.70Å0.310.87TLL2115 PROTEIN
2jbf.3.A22.80monomerHHblitsX-ray1.70Å0.310.87TLL2115 PROTEIN
2wuq.1.A18.68homo-dimerHHblitsX-ray1.80Å0.280.90BETA-LACTAMASE REGULATORY PROTEIN BLAB
4jlf.1.A42.53monomerBLASTX-ray2.10Å0.400.77Beta-lactamase
2gdn.1.A42.53monomerBLASTX-ray1.72Å0.400.77Beta-lactamase
3zhh.1.A42.53monomerBLASTX-ray2.85Å0.400.77BETA-LACTAMASE
4qhc.1.A42.53monomerBLASTX-ray1.90Å0.400.77Beta-lactamase
3dwz.1.A42.53monomerBLASTX-ray1.80Å0.400.77Beta-lactamase
1hzo.1.A42.08monomerBLASTX-ray1.75Å0.400.77BETA-LACTAMASE
3ndg.1.A42.08monomerBLASTX-ray1.90Å0.400.77Beta-lactamase
4qb8.1.A42.08monomerBLASTX-ray1.76Å0.400.77Beta-lactamase
4x6t.1.A42.08monomerBLASTX-ray1.40Å0.400.77Beta-lactamase
5ihv.1.A42.79monomerBLASTX-ray1.10Å0.410.75Beta-lactamase
4hes.1.A15.87homo-dimerHHblitsX-ray1.90Å0.280.88Beta-lactamase class A-like protein
2xep.1.A19.68monomerHHblitsX-ray1.50Å0.280.87ORF12
2xgn.1.A20.08monomerHHblitsX-ray1.70Å0.280.87ORF12
1sde.1.A16.53monomerHHblitsX-ray1.15Å0.280.87D-alanyl-D-alanine carboxypeptidase
2xfs.1.A18.88monomerHHblitsX-ray1.80Å0.280.87ORF12
1xp4.2.A18.11monomerHHblitsX-ray2.80Å0.290.85D-alanyl-D-alanine carboxypeptidase
1xp4.1.A18.11monomerHHblitsX-ray2.80Å0.290.85D-alanyl-D-alanine carboxypeptidase
1xp4.3.A18.11monomerHHblitsX-ray2.80Å0.290.85D-alanyl-D-alanine carboxypeptidase
1mpl.1.A15.79monomerHHblitsX-ray1.12Å0.280.86D-alanyl-D-alanine carboxypeptidase
3cjm.1.A22.27monomerHHblitsX-ray1.50Å0.300.83Putative beta-lactamase
1alq.1.A36.45monomerBLASTX-ray1.80Å0.380.75CP254 BETA-LACTAMASE
5tr7.1.A17.23monomerHHblitsX-ray2.05Å0.290.83D-alanyl-D-alanine carboxypeptidase
3a3j.1.A16.81monomerHHblitsX-ray2.15Å0.280.83PBP5
5tfq.1.A26.03monomerBLASTX-ray1.07Å0.330.77Beta-lactamase
5e31.1.A15.15monomerHHblitsX-ray2.30Å0.270.81Penicillin binding protein 2 prime
3vsk.1.A14.96homo-dimerHHblitsX-ray2.30Å0.260.82Penicillin-binding protein 3
3vsk.1.B14.96homo-dimerHHblitsX-ray2.30Å0.260.82Penicillin-binding protein 3
3vsl.1.B14.96homo-dimerHHblitsX-ray2.40Å0.260.82Penicillin-binding protein 3
5dvy.1.A14.72homo-dimerHHblitsX-ray2.95Å0.270.81Penicillin binding protein 2 prime
1e25.1.A30.43monomerBLASTX-ray1.90Å0.360.72EXTENDED-SPECTRUM BETA-LACTAMASE PER-1
5hx9.1.A45.03monomerBLASTX-ray1.80Å0.410.67Beta-lactamase
4k91.1.A20.55monomerHHblitsX-ray2.05Å0.300.77D-ala-D-ala-carboxypeptidase
4k91.2.A20.55monomerHHblitsX-ray2.05Å0.300.77D-ala-D-ala-carboxypeptidase
4ied.1.A16.74monomerHHblitsX-ray1.50Å0.270.79Class D beta-lactamase
1tvf.1.A15.56monomerHHblitsX-ray2.00Å0.280.79penicillin binding protein 4
1skf.1.A20.09monomerHHblitsX-ray2.00Å0.300.77D-ALANYL-D-ALANINE TRANSPEPTIDASE
3hun.1.A15.63monomerHHblitsX-ray2.00Å0.280.78Penicillin-binding protein 4
3ita.1.A17.57monomerHHblitsX-ray1.80Å0.290.78D-alanyl-D-alanine carboxypeptidase dacC
3ita.2.A17.57monomerHHblitsX-ray1.80Å0.290.78D-alanyl-D-alanine carboxypeptidase dacC
3ita.3.A17.57monomerHHblitsX-ray1.80Å0.290.78D-alanyl-D-alanine carboxypeptidase dacC
3ita.4.A17.57monomerHHblitsX-ray1.80Å0.290.78D-alanyl-D-alanine carboxypeptidase dacC
3it9.3.A17.57monomerHHblitsX-ray2.10Å0.290.78D-alanyl-D-alanine carboxypeptidase dacC
1es4.1.A20.09monomerHHblitsX-ray1.90Å0.300.77DD-TRANSPEPTIDASE
1es3.1.A19.63monomerHHblitsX-ray2.20Å0.300.77DD-TRANSPEPTIDASE
1esi.1.A20.09monomerHHblitsX-ray1.80Å0.290.77DD-TRANSPEPTIDASE
1es5.1.A20.09monomerHHblitsX-ray1.40Å0.290.77DD-TRANSPEPTIDASE
1es2.1.A19.18monomerHHblitsX-ray1.55Å0.290.77DD-TRANSPEPTIDASE
1nrf.1.A16.14monomerHHblitsX-ray2.50Å0.280.78REGULATORY PROTEIN BLAR1
5fsr.1.A17.19monomerHHblitsX-ray2.40Å0.290.77D-ALANYL-D-ALANINE CARBOXYPEPTIDASE DACD
1j9m.1.A19.18monomerHHblitsX-ray1.65Å0.290.77DD-transpeptidase
5j8x.1.A15.70monomerHHblitsX-ray2.53Å0.280.78D-alanyl-D-alanine carboxypeptidase DacA
4d2o.1.A32.16monomerBLASTX-ray2.20Å0.360.70PER-2 BETA-LACTAMASE
4d2o.2.A32.16monomerBLASTX-ray2.20Å0.360.70PER-2 BETA-LACTAMASE
1z6f.1.A15.77monomerHHblitsX-ray1.60Å0.280.78Penicillin-binding protein 5
3bec.1.A15.77monomerHHblitsX-ray1.60Å0.280.78Penicillin-binding protein 5
1nzu.1.A15.77monomerHHblitsX-ray2.00Å0.280.78Penicillin-binding protein 5
5kzh.1.A13.54monomerHHblitsX-ray1.61Å0.250.80Beta-lactamase
1sdn.1.A15.77monomerHHblitsX-ray2.50Å0.280.78Penicillin-binding protein 5
1hd8.1.A15.77monomerHHblitsX-ray2.30Å0.280.78PENICILLIN-BINDING PROTEIN 5
1nj4.1.A15.77monomerHHblitsX-ray1.90Å0.280.78Penicillin-binding protein 5
1k38.1.A16.07homo-dimerHHblitsX-ray1.50Å0.270.78Beta-lactamase OXA-2
4oh0.1.A13.72monomerHHblitsX-ray1.30Å0.260.79Beta-lactamase OXA-58
4z9q.1.A13.72monomerHHblitsX-ray2.23Å0.260.79Beta-lactamase OXA-58
4ppr.1.A18.43monomerHHblitsX-ray2.00Å0.290.76Penicillin-binding protein DacB1
3if6.1.A15.70homo-dimerHHblitsX-ray2.40Å0.270.78OXA-46 oxacillinase
3if6.2.A15.70homo-dimerHHblitsX-ray2.40Å0.270.78OXA-46 oxacillinase
3if6.2.B15.70homo-dimerHHblitsX-ray2.40Å0.270.78OXA-46 oxacillinase
5tg4.1.A13.72monomerHHblitsX-ray1.44Å0.260.79Beta-lactamase
4x53.1.A13.27monomerHHblitsX-ray2.30Å0.260.79Class D beta-lactamase OXA-160
3eqv.1.A19.07monomerHHblitsX-ray2.40Å0.300.75Penicillin-binding protein 2
3eqv.2.A19.07monomerHHblitsX-ray2.40Å0.300.75Penicillin-binding protein 2
3pag.1.A13.27monomerHHblitsX-ray2.25Å0.260.79Beta-lactamase
4n1x.1.A18.52monomerHHblitsX-ray2.00Å0.290.76Peptidoglycan glycosyltransferase
4jbf.1.A18.52monomerHHblitsX-ray1.92Å0.290.76Peptidoglycan glycosyltransferase
4r3j.2.A18.52monomerHHblitsX-ray2.44Å0.290.76Peptidoglycan glycosyltransferase
3ue3.1.A16.74monomerHHblitsX-ray2.30Å0.290.75Septum formation, penicillin binding protein 3, peptidoglycan synthetase
5tg5.1.A13.27monomerHHblitsX-ray1.75Å0.250.79Beta-lactamase
4x55.1.A10.92monomerHHblitsX-ray1.94Å0.240.80Beta-lactamase OXA-225
3znt.1.A13.33monomerHHblitsX-ray1.95Å0.260.79BETA-LACTAMASE
5tg6.1.A13.27monomerHHblitsX-ray1.78Å0.250.79Beta-lactamase
5fi2.1.A12.61homo-tetramerHHblitsX-ray2.50Å0.270.78Glutaminase kidney isoform, mitochondrial
5fi2.1.C12.61homo-tetramerHHblitsX-ray2.50Å0.270.78Glutaminase kidney isoform, mitochondrial
5fi7.1.A12.61homo-tetramerHHblitsX-ray2.50Å0.270.78Glutaminase kidney isoform, mitochondrial
5hl1.1.C12.61homo-tetramerHHblitsX-ray2.40Å0.270.78Glutaminase kidney isoform, mitochondrial
3uo9.1.A12.61homo-tetramerHHblitsX-ray2.30Å0.270.78Glutaminase kidney isoform, mitochondrial
1m6k.1.A14.55homo-dimerHHblitsX-ray1.50Å0.270.77beta-lactamase OXA-1
4drt.1.A13.96monomerHHblitsX-ray2.00Å0.270.78de novo designed serine hydrolase, OR89
5i94.1.A12.61homo-tetramerHHblitsX-ray2.98Å0.270.78Glutaminase kidney isoform, mitochondrial
5d3o.1.A12.61homo-tetramerHHblitsX-ray2.79Å0.270.78Glutaminase kidney isoform, mitochondrial
3ss4.1.A12.61homo-tetramerHHblitsX-ray2.85Å0.270.78Glutaminase C
3ss3.1.B12.61homo-tetramerHHblitsX-ray2.42Å0.270.78Glutaminase C
4jkt.1.C12.61homo-tetramerHHblitsX-ray2.77Å0.270.78Glutaminase kidney isoform, mitochondrial
4jkt.1.D12.61homo-tetramerHHblitsX-ray2.77Å0.270.78Glutaminase kidney isoform, mitochondrial
5fat.1.A13.27homo-dimerHHblitsX-ray2.09Å0.250.79Beta-lactamase
2rl3.1.A9.25homo-dimerHHblitsX-ray1.90Å0.250.79Beta-lactamase PSE-2
2rl3.1.B9.25homo-dimerHHblitsX-ray1.90Å0.250.79Beta-lactamase PSE-2
4mll.1.A14.09monomerHHblitsX-ray1.37Å0.270.77Beta-lactamase OXA-1
1k54.1.A9.25homo-dimerHHblitsX-ray1.70Å0.250.79Beta lactamase OXA-10
1k57.2.B9.25homo-dimerHHblitsX-ray1.90Å0.250.79BETA LACTAMASE OXA-10
3un7.1.A22.64monomerHHblitsX-ray2.00Å0.300.74Penicillin-binding protein A
3upp.2.A22.64monomerHHblitsX-ray2.40Å0.300.74Penicillin-binding protein A
3upp.1.A22.64monomerHHblitsX-ray2.40Å0.300.74Penicillin-binding protein A
3lo7.1.A22.64monomerHHblitsX-ray2.05Å0.300.74Penicillin-binding protein A
5boh.1.A13.90monomerHHblitsX-ray1.80Å0.260.78Beta-lactamase
3pae.2.A12.89monomerHHblitsX-ray2.10Å0.260.79Beta-lactamase
4f94.1.A12.89monomerHHblitsX-ray2.40Å0.260.79Beta-lactamase
1fof.1.B9.29homo-dimerHHblitsX-ray2.00Å0.250.79BETA LACTAMASE OXA-10
1fof.1.A9.29homo-dimerHHblitsX-ray2.00Å0.250.79BETA LACTAMASE OXA-10
1k6r.1.B9.25homo-dimerHHblitsX-ray2.30Å0.250.79Beta-lactamase PSE-2
1k6r.1.A9.25homo-dimerHHblitsX-ray2.30Å0.250.79Beta-lactamase PSE-2
1k4e.1.A9.25homo-dimerHHblitsX-ray2.00Å0.250.79Beta-lactamase PSE-2
4wz5.1.A9.25homo-dimerHHblitsX-ray1.60Å0.250.79Beta-lactamase OXA-10
3g4p.1.A13.39monomerHHblitsX-ray1.97Å0.260.78Beta-lactamase OXA-24
2wgv.1.A9.29homo-dimerHHblitsX-ray1.80Å0.250.79BETA-LACTAMASE OXA-10
2wgw.1.A9.29homo-dimerHHblitsX-ray1.80Å0.250.79BETA-LACTAMASE OXA-10
2wgw.1.B9.29homo-dimerHHblitsX-ray1.80Å0.250.79BETA-LACTAMASE OXA-10
4p0m.1.A19.63monomerHHblitsX-ray2.00Å0.290.75D-alanyl-D-alanine carboxypeptidase
4mnr.1.A16.67monomerHHblitsX-ray1.65Å0.290.76Peptidoglycan glycosyltransferase
3mfd.1.A17.37monomerHHblitsX-ray1.75Å0.300.74D-alanyl-D-alanine carboxypeptidase dacB
3mfd.2.A17.37monomerHHblitsX-ray1.75Å0.300.74D-alanyl-D-alanine carboxypeptidase dacB
4k0w.1.A11.45monomerHHblitsX-ray1.20Å0.250.79Beta-lactamase
4l0l.1.A16.20monomerHHblitsX-ray2.10Å0.280.76Penicillin-binding protein 3
2x01.1.A8.85homo-dimerHHblitsX-ray1.90Å0.250.79BETA-LACTAMASE OXA-10
2x01.1.B8.85homo-dimerHHblitsX-ray1.90Å0.250.79BETA-LACTAMASE OXA-10
1h8z.1.A9.33homo-dimerHHblitsX-ray1.80Å0.250.79BETA-LACTAMASE
1h8y.1.B9.33homo-dimerHHblitsX-ray2.00Å0.250.79BETA-LACTAMASE
3qnc.1.A8.85homo-dimerHHblitsX-ray1.60Å0.250.79Oxacillinase
2wgi.1.B8.85homo-dimerHHblitsX-ray2.85Å0.250.79BETA-LACTAMASE OXA-10
2wgi.1.A8.85homo-dimerHHblitsX-ray2.85Å0.250.79BETA-LACTAMASE OXA-10
2hpb.1.A8.85homo-dimerHHblitsX-ray2.05Å0.250.79Beta-lactamase PSE-2
4wmc.1.A12.89homo-dimerHHblitsX-ray2.30Å0.250.79Beta-lactamase
5l2f.1.A12.89monomerHHblitsX-ray1.77Å0.250.79Beta-lactamase
4ra7.1.A18.14monomerHHblitsX-ray1.94Å0.290.75Peptidoglycan glycosyltransferase
3equ.1.A19.34monomerHHblitsX-ray2.40Å0.300.74Penicillin-binding protein 2
3equ.2.A19.34monomerHHblitsX-ray2.40Å0.300.74Penicillin-binding protein 2
4jf4.2.A11.50monomerHHblitsX-ray2.14Å0.250.79Beta-lactamase
4jf5.1.A11.50monomerHHblitsX-ray1.15Å0.250.79Beta-lactamase
4jf6.1.A11.50monomerHHblitsX-ray2.50Å0.250.79Beta-lactamase
4k0x.1.A11.50monomerHHblitsX-ray1.61Å0.250.79Beta-lactamase
5e2f.1.A16.51monomerHHblitsX-ray1.30Å0.270.76Beta-lactamase YbxI
5faq.1.A12.95homo-dimerHHblitsX-ray1.96Å0.250.78Beta-lactamase
3qnb.1.A9.29homo-dimerHHblitsX-ray1.95Å0.250.79Oxacillinase
4u3t.1.A16.74monomerHHblitsX-ray2.20Å0.280.75Penicillin-binding protein 2
4u3t.2.A16.74monomerHHblitsX-ray2.20Å0.280.75Penicillin-binding protein 2
2hp5.2.A8.85homo-dimerHHblitsX-ray2.70Å0.250.79Beta-lactamase PSE-2
2hp5.1.B8.85homo-dimerHHblitsX-ray2.70Å0.250.79Beta-lactamase PSE-2
2hp5.1.A8.85homo-dimerHHblitsX-ray2.70Å0.250.79Beta-lactamase PSE-2
4bjp.1.A16.82homo-dimerHHblitsX-ray2.50Å0.290.75PENICILLIN BINDING PROTEIN TRANSPEPTIDASE DOMAIN PROTEIN
1rp5.1.A16.20monomerHHblitsX-ray3.00Å0.280.76penicillin-binding protein 2x
1rp5.2.A16.20monomerHHblitsX-ray3.00Å0.280.76penicillin-binding protein 2x
5haq.1.A12.44homo-dimerHHblitsX-ray2.14Å0.250.79Beta-lactamase
4kqr.1.A15.81monomerHHblitsX-ray2.01Å0.280.75Penicillin-binding protein 3
3ocn.1.A15.81monomerHHblitsX-ray2.61Å0.280.75penicillin-binding protein 3
3ocl.1.A15.81monomerHHblitsX-ray2.30Å0.280.75Penicillin-binding protein 3
3oc2.1.A15.81monomerHHblitsX-ray1.97Å0.280.75Penicillin-binding protein 3
5df9.1.A15.81monomerHHblitsX-ray2.70Å0.280.75Cell division protein
4s2m.1.A12.50homo-dimerHHblitsX-ray2.87Å0.250.78Beta-lactamase
4s2l.1.A12.50homo-dimerHHblitsX-ray1.72Å0.250.78Beta-lactamase
1e3u.2.B8.89hetero-oligomerHHblitsX-ray1.66Å0.250.79BETA-LACTAMASE OXA-10
4ovd.1.A15.81monomerHHblitsX-ray2.00Å0.280.75Peptidoglycan glycosyltransferase
4fsf.1.A15.81monomerHHblitsX-ray2.20Å0.280.75Penicillin-binding protein 3
4wek.1.A15.81monomerHHblitsX-ray1.74Å0.280.75Penicillin-binding protein 3
3pbo.1.A15.81monomerHHblitsX-ray1.74Å0.280.75Penicillin-binding protein 3
3pbr.1.A15.81monomerHHblitsX-ray1.95Å0.280.75Penicillin-binding protein 3
3pbt.1.A15.81monomerHHblitsX-ray1.64Å0.280.75Penicillin-binding protein 3
3pbq.1.A15.81monomerHHblitsX-ray1.70Å0.280.75Penicillin-binding protein 3
3pbn.1.A15.81monomerHHblitsX-ray2.00Å0.280.75Penicillin-binding protein 3
5dts.1.A13.00homo-dimerHHblitsX-ray1.94Å0.250.78Beta-lactamase
3uy6.1.A9.91monomerHHblitsX-ray2.10Å0.260.78Regulatory protein BlaR1
2wki.1.A7.96homo-dimerHHblitsX-ray2.10Å0.240.79BETA-LACTAMASE OXA-10
2wkh.1.B7.96homo-dimerHHblitsX-ray1.79Å0.240.79BETA-LACTAMASE OXA-10
4rye.1.A18.31monomerHHblitsX-ray1.90Å0.290.74D-alanyl-D-alanine carboxypeptidase
1xa1.1.A11.87monomerHHblitsX-ray1.80Å0.270.77Regulatory protein blaR1
1xa7.1.A11.87monomerHHblitsX-ray2.40Å0.270.77Regulatory protein blaR1
1xa7.2.A11.87monomerHHblitsX-ray2.40Å0.270.77Regulatory protein blaR1
2wad.1.A18.14monomerHHblitsX-ray2.18Å0.280.75PENICILLIN-BINDING PROTEIN 2B
2wad.2.A18.14monomerHHblitsX-ray2.18Å0.280.75PENICILLIN-BINDING PROTEIN 2B
2wad.3.A18.14monomerHHblitsX-ray2.18Å0.280.75PENICILLIN-BINDING PROTEIN 2B
5hap.1.A12.56homo-dimerHHblitsX-ray1.89Å0.250.78Beta-lactamase
1pyy.1.A15.28monomerHHblitsX-ray2.42Å0.280.76Penicillin-binding protein 2X
3q7v.1.A11.42monomerHHblitsX-ray2.10Å0.270.77Beta-lactamase regulatory protein BlaR1
4zdx.1.A13.00monomerHHblitsX-ray2.00Å0.250.78Beta-lactamase
1qme.1.A16.28monomerHHblitsX-ray2.40Å0.280.75PENICILLIN-BINDING PROTEIN 2X
4yin.1.A9.38homo-dimerHHblitsX-ray2.30Å0.250.78Beta-lactamase
4yin.1.B9.38homo-dimerHHblitsX-ray2.30Å0.250.78Beta-lactamase
3hbr.1.A13.51homo-dimerHHblitsX-ray1.90Å0.250.78OXA-48
1k25.1.A14.88monomerHHblitsX-ray3.20Å0.280.75low-affinity PENICILLIN-BINDING PROTEIN 2X
1k25.2.A14.88monomerHHblitsX-ray3.20Å0.280.75low-affinity PENICILLIN-BINDING PROTEIN 2X
3ih9.1.A14.35homo-dimerHHblitsX-ray2.50Å0.270.76Salt-tolerant glutaminase
3age.1.A14.35homo-dimerHHblitsX-ray2.60Å0.270.76Salt-tolerant glutaminase
3ihb.2.A14.35homo-dimerHHblitsX-ray2.40Å0.270.76Salt-tolerant glutaminase
2pby.1.A16.51homo-tetramerHHblitsX-ray2.07Å0.290.74Glutaminase
2pby.1.B16.51homo-tetramerHHblitsX-ray2.07Å0.290.74Glutaminase
2pby.1.C16.51homo-tetramerHHblitsX-ray2.07Å0.290.74Glutaminase
5fdh.1.A12.61homo-dimerHHblitsX-ray2.26Å0.250.78Beta-lactamase
5har.1.A11.66homo-dimerHHblitsX-ray1.74Å0.250.78Beta-lactamase
5jyp.1.A12.90homo-tetramerHHblitsX-ray2.74Å0.270.76Glutaminase kidney isoform, mitochondrial
3agf.1.A16.36homo-tetramerHHblitsX-ray2.60Å0.280.75Glutaminase 1
4ztk.1.A13.95monomerHHblitsX-ray2.10Å0.270.75Cell division protein FtsI/penicillin binding protein 2
1u60.1.A17.54homo-dimerHHblitsX-ray1.61Å0.290.74Probable glutaminase ybaS
5tro.1.A15.49homo-dimerHHblitsX-ray1.80Å0.280.74Penicillin-binding protein 1
3brm.1.A15.89homo-dimerHHblitsX-ray2.29Å0.270.75Glutaminase 1
1mki.1.A15.89homo-dimerHHblitsX-ray2.00Å0.270.75Probable Glutaminase ybgJ
3vp1.1.A12.96homo-tetramerHHblitsX-ray2.30Å0.270.76Glutaminase kidney isoform, mitochondrial
3czd.1.A12.96homo-dimerHHblitsX-ray2.40Å0.270.76Glutaminase kidney isoform
4o7d.1.A12.96homo-tetramerHHblitsX-ray2.30Å0.270.76Glutaminase kidney isoform, mitochondrial
4ye5.1.A15.49monomerHHblitsX-ray2.05Å0.280.74Peptidoglycan synthetase penicillin-binding protein 3
4ye5.2.A15.49monomerHHblitsX-ray2.05Å0.280.74Peptidoglycan synthetase penicillin-binding protein 3
5u47.1.A13.68monomerHHblitsX-ray1.95Å0.280.74Penicillin binding protein 2X
2waf.1.A16.43monomerHHblitsX-ray3.29Å0.270.74PENICILLIN-BINDING PROTEIN 2B
2wae.1.A17.92monomerHHblitsX-ray2.26Å0.280.74PENICILLIN-BINDING PROTEIN 2B
5ctn.1.A13.55monomerHHblitsX-ray1.35Å0.270.75Beta-lactamase
5ctm.1.A13.08monomerHHblitsX-ray1.00Å0.270.75Beta-lactamase
5ctm.2.A13.08monomerHHblitsX-ray1.00Å0.270.75Beta-lactamase
3vp4.1.A13.15homo-tetramerHHblitsX-ray2.45Å0.270.74Glutaminase kidney isoform, mitochondrial
2iwc.1.A10.33monomerHHblitsX-ray2.10Å0.260.74METHICILLIN RESISTANCE MECR1 PROTEIN
5hfo.1.A12.96homo-dimerHHblitsX-ray2.21Å0.250.76Beta-lactamase
2iwd.1.A9.91monomerHHblitsX-ray2.40Å0.260.74METHICILLIN RESISTANCE MECR1 PROTEIN
1mwt.1.A13.68monomerHHblitsX-ray2.45Å0.260.74penicillin-binding protein 2a
1mwt.2.A13.68monomerHHblitsX-ray2.45Å0.260.74penicillin-binding protein 2a
1mwr.1.A13.68monomerHHblitsX-ray2.45Å0.260.74penicillin-binding protein 2a
1mwr.2.A13.68monomerHHblitsX-ray2.45Å0.260.74penicillin-binding protein 2a
4bl2.1.A13.68monomerHHblitsX-ray2.72Å0.260.74PENICILLIN BINDING PROTEIN 2 PRIME
4bl2.2.A13.68monomerHHblitsX-ray2.72Å0.260.74PENICILLIN BINDING PROTEIN 2 PRIME
4cjn.1.A13.74homo-dimerHHblitsX-ray1.95Å0.260.74PENICILLIN BINDING PROTEIN 2 PRIME
3zfz.2.A13.74monomerHHblitsX-ray2.25Å0.260.74PENICILLIN BINDING PROTEIN 2 PRIME
3zg0.2.A13.74monomerHHblitsX-ray2.60Å0.260.74PENICILLIN BINDING PROTEIN 2 PRIME
3zfz.1.A13.74monomerHHblitsX-ray2.25Å0.260.74PENICILLIN BINDING PROTEIN 2 PRIME
4cjn.1.B13.74homo-dimerHHblitsX-ray1.95Å0.260.74PENICILLIN BINDING PROTEIN 2 PRIME
3zg5.2.A13.74monomerHHblitsX-ray2.55Å0.260.74PENICILLIN BINDING PROTEIN 2 PRIME
5m19.1.B13.74homo-dimerHHblitsX-ray2.00Å0.260.74Penicillin-binding protein 2
5m1a.2.A13.74monomerHHblitsX-ray2.00Å0.260.74Penicillin-binding protein 2
4cpk.1.A13.74homo-dimerHHblitsX-ray2.35Å0.260.74PENICILLIN BINDING PROTEIN 2 PRIME
4cpk.1.B13.74homo-dimerHHblitsX-ray2.35Å0.260.74PENICILLIN BINDING PROTEIN 2 PRIME
4bl3.1.A13.74monomerHHblitsX-ray3.00Å0.260.74PENICILLIN BINDING PROTEIN 2 PRIME
4bl3.2.A13.74monomerHHblitsX-ray3.00Å0.260.74PENICILLIN BINDING PROTEIN 2 PRIME
4bqm.1.A13.04homo-tetramerHHblitsX-ray2.18Å0.270.72GLUTAMINASE LIVER ISOFORM, MITOCHONDRIAL
2jbf.1.A32.24monomerBLASTX-ray1.70Å0.350.64TLL2115 PROTEIN
2jbf.3.A32.24monomerBLASTX-ray1.70Å0.350.64TLL2115 PROTEIN
2j7v.1.A31.69monomerBLASTX-ray1.90Å0.350.64TLL2115 PROTEIN
2j8y.3.A31.69monomerBLASTX-ray1.90Å0.350.64TLL2115 PROTEIN
4gn2.1.A17.59monomerHHblitsX-ray2.01Å0.270.70Oxacillinase
2z2m.1.B15.71hetero-oligomerHHblitsX-ray2.60Å0.280.67Penicillin-binding protein 2X
2z2m.2.B15.71hetero-oligomerHHblitsX-ray2.60Å0.280.67Penicillin-binding protein 2X
5crf.1.A21.62monomerHHblitsX-ray1.80Å0.300.65Penicillin-binding protein 1A
5crf.2.A21.62monomerHHblitsX-ray1.80Å0.300.65Penicillin-binding protein 1A
5crf.3.A21.62monomerHHblitsX-ray1.80Å0.300.65Penicillin-binding protein 1A
5crf.4.A21.62monomerHHblitsX-ray1.80Å0.300.65Penicillin-binding protein 1A
2zc5.1.B18.92hetero-oligomerHHblitsX-ray3.00Å0.300.65Penicillin-binding protein 1A
2v2f.1.B17.84hetero-oligomerHHblitsX-ray1.90Å0.300.65PENICILLIN BINDING PROTEIN 1A
2c6w.1.B19.02hetero-oligomerHHblitsX-ray2.61Å0.300.64PENICILLIN-BINDING PROTEIN 1A
2c5w.1.B19.02hetero-oligomerHHblitsX-ray2.55Å0.300.64PENICILLIN-BINDING PROTEIN 1A
2je5.1.A18.28monomerHHblitsX-ray2.60Å0.290.65PENICILLIN-BINDING PROTEIN 1B
2jch.1.A18.28monomerHHblitsX-ray2.40Å0.290.65PENICILLIN-BINDING PROTEIN 1B
2y2q.1.A17.74homo-dimerHHblitsX-ray2.15Å0.280.65PENICILLIN-BINDING PROTEIN 1B
2y2q.1.B17.74homo-dimerHHblitsX-ray2.15Å0.280.65PENICILLIN-BINDING PROTEIN 1B
2fff.1.B17.20hetero-oligomerHHblitsX-ray2.23Å0.280.65penicillin-binding protein 1B
2xd1.1.A17.84monomerHHblitsX-ray3.00Å0.290.65PENICILLIN-BINDING PROTEIN 1B
2xd1.2.A17.84monomerHHblitsX-ray3.00Å0.290.65PENICILLIN-BINDING PROTEIN 1B
2xd5.1.A17.84homo-dimerHHblitsX-ray2.50Å0.290.65PENICILLIN-BINDING PROTEIN 1B
2uwx.1.A17.84monomerHHblitsX-ray2.39Å0.290.65PENICILLIN-BINDING PROTEIN 1B
3dwk.1.A15.05monomerHHblitsX-ray3.10Å0.280.65Penicillin-binding protein 2
3dwk.2.A15.05monomerHHblitsX-ray3.10Å0.280.65Penicillin-binding protein 2
3dwk.3.A15.05monomerHHblitsX-ray3.10Å0.280.65Penicillin-binding protein 2
3dwk.4.A15.05monomerHHblitsX-ray3.10Å0.280.65Penicillin-binding protein 2
3zg7.1.B19.23hetero-oligomerHHblitsX-ray1.99Å0.290.64PENICILLIN-BINDING PROTEIN 4
3zg9.1.B19.23hetero-oligomerHHblitsX-ray1.80Å0.290.64PENICILLIN-BINDING PROTEIN 4
3fwm.1.A16.22monomerHHblitsX-ray2.16Å0.270.65Penicillin-binding protein 1B
3fwl.1.A16.22monomerHHblitsX-ray3.09Å0.270.65Penicillin-binding protein 1B
5fgz.1.A16.22monomerHHblitsX-ray2.85Å0.270.65Penicillin-binding protein 1B
5hlb.1.B16.22homo-dimerHHblitsX-ray2.42Å0.270.65Penicillin-binding protein 1B
5hl9.1.A16.22monomerHHblitsX-ray2.70Å0.270.65Penicillin-binding protein 1B
2olv.1.A14.75monomerHHblitsX-ray2.80Å0.280.64Penicillin-binding protein 2
2olu.1.A14.75monomerHHblitsX-ray2.90Å0.280.64Penicillin-binding protein 2
3vma.1.A16.30monomerHHblitsX-ray2.16Å0.270.64Penicillin-binding protein 1B
3wwx.1.A17.22monomerHHblitsX-ray1.49Å0.280.63S12 family peptidase
3rju.1.A15.91monomerHHblitsX-ray1.50Å0.270.62Beta-lactamase/D-alanine Carboxypeptidase
3tg9.1.A16.48homo-dimerHHblitsX-ray2.20Å0.270.62Penicillin-binding protein
2efu.1.A16.38monomerHHblitsX-ray2.30Å0.270.62D-Amino acid amidase
2efx.6.A16.38monomerHHblitsX-ray2.20Å0.270.62D-amino acid amidase
1my8.1.A12.85monomerHHblitsX-ray1.72Å0.250.63beta-lactamase
3gqz.1.A12.85monomerHHblitsX-ray1.80Å0.250.63Beta-lactamase
3gvb.1.A12.85monomerHHblitsX-ray1.80Å0.250.63Beta-lactamase
5tgf.1.A12.99monomerHHblitsX-ray1.81Å0.260.62Uncharacterized protein
1fcn.1.A13.48monomerHHblitsX-ray2.35Å0.260.62BETA-LACTAMASE
1fcn.2.A13.48monomerHHblitsX-ray2.35Å0.260.62BETA-LACTAMASE
3iwi.1.A11.73monomerHHblitsX-ray1.64Å0.250.63Beta-lactamase
4x68.1.A16.57homo-dimerHHblitsX-ray1.68Å0.260.61Beta-lactamase
3ixg.1.A11.11monomerHHblitsX-ray2.14Å0.240.63Beta-lactamase
3ixg.2.A11.11monomerHHblitsX-ray2.14Å0.240.63Beta-lactamase
3ixb.1.A11.17monomerHHblitsX-ray1.63Å0.240.63Beta-lactamase
3iwq.1.B11.17homo-dimerHHblitsX-ray1.84Å0.240.63Beta-lactamase
2zj9.1.A11.17monomerHHblitsX-ray1.70Å0.240.63AmpC
1l0d.1.A11.24monomerHHblitsX-ray1.53Å0.250.62beta-lactamase
4ken.1.A11.24monomerHHblitsX-ray1.89Å0.250.62Beta-lactamase
4nk3.1.A17.24monomerHHblitsX-ray1.90Å0.260.61Beta-lactamase
2qz6.1.A12.64monomerHHblitsX-ray2.26Å0.260.61Beta-lactamase
1fsw.1.A12.36homo-dimerHHblitsX-ray1.90Å0.250.62CEPHALOSPORINASE
1l0f.1.A11.24monomerHHblitsX-ray1.66Å0.250.62beta-lactamase
1l0f.2.A11.24monomerHHblitsX-ray1.66Å0.250.62beta-lactamase
5e2h.1.A12.43monomerHHblitsX-ray1.80Å0.250.62Beta-lactamase
5cgw.1.A11.93monomerHHblitsX-ray1.40Å0.250.62Beta-lactamase
1zc2.1.A11.24monomerHHblitsX-ray2.09Å0.240.62beta-lactamase class C
5e2g.1.A14.37monomerHHblitsX-ray1.65Å0.260.61Beta-lactamase
1l0g.1.A11.24monomerHHblitsX-ray1.50Å0.240.62beta-lactamase
1l0g.2.A11.24monomerHHblitsX-ray1.50Å0.240.62beta-lactamase
4net.1.A9.60monomerHHblitsX-ray1.20Å0.250.62AmpC
4net.2.A9.60monomerHHblitsX-ray1.20Å0.250.62AmpC
3wrz.1.A16.67monomerHHblitsX-ray1.80Å0.260.61Beta-lactamase
2q9m.1.A12.57monomerHHblitsX-ray2.05Å0.250.61Beta-lactamase
3s1y.1.A16.18monomerHHblitsX-ray1.40Å0.260.60Beta-lactamase
4u0t.1.A10.80monomerHHblitsX-ray1.73Å0.250.62ADC-7 beta-lactamase
5evi.1.A12.07monomerHHblitsX-ray1.80Å0.250.61Beta-Lactamase/D-Alanine Carboxypeptidase
3s4x.1.A13.14monomerHHblitsX-ray1.95Å0.250.61Beta-lactamase
1s6r.1.A13.29monomerHHblitsX-ray2.24Å0.260.60beta-lactamase
3wrt.1.A13.79monomerHHblitsX-ray2.90Å0.240.61Beta-lactamase
4xux.1.A12.79monomerHHblitsX-ray1.75Å0.250.60Beta-lactamase
1bls.1.A12.21monomerHHblitsX-ray2.30Å0.250.60BETA-LACTAMASE
2zc7.1.A12.72monomerHHblitsX-ray2.40Å0.250.60Beta-lactamase ACT-1
2zc7.2.A12.72monomerHHblitsX-ray2.40Å0.250.60Beta-lactamase ACT-1
1rgy.1.A11.70monomerHHblitsX-ray1.52Å0.250.60beta-lactamase
3o3v.1.A10.53monomerHHblitsX-ray2.40Å0.250.60beta-lactamase
5cgs.1.A12.50monomerHHblitsX-ray1.63Å0.260.59Beta-lactamase
1pi4.1.A12.35monomerHHblitsX-ray1.39Å0.250.59Beta-lactamase
1pi4.2.A12.35monomerHHblitsX-ray1.39Å0.250.59Beta-lactamase
3ixd.1.A13.69monomerHHblitsX-ray2.64Å0.250.59Beta-lactamase
2ex2.1.A16.25homo-dimerHHblitsX-ray1.55Å0.290.56Penicillin-binding protein 4
2exa.1.A16.25monomerHHblitsX-ray1.70Å0.290.56Penicillin-binding protein 4
5evl.1.A11.38monomerHHblitsX-ray1.52Å0.240.58Beta-lactamase
3v39.1.A14.29monomerHHblitsX-ray1.45Å0.270.56D-alanyl-D-alanine carboxypeptidase
3a3d.1.A16.46homo-dimerHHblitsX-ray1.60Å0.280.55Penicillin-binding protein 4
3a3d.1.B16.46homo-dimerHHblitsX-ray1.60Å0.280.55Penicillin-binding protein 4
5cer.1.A15.19hetero-oligomerHHblitsX-ray2.48Å0.270.55Bd0816
2xdm.1.A17.53monomerHHblitsX-ray2.40Å0.290.54D-ALANYL-D-ALANINE CARBOXYPEPTIDASE
2xdm.3.A17.53monomerHHblitsX-ray2.40Å0.290.54D-ALANYL-D-ALANINE CARBOXYPEPTIDASE
1w5d.1.A16.03monomerHHblitsX-ray2.10Å0.270.55PENICILLIN-BINDING PROTEIN
3zcz.1.A17.53monomerHHblitsX-ray2.60Å0.280.54D-ALANYL-D-ALANINE CARBOXYPEPTIDASE
1w8q.1.A17.53monomerHHblitsX-ray2.85Å0.280.54D-ALANYL-D-ALANINE CARBOXYPEPTIDASE
2vgj.2.A17.53monomerHHblitsX-ray2.40Å0.280.54D-ALANYL-D-ALANINE CARBOXYPEPTIDASE
3c21.1.A11.61homo-octamerHHblitsX-ray2.70Å0.270.54DNA integrity scanning protein disA
3c23.1.A11.61homo-octamerHHblitsX-ray2.50Å0.270.54DNA integrity scanning protein disA
4yvz.1.A11.61homo-octamerHHblitsX-ray2.50Å0.270.54DNA integrity scanning protein DisA
3i7j.1.A16.88monomerHHblitsX-ray2.20Å0.270.54beta-lactamase Mb2281c
4y7p.1.A19.46monomerHHblitsX-ray2.10Å0.290.52Alkaline D-peptidase
4hef.1.A17.81monomerHHblitsX-ray1.86Å0.270.51Beta-lactamase
4ooy.1.A17.81monomerHHblitsX-ray1.10Å0.270.51Beta-lactamase
4oon.1.A21.43monomerHHblitsX-ray3.20Å0.300.49Penicillin-binding protein 1A
4wyy.1.A17.12monomerHHblitsX-ray1.28Å0.270.51Beta-lactamase
2wzx.1.A16.55monomerHHblitsX-ray1.40Å0.270.51BETA-LACTAMASE
4gzb.1.A16.55monomerHHblitsX-ray1.79Å0.270.51Beta-lactamase
5u2g.1.A19.15monomerHHblitsX-ray2.61Å0.290.49Penicillin-binding protein 1A
3udf.1.A20.00homo-dimerHHblitsX-ray1.70Å0.290.49Penicillin-binding protein 1a
3udf.1.B20.00homo-dimerHHblitsX-ray1.70Å0.290.49Penicillin-binding protein 1a
3udi.1.A20.00homo-dimerHHblitsX-ray2.60Å0.290.49Penicillin-binding protein 1a
3udi.1.B20.00homo-dimerHHblitsX-ray2.60Å0.290.49Penicillin-binding protein 1a
3ue1.1.A20.00homo-dimerHHblitsX-ray2.73Å0.290.49Penicillin-binding protein 1a
4qd4.1.A12.41monomerHHblitsX-ray1.80Å0.260.51Beta-lactamase ADC-68
3w8k.1.A14.18monomerHHblitsX-ray1.50Å0.260.49Beta-lactamase
4ewf.1.A37.19monomerBLASTX-ray2.00Å0.370.42Beta-lactamase
5ceb.1.A15.67monomerHHblitsX-ray1.93Å0.280.47Bd3459
5cec.1.A14.07hetero-oligomerHHblitsX-ray1.36Å0.270.47Bd3459
3cjm.1.A34.00monomerBLASTX-ray1.50Å0.350.35Putative beta-lactamase
4dxb.1.A100.00monomerBLASTX-ray2.29Å0.610.21Maltose-binding periplasmic protein, Beta-lactamase TEM chimera
4dxc.1.A100.00monomerBLASTX-ray2.30Å0.610.21Maltose-binding periplasmic protein, Beta-lactamase TEM chimera
4lcm.1.A14.93monomerHHblitsX-ray3.19Å0.280.23Transesterase
3hlc.1.A16.42monomerHHblitsX-ray2.00Å0.270.23Transesterase
4lcl.1.A14.93monomerHHblitsX-ray1.80Å0.270.23Transesterase
3hlf.1.A14.93monomerHHblitsX-ray2.00Å0.270.23Transesterase
2qmi.1.A15.15homo-octamerHHblitsX-ray2.20Å0.270.23Pbp related beta-lactamase
5f1f.1.A17.91monomerHHblitsX-ray1.55Å0.260.23Beta-lactamase
1ei5.1.A16.92homo-dimerHHblitsX-ray1.90Å0.290.23D-AMINOPEPTIDASE
2zm0.1.A19.05homo-dimerHHblitsX-ray1.50Å0.300.226-aminohexanoate-dimer hydrolase
3vwl.1.A19.05homo-dimerHHblitsX-ray1.60Å0.300.226-aminohexanoate-dimer hydrolase
2e8i.1.A19.05monomerHHblitsX-ray1.45Å0.300.226-aminohexanoate-dimer hydrolase
3vwn.1.A19.05homo-dimerHHblitsX-ray1.20Å0.300.226-aminohexanoate-dimer hydrolase
1wyb.1.A19.05monomerHHblitsX-ray1.80Å0.300.226-aminohexanoate-dimer hydrolase
3vwm.1.A19.05homo-dimerHHblitsX-ray1.60Å0.300.226-aminohexanoate-dimer hydrolase
1wyc.1.A19.05monomerHHblitsX-ray1.58Å0.300.226-aminohexanoate-dimer hydrolase
2zly.1.A19.05homo-dimerHHblitsX-ray1.58Å0.300.226-aminohexanoate-dimer hydrolase
3vwr.1.A17.46homo-dimerHHblitsX-ray1.65Å0.300.226-aminohexanoate-dimer hydrolase
3vwp.1.A17.46homo-dimerHHblitsX-ray1.55Å0.300.226-aminohexanoate-dimer hydrolase
3vwq.1.A17.46homo-dimerHHblitsX-ray1.70Å0.300.226-aminohexanoate-dimer hydrolase
3a66.1.A17.46homo-dimerHHblitsX-ray1.60Å0.300.226-AMINOHEXANOATE-DIMER HYDROLASE
2zm7.1.A17.46homo-dimerHHblitsX-ray1.60Å0.300.226-aminohexanoate-dimer hydrolase
2zm8.1.A17.46homo-dimerHHblitsX-ray1.55Å0.300.226-aminohexanoate-dimer hydrolase
2zm2.1.A19.05homo-dimerHHblitsX-ray1.55Å0.300.226-aminohexanoate-dimer hydrolase
3a65.1.A17.46homo-dimerHHblitsX-ray1.70Å0.300.226-aminohexanoate-dimer hydrolase
2zm9.1.A17.46homo-dimerHHblitsX-ray1.50Å0.300.226-aminohexanoate-dimer hydrolase
5f1g.1.A13.43monomerHHblitsX-ray1.76Å0.250.23Beta-lactamase
4ivi.1.A19.05monomerHHblitsX-ray2.00Å0.290.22Carboxylesterase
4p6b.1.A13.64homo-octamerHHblitsX-ray1.70Å0.260.23Est-Y29
4p85.1.A13.64homo-octamerHHblitsX-ray2.00Å0.260.23Est-Y29
1zkj.1.A18.46monomerHHblitsX-ray1.55Å0.270.23extended-spectrum beta-lactamase
5hai.1.A13.85monomerHHblitsX-ray2.74Å0.260.23Beta-lactamase
4gdn.1.A14.29monomerHHblitsX-ray3.20Å0.280.22Protein flp
4gdn.2.A14.29monomerHHblitsX-ray3.20Å0.280.22Protein flp
4gdn.3.A14.29monomerHHblitsX-ray3.20Å0.280.22Protein flp
4gdn.4.A14.29monomerHHblitsX-ray3.20Å0.280.22Protein flp
4gb7.1.A16.13monomerHHblitsX-ray1.60Å0.290.226-aminohexanoate-dimer hydrolase
1i5q.1.A13.85monomerHHblitsX-ray1.83Å0.250.23BETA-LACTAMASE
1i5q.2.A13.85monomerHHblitsX-ray1.83Å0.250.23BETA-LACTAMASE
3fkv.1.A12.31monomerHHblitsX-ray1.85Å0.250.23Beta-lactamase
3fkv.2.A12.31monomerHHblitsX-ray1.85Å0.250.23Beta-lactamase
1l0e.1.A12.31monomerHHblitsX-ray1.90Å0.250.23beta-lactamase
1l0e.2.A12.31monomerHHblitsX-ray1.90Å0.250.23beta-lactamase
3iwo.1.A14.06monomerHHblitsX-ray1.90Å0.260.22Beta-lactamase
1y54.1.A12.50monomerHHblitsX-ray2.10Å0.250.22Beta-lactamase
3zyt.1.A10.94homo-trimerHHblitsX-ray2.45Å0.230.22ESTERASE A
1ci9.1.A28.00homo-dimerHHblitsX-ray1.80Å0.310.17PROTEIN (CARBOXYLESTERASE)
1rgz.1.A16.67monomerHHblitsX-ray1.37Å0.270.13class C beta-lactamase
1ga0.1.A16.67monomerHHblitsX-ray1.60Å0.270.13BETA-LACTAMASE
1gce.1.A16.67monomerHHblitsX-ray1.80Å0.270.13BETA-LACTAMASE
4e6x.1.A16.67monomerHHblitsX-ray2.24Å0.260.13ClbP peptidase
1fr1.1.A13.89monomerHHblitsX-ray2.00Å0.260.13BETA-LACTAMASE
3hl9.1.A17.14monomerHHblitsX-ray3.40Å0.280.12Transesterase